>cd05074 PTKc_Tyro3 Catalytic Domain of the Protein Tyrosine Kinase, Tyro3. Protein Tyrosine Kinase (PTK) family; Tyro3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyro3 (or Sky) is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Tyro3 is predominantly expressed in the central nervous system and the brain, and functions as a neurotrophic fac

Probab=94.57  E-value=0.025  Score=34.66  Aligned_cols=30  Identities=30%  Similarity=0.411  Sum_probs=24.9

Q ss_pred             CCEEECCCCCCCEEECCCCCEEEECCCCCC
Q ss_conf             744402234642256279604873162135
Q gi|254780795|r  184 TGIIHADLFPDNVLFYNNKIMGLIDFYFSC  213 (316)
Q Consensus       184 ~g~IHgDl~~~NiL~~~~~i~giIDF~~~~  213 (316)
T Consensus       132 ~~iiHRDlKp~NiLl~~~~~~kl~DFGls~  161 (273)
T cd05074         132 KNFIHRDLAARNCMLNENMTVCVADFGLSK  161 (273)
T ss_pred             CCCCCCCCCCCEEEECCCCCEEEEECCCCE
T ss_conf             893625565655899899978998468762