HHsearch alignment for GI: 254780795 and conserved domain: cd05064

>cd05064 PTKc_EphR_A10 Catalytic Domain of the Protein Tyrosine Kinase, Ephrin Receptor A10. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor
Probab=94.68  E-value=0.11  Score=30.50  Aligned_cols=30  Identities=20%  Similarity=0.269  Sum_probs=24.6

Q ss_pred             CCEEECCCCCCCEEECCCCCEEEECCCCCC
Q ss_conf             744402234642256279604873162135
Q gi|254780795|r  184 TGIIHADLFPDNVLFYNNKIMGLIDFYFSC  213 (316)
Q Consensus       184 ~g~IHgDl~~~NiL~~~~~i~giIDF~~~~  213 (316)
T Consensus       126 ~~iiHrDlK~~NiLl~~~~~~Kl~DFG~~~  155 (266)
T cd05064         126 MGYVHKGLAAHKVLVNSDLVCKISGFRRLQ  155 (266)
T ss_pred             CCEEECCCCHHHEEECCCCCEEECCCCCCC
T ss_conf             895506766550898899978988773644