HHsearch alignment for GI: 254780798 and conserved domain: pfam03888

>pfam03888 MucB_RseB MucB/RseB family. Members of this family are regulators of the anti-sigma E protein RseD.
Probab=98.27  E-value=0.00023  Score=43.56  Aligned_cols=188  Identities=9%  Similarity=0.031  Sum_probs=110.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCEEEEEEEEEECCCEEEEEEEEE-CCC--EEEEEECCCC
Q ss_conf             8999999999999999997403444310179999998612670699999961895599999996-698--6999971664
Q gi|254780798|r    6 YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMA-RPS--KFYFKYSSPS   82 (204)
Q Consensus         6 mk~i~~~~i~~~~~~~~~~~a~~~~~~~~~~~~i~~~l~~~~t~~a~F~Q~~~~~~~~G~~~~k-kP~--k~rw~y~~P~   82 (204)
T Consensus         1 ~~~~~~~~~~~~~l~-~~~~a~a~~sa~~~L~~M~~A~~-~lnY~G~fvy~~~~~i~s~ri~H~~~~g~e~erL~~LdG~   78 (314)
T pfam03888         1 MKKLKSLTLLLGSLL-ASPTAQAEDSAQALLNRMNEASQ-QLSYEGSFVYERNGSFSSLRYRHARQDGKSYAQLLQLDGP   78 (314)
T ss_pred             CCHHHHHHHHHHHHH-CCCCCCCCCCHHHHHHHHHHHHH-HCCEEEEEEEEECCEEEEEEEEEEECCCEEEEEEEECCCC
T ss_conf             925887999999873-57333466789999999999887-5774799999919902159999995599699999954998


Q ss_pred             EEEEEEECEEEEEEECCCCCCCCHHHHHHHHH-HHCCHHHHHHHHCCC--C----CCCCCCEEEEECCCCCCCCEEEEEE
Q ss_conf             15777512059997133343210111111233-210001212221011--3----2235727997204666663479999
Q gi|254780798|r   83 SVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS-VIFSNNQHVIQESIQ--R----VESNNSFITIFFKDDFMGNMISVTF  155 (204)
Q Consensus        83 ~~~iv~~g~~l~~~d~~~~q~~~~~~~~~~~~-~~~~~~~~~~~~~~~--~----~~~~~~~~~~~~~~~~~~~~i~l~f  155 (204)
T Consensus        79 ~rEiiR~~d~v~~~~p~~~~~~~~~~~~~~~~p~~~~~~~~l~~~Y~~~~~G~~RVAGR~a~~v~l~PkD~~RYgy~lWi  158 (314)
T pfam03888        79 QQEVVRRDNLVSYFSPGLEPFTINSGMIADSLPVMNTDFKRLSSYYDFVKVGRSRVAGRAAQVIRVVPKDQFRYGYELHL  158 (314)
T ss_pred             HHEEEEECCEEEEECCCCCCEEEECCCCCCCCCCCCCCHHHHHHCCCEEECCCCEECCCEEEEEEEEECCCCCEEEEEEE
T ss_conf             00289969999999179840687466567777656689889853566599897318885569999986888824789999


Q ss_pred             ECCCCEEEEEEEEECCCCEE-EEEEEEEECCCCCCHHHCCC
Q ss_conf             36984299999996799879-99997432288689655126
Q gi|254780798|r  156 DRLSYRLLNWKIMDSSRRYS-IIKILKYKENTVLDPKVFEI  195 (204)
Q Consensus       156 ~~~~~~l~~~~i~D~~G~~t-~i~f~ni~~N~~i~~~~F~f  195 (204)
T Consensus       159 D~etgLlLks~lld~~g~vLEqf~ft~l~v~~~~~~~~~~~  199 (314)
T pfam03888       159 DEETGLPLRSDLLDRDGQLLEQFRVTQLDTGDRLALSEDYL  199 (314)
T ss_pred             ECCCCCEEEEHHHCCCCCEEEEEEEEEEEECCCCCHHHHHH
T ss_conf             55789786603336799789999999998267657667641