HHsearch alignment for GI: 254780795 and conserved domain: cd05106

>cd05106 PTKc_CSF-1R Catalytic Domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-stimulating factor-1 receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti
Probab=90.36  E-value=0.21  Score=28.66  Aligned_cols=30  Identities=27%  Similarity=0.459  Sum_probs=26.3

Q ss_pred             CCEEECCCCCCCEEECCCCCEEEECCCCCC
Q ss_conf             744402234642256279604873162135
Q gi|254780795|r  184 TGIIHADLFPDNVLFYNNKIMGLIDFYFSC  213 (316)
Q Consensus       184 ~g~IHgDl~~~NiL~~~~~i~giIDF~~~~  213 (316)
T Consensus       231 ~~iIHRDLaarNiLv~~~~~vKIaDFGLsr  260 (374)
T cd05106         231 KNCIHRDVAARNVLLTDGRVAKICDFGLAR  260 (374)
T ss_pred             CCEECCCCCHHEEEECCCCCEEEEECCCCC
T ss_conf             892327677401898689829995361010