HHsearch alignment for GI: 254780795 and conserved domain: cd05107

>cd05107 PTKc_PDGFR_beta Catalytic Domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D
Probab=90.06  E-value=0.19  Score=28.95  Aligned_cols=30  Identities=30%  Similarity=0.491  Sum_probs=26.6

Q ss_pred             CCEEECCCCCCCEEECCCCCEEEECCCCCC
Q ss_conf             744402234642256279604873162135
Q gi|254780795|r  184 TGIIHADLFPDNVLFYNNKIMGLIDFYFSC  213 (316)
Q Consensus       184 ~g~IHgDl~~~NiL~~~~~i~giIDF~~~~  213 (316)
T Consensus       258 ~~iiHRDLaarNiLv~~~~~~KIaDFGlar  287 (401)
T cd05107         258 KNCVHRDLAARNVLICEGKLVKICDFGLAR  287 (401)
T ss_pred             CCCCCCCCCCCEEEECCCCCEEECCCEEEE
T ss_conf             787254466043897489938968361003