BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780798|ref|YP_003065211.1| possible lolA type protein
[Candidatus Liberibacter asiaticus str. psy62]
         (204 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780798|ref|YP_003065211.1| possible lolA type protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040475|gb|ACT57271.1| possible lolA type protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 204

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 204/204 (100%), Positives = 204/204 (100%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY 60
           MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY
Sbjct: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY 60

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
           VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN
Sbjct: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
           QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL
Sbjct: 121 QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180

Query: 181 KYKENTVLDPKVFEIPYDKIHNIN 204
           KYKENTVLDPKVFEIPYDKIHNIN
Sbjct: 181 KYKENTVLDPKVFEIPYDKIHNIN 204


>gi|315122020|ref|YP_004062509.1| possible lolA type protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495422|gb|ADR52021.1| possible lolA type protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 207

 Score =  228 bits (582), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 147/180 (81%), Gaps = 3/180 (1%)

Query: 27  AYPIT--KDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSS 83
           AY I   K+ +V+KAI+HFLSIQT+QG F+QED  G V+KGEFFM RPSKFYFKYSSPSS
Sbjct: 27  AYSIVDIKEHAVQKAIDHFLSIQTIQGIFVQEDTVGNVIKGEFFMTRPSKFYFKYSSPSS 86

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFK 143
            SL+SDG N+A+YNAKLD W+VYPL   AF +IFSN ++ +Q+SIQR+E+NN+FIT+FF+
Sbjct: 87  GSLVSDGRNVAIYNAKLDAWTVYPLPNTAFGIIFSNKRNEMQQSIQRIETNNAFITLFFR 146

Query: 144 DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           +    NMIS+TFDRLSYRLLNW+I DSS    ++KILKYKEN  L  ++F IPYDKIHNI
Sbjct: 147 EVLTKNMISLTFDRLSYRLLNWEITDSSGTSILVKILKYKENITLKSELFVIPYDKIHNI 206


>gi|222150121|ref|YP_002551078.1| possible lolA type protein [Agrobacterium vitis S4]
 gi|221737103|gb|ACM38066.1| possible lolA type protein [Agrobacterium vitis S4]
          Length = 220

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/165 (33%), Positives = 89/165 (53%), Gaps = 3/165 (1%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF S++TM G F+Q    G    G+F++ RP K  F Y  PS + +ISDG N+A+ N K
Sbjct: 54  DHFASVKTMMGEFVQFGPRGEQTAGKFYIERPGKLRFNYEQPSPMRVISDGRNVAIGNLK 113

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDR 157
           + TW VYPL     S++ S+   +  + +++V+      TI   D   F    I++ FD 
Sbjct: 114 MKTWDVYPLSKTPLSLLLSDRIDLGHQMVRQVKEEQDLTTIVLGDKSIFGDQTITLMFDP 173

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
            ++ L  W + D+  + + + I   ++    D KVFE+PYD I N
Sbjct: 174 KTFELRQWTVTDAQGKDTSVMIFNVQQGVNFDEKVFEVPYDDIRN 218


>gi|255597485|ref|XP_002536785.1| conserved hypothetical protein [Ricinus communis]
 gi|223518556|gb|EEF25598.1| conserved hypothetical protein [Ricinus communis]
          Length = 222

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 106/202 (52%), Gaps = 5/202 (2%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNA-AYPITKDQSVKKAI-EHFLSIQTMQGTFLQ-EDAGY 60
           L  + ++G + L   SA  P N  A       +  +AI +HF S+ TMQG F+Q    G 
Sbjct: 13  LTRRHMLGAMALVAASAALPVNVFAQAAAGGSATAQAIADHFSSVGTMQGEFVQFGPRGE 72

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
              G+FF+ RP K  F Y  PS + +I+DG N+AV N KL TW++YPL     S++ +  
Sbjct: 73  QTGGKFFIQRPGKLRFNYDDPSPIRVIADGKNVAVGNLKLKTWNLYPLSKTPLSLLLAQK 132

Query: 121 QHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
            ++   S++ V+  +   TI   ++  F  + I++ FD  +Y L  W I D+  + + + 
Sbjct: 133 INLSDGSVKSVKEESDLTTIALGNNTVFGNSTITMMFDPKTYDLRQWTITDNQGKDTSVM 192

Query: 179 ILKYKENTVLDPKVFEIPYDKI 200
           +   K     D KVF++PY+ I
Sbjct: 193 VFNVKTGVQFDDKVFKVPYESI 214


>gi|150398247|ref|YP_001328714.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium
           medicae WSM419]
 gi|150029762|gb|ABR61879.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium
           medicae WSM419]
          Length = 220

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/165 (33%), Positives = 90/165 (54%), Gaps = 3/165 (1%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF S++TM G F+Q    G    G+F++ RP +  F Y +PS + +I+DG ++ + N K
Sbjct: 51  DHFSSVKTMAGEFVQFGPRGEQTGGKFYIRRPGRIRFNYEAPSPMRVIADGKSVVIGNMK 110

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDR 157
           L TW +YPL     +++ S    +  + ++ V+     ITI   D   F  + I++ FD 
Sbjct: 111 LKTWDIYPLSKTPLNLLLSERIDLSSKMVRDVKVEADLITIVLGDRSIFGDSTITMMFDP 170

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
            SY L  W I D+ R+ + + I   +    LD KVF IPYD++ N
Sbjct: 171 KSYNLRQWTITDAQRKDTSVMIFNVRTGIALDDKVFRIPYDEVRN 215


>gi|227823662|ref|YP_002827635.1| putative outer membrane lipoproteins carrier protein [Sinorhizobium
           fredii NGR234]
 gi|227342664|gb|ACP26882.1| putative outer membrane lipoproteins carrier protein [Sinorhizobium
           fredii NGR234]
          Length = 220

 Score =  111 bits (277), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 89/168 (52%), Gaps = 3/168 (1%)

Query: 38  KAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY 96
           K  +HF S++TM G F+Q    G    G+F++ RP +  F Y +PS + +I+DG ++ + 
Sbjct: 49  KIADHFSSVKTMAGEFVQFGPRGEQTGGKFYIRRPGRIRFNYEAPSPMRVIADGRSVVIG 108

Query: 97  NAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVT 154
           N KL TW +YPL     +++ S    +    ++ V      ITI   D   F  + I++ 
Sbjct: 109 NMKLKTWDIYPLSKTPLNLLLSERIDLSSRMVRDVRVEPDLITIVLGDRSIFGDSTITMM 168

Query: 155 FDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
           FD  SY L  W I D+ ++ + + I   +    LD KVF IPYD++ N
Sbjct: 169 FDPKSYNLRQWTITDAQKKDTSVMIFNVQTGIALDDKVFRIPYDEVRN 216


>gi|15966945|ref|NP_387298.1| hypothetical protein SMc03809 [Sinorhizobium meliloti 1021]
 gi|307301718|ref|ZP_07581477.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium
           meliloti BL225C]
 gi|307316258|ref|ZP_07595702.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium
           meliloti AK83]
 gi|15076218|emb|CAC47771.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306898098|gb|EFN28840.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium
           meliloti AK83]
 gi|306903416|gb|EFN34005.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium
           meliloti BL225C]
          Length = 220

 Score =  110 bits (276), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 88/165 (53%), Gaps = 3/165 (1%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF S++TM G F+Q    G    G+F++ RP +  F Y +PS + +I+DG ++ + N K
Sbjct: 51  DHFSSVKTMAGEFVQFGPRGEQTGGKFYIRRPGRIRFNYEAPSPMRVIADGKSVVIGNMK 110

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDR 157
           L TW +YPL     +++ S    +    ++ V      ITI   D   F  + I++ FD 
Sbjct: 111 LKTWDIYPLSKTPLNLLLSERIDLRSRMVRDVRVEADLITIVLGDRSIFGDSTITMMFDP 170

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
            SY L  W I D+ ++ + + I   +    LD KVF IPYD++ N
Sbjct: 171 KSYNLRQWTITDAQKKDTSVMIFNVRTGIALDDKVFRIPYDEVRN 215


>gi|325294130|ref|YP_004279994.1| outer-membrane lipoprotein carrier protein [Agrobacterium sp.
           H13-3]
 gi|325061983|gb|ADY65674.1| outer-membrane lipoprotein carrier protein [Agrobacterium sp.
           H13-3]
          Length = 224

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 99/199 (49%), Gaps = 8/199 (4%)

Query: 11  GVVILFFYSAIF----PFNA-AYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKG 64
           GV+  F  +A+     P NA A       + +K   HF S++TM G F+Q    G    G
Sbjct: 23  GVLTAFSMAAVMAGLSPLNAFAQAAGNSATAQKIANHFSSVKTMMGEFVQFGPRGEQTGG 82

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
           +F++ RP K  F Y  PS + +ISDG N+ + N KL TW +YPL     S++ S+   + 
Sbjct: 83  KFYIERPGKLRFNYEDPSPMRVISDGKNVVIGNMKLKTWDLYPLSKTPLSLLLSDKIDLS 142

Query: 125 QESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
            + ++ V+  +   TI   D   F  + I++ FD  ++ L  W   D+  + + + I   
Sbjct: 143 NQKVRNVKEESDLTTIVLGDKSVFGDSTITLMFDPKTFDLRQWTTTDAQNKDTTVMIFNV 202

Query: 183 KENTVLDPKVFEIPYDKIH 201
           +    LD +VF I Y+++ 
Sbjct: 203 QTGVNLDERVFNINYEEVR 221


>gi|159185367|ref|NP_355690.2| hypothetical protein Atu2760 [Agrobacterium tumefaciens str. C58]
 gi|159140618|gb|AAK88475.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 224

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 99/199 (49%), Gaps = 8/199 (4%)

Query: 11  GVVILFFYSAIF----PFNA-AYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKG 64
           GV+  F  +A+     P NA A       + +K   HF S++TM G F+Q    G    G
Sbjct: 23  GVLTAFSMAAVIAGLSPLNAFAQAAGNGATAQKIANHFSSVKTMMGEFVQFGPRGEQTGG 82

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
           +F++ RP K  F Y  PS + +ISDG N+ + N KL TW +YPL     S++ S+   + 
Sbjct: 83  KFYIERPGKLRFNYEDPSPMRVISDGKNVVIGNMKLKTWDLYPLSKTPLSLLLSDKIDLG 142

Query: 125 QESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
            + ++ V+  +   TI   D   F  + I++ FD  ++ L  W   D+  + + + I   
Sbjct: 143 NQKVRDVKEESDLTTIVLGDKSVFGDSTITLMFDPKTFDLRQWTTTDAQNKDTTVMIFNV 202

Query: 183 KENTVLDPKVFEIPYDKIH 201
           +    LD +VF I Y+++ 
Sbjct: 203 QTGVNLDERVFNINYEEVR 221


>gi|209551338|ref|YP_002283255.1| outer membrane lipoprotein carrier protein LolA [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209537094|gb|ACI57029.1| outer membrane lipoprotein carrier protein LolA [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 222

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 87/163 (53%), Gaps = 3/163 (1%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF  + TMQG F+Q    G    G+FF+ RP K  F Y  PS + +I+DG N+A+ N K
Sbjct: 52  DHFSGVTTMQGEFVQFGPRGEQTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNVAIGNTK 111

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDR 157
           L TW +YPL     S++ + +  +    ++RV+  +   TI   ++  F  + I++ FD 
Sbjct: 112 LKTWDLYPLSKTPLSLLLAQHIDLSAGMVKRVKEESDLTTIALGNNTVFGNSTITMMFDP 171

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
            +Y L  W I D+  + + + I   K     D +VF +PY+ I
Sbjct: 172 KTYDLRQWTITDNQGKDTSVMIFNVKTGMQFDDRVFRVPYESI 214


>gi|163757410|ref|ZP_02164499.1| hypothetical protein HPDFL43_18407 [Hoeflea phototrophica DFL-43]
 gi|162284912|gb|EDQ35194.1| hypothetical protein HPDFL43_18407 [Hoeflea phototrophica DFL-43]
          Length = 233

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 90/170 (52%), Gaps = 3/170 (1%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           + ++  +HF S++TM G F+Q    G    G+FF+ RP K  F Y +PSSV +I+DG  +
Sbjct: 57  AAQRVADHFASVKTMTGEFIQFGPNGEQTGGKFFIDRPGKLRFNYEAPSSVRVIADGKAV 116

Query: 94  AVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMI 151
            + N KL TW +YPL      ++ ++   +  + ++ V  +   ITI   +   F  + I
Sbjct: 117 VIGNRKLRTWDLYPLNKTPLKLLLADRIDLSADMVRSVTEDPDLITIVLGNKTIFGDSTI 176

Query: 152 SVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIH 201
           S+ FD  S+ L  W I D+  + + + I   +        VF++PYD++H
Sbjct: 177 SLMFDPKSFELRQWTIRDAQGKDTSVMIFNVRTGVTFASNVFKVPYDQVH 226


>gi|86359551|ref|YP_471443.1| putative outer membrane lipoproteins carrier protein [Rhizobium
           etli CFN 42]
 gi|86283653|gb|ABC92716.1| putative outer membrane lipoproteins carrier protein [Rhizobium
           etli CFN 42]
          Length = 222

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 86/163 (52%), Gaps = 3/163 (1%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF  + TMQG F+Q    G    G+FF+ RP K  F Y  PS + +I+DG N+A+ N K
Sbjct: 52  DHFSGVTTMQGEFVQFGPRGEQTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNVAIGNTK 111

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDR 157
           L TW +YPL     S++ + +  +    ++ V+  +   TI   ++  F  + I++ FD 
Sbjct: 112 LKTWDLYPLSKTPLSLLLAQHIDLSAGMVKGVKEESDLTTIALGNNTVFGNSTITMMFDP 171

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
            +Y L  W I D+  + + + I   K     D +VF +PY+ I
Sbjct: 172 KTYDLRQWTITDNQGKDTSVMIFNVKTGVQFDDRVFRVPYESI 214


>gi|116254289|ref|YP_770127.1| hypothetical protein RL4562 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258937|emb|CAK10046.1| conserved hypothetical exported protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 222

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 86/163 (52%), Gaps = 3/163 (1%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF  + TMQG F+Q    G    G+FF+ RP K  F Y +PS + +I+DG N+A+ N K
Sbjct: 52  DHFSGVTTMQGEFVQFGPRGEQTGGKFFIQRPGKLRFNYDAPSPMRVIADGRNVAIGNTK 111

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDR 157
           L TW +YPL     S++ +    +    ++ V+  +   TI   ++  F  + I++ FD 
Sbjct: 112 LKTWDLYPLSKTPLSLLLARRIDLSAGMVKGVKEESDLTTIALGNNTVFGNSTITMMFDP 171

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
            +Y L  W I D+  + + + I   K     D +VF +PY+ I
Sbjct: 172 KTYDLRQWTITDNQGKDTSVMIFNVKTGMQFDDRVFRVPYETI 214


>gi|327190168|gb|EGE57273.1| putative outer membrane lipoproteins carrier protein [Rhizobium
           etli CNPAF512]
          Length = 222

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 86/163 (52%), Gaps = 3/163 (1%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF  + TMQG F+Q    G    G+FF+ RP K  F Y  PS + +I+DG N+A+ N K
Sbjct: 52  DHFSGVTTMQGEFVQFGPRGEQTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNVAIGNTK 111

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDR 157
           L TW +YPL     S++ + +  +    ++ V+  +   TI   ++  F  + I++ FD 
Sbjct: 112 LKTWDLYPLSKTPLSLLLAQHIDLSAGMVKGVKEESDLTTIALGNNTVFGNSTITMMFDP 171

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
            +Y L  W I D+  + + + I   K     D +VF +PY+ I
Sbjct: 172 KTYDLRQWTITDNQGKDTSVMIFNVKTGMQFDDRVFRVPYESI 214


>gi|190893819|ref|YP_001980361.1| outer membrane lipoproteins carrier protein [Rhizobium etli CIAT
           652]
 gi|190699098|gb|ACE93183.1| putative outer membrane lipoproteins carrier protein [Rhizobium
           etli CIAT 652]
          Length = 222

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 86/163 (52%), Gaps = 3/163 (1%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF  + TMQG F+Q    G    G+FF+ RP K  F Y  PS + +I+DG N+A+ N K
Sbjct: 52  DHFSGVTTMQGEFVQFGPRGEQTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNVAIGNTK 111

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDR 157
           L TW +YPL     S++ + +  +    ++ V+  +   TI   ++  F  + I++ FD 
Sbjct: 112 LKTWDLYPLSKTPLSLLLAQHIDLSAGMVKGVKEESDLTTIALGNNTVFGNSTITMMFDP 171

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
            +Y L  W I D+  + + + I   K     D +VF +PY+ I
Sbjct: 172 KTYDLRQWTITDNQGKDTSVMIFNVKTGMQFDDRVFRVPYESI 214


>gi|241206775|ref|YP_002977871.1| outer membrane lipoprotein carrier protein LolA [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240860665|gb|ACS58332.1| outer membrane lipoprotein carrier protein LolA [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 222

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 86/163 (52%), Gaps = 3/163 (1%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF  + TMQG F+Q    G    G+FF+ RP K  F Y  PS + +I+DG N+A+ N K
Sbjct: 52  DHFSGVTTMQGEFVQFGPRGEQTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNVAIGNMK 111

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDR 157
           L TW +YPL     S++ + +  +    ++ V+  +   TI   ++  F  + I++ FD 
Sbjct: 112 LKTWDLYPLSKTPLSLLLAQHIDLSAGMVKGVKEESDLTTIALGNNTVFGNSTITMMFDP 171

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
            +Y L  W I D+  + + + I   K     + +VF +PY+ I
Sbjct: 172 KTYDLRQWTITDNQGKDTSVMIFNVKTGMQFEDRVFRVPYETI 214


>gi|114707342|ref|ZP_01440239.1| hypothetical protein FP2506_03950 [Fulvimarina pelagi HTCC2506]
 gi|114537223|gb|EAU40350.1| hypothetical protein FP2506_03950 [Fulvimarina pelagi HTCC2506]
          Length = 234

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 97/200 (48%), Gaps = 7/200 (3%)

Query: 7   KSVIGVVILFFYSA--IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMK 63
           +S++ V++    +A  +  FN    + +  + ++  +HF SI +M G F+Q D  G   +
Sbjct: 31  RSILSVMLALGIAAPAVTAFNGPV-LAQSGAAQRIADHFSSIPSMHGDFVQFDPNGRQSE 89

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHV 123
           G+F++ +P K  F Y+S   + +I+DG+ +A+ N KL+TW  YPL      ++     ++
Sbjct: 90  GKFYIEKPGKVRFDYAS-QPLRVIADGTTVAINNKKLNTWDTYPLSQTPLKLLLDRRINL 148

Query: 124 IQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
              +I+ V       TI   D   F  + I++ FD  S  L  W I D   R + + I  
Sbjct: 149 SSANIRSVREEPDLTTIVMGDRSVFGNSTITMMFDPQSSDLKQWTIRDKQGRDTTVMIYN 208

Query: 182 YKENTVLDPKVFEIPYDKIH 201
            KE   +    F IPY  I 
Sbjct: 209 VKEGGDIQNSAFNIPYTAIQ 228


>gi|319406309|emb|CBI79946.1| LolA family protein [Bartonella sp. AR 15-3]
          Length = 206

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 98/198 (49%), Gaps = 7/198 (3%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFN-AAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGY 60
           F   + ++ V++LFF  +   F+ +A  + + Q++   I  F +I+TM G F+Q    G 
Sbjct: 5   FFSLRRIVSVILLFFLLSSPAFSQSAKQLARAQNI---INRFAAIKTMTGDFIQFSPKGK 61

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
           + KG F++ RP K  F Y     + +I+DG ++ + N  L+TWS Y L       +  N 
Sbjct: 62  ITKGTFYLERPGKIRFSYKG-VPLQIIADGKSVGINNRALNTWSFYRLSQTPMKFLLGNT 120

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
            ++  E++     +   + I  +D  +G   I + FD  SY L  W I+D     + I+I
Sbjct: 121 INLSSENLLAFREDPKTVVIILRDKTIGKGQIKIIFDSQSYALRQWAILDQQNLETTIQI 180

Query: 180 LKYKENTVLDPKVFEIPY 197
           +  + N     ++F IPY
Sbjct: 181 MNVRTNVRFSNEMFVIPY 198


>gi|90421062|ref|ZP_01228965.1| outer membrane lipoprotein carrier protein [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90334697|gb|EAS48474.1| outer membrane lipoprotein carrier protein [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 214

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 80/163 (49%), Gaps = 4/163 (2%)

Query: 41  EHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF  I +M G F+Q D  G   +G+F++ +P K  F Y+    + +I+DGS +A+ N K
Sbjct: 46  DHFAGIPSMHGDFVQFDPNGRQTEGKFYIEKPGKVRFDYTQ-QPLRVIADGSTVAINNKK 104

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDR 157
           L+TW  YPL      ++      + Q +IQ V+      TI   D   F  + I++ FD 
Sbjct: 105 LNTWDTYPLSKTPLKLLLDRRIDLSQANIQSVKEEPDLTTIVMGDSSIFGNSRITLMFDP 164

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
            SY L  W I D   + + + I   K    +    F+IPY  I
Sbjct: 165 KSYELKQWTIRDQQGKDTTVMIYNVKHGGDIAESTFKIPYTAI 207


>gi|218514561|ref|ZP_03511401.1| putative outer membrane lipoproteins carrier protein [Rhizobium
           etli 8C-3]
          Length = 179

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 79/147 (53%), Gaps = 3/147 (2%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF  + TMQG F+Q    G    G+FF+ RP K  F Y  PS + +I+DG N+A+ N K
Sbjct: 28  DHFSGVTTMQGEFVQFGPRGEQTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNVAIGNTK 87

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDR 157
           L TW +YPL     S++ + +  +    ++ V+  +   TI   ++  F  + I++ FD 
Sbjct: 88  LKTWDLYPLSKTPLSLLLAQHIDLSAGMVKGVKEESDLTTIALGNNTVFGNSTITMMFDP 147

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKE 184
            +Y L  W I D+  + + + I + ++
Sbjct: 148 KTYDLRQWTITDNQGKDTSVMIFQRQD 174


>gi|110635563|ref|YP_675771.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium sp.
           BNC1]
 gi|110286547|gb|ABG64606.1| outer membrane lipoprotein carrier protein LolA [Chelativorans sp.
           BNC1]
          Length = 216

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 85/164 (51%), Gaps = 3/164 (1%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF +++TM G F+Q    G    G+F++ RP K  F Y  P+   ++SDGS + + N K
Sbjct: 46  QHFSNVRTMTGEFVQFGPRGEQTGGKFYIERPGKIRFDYEPPAQFRVMSDGSTVVLENKK 105

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVT--FDR 157
           ++T  +Y L      ++      +  +++++V+ +    T+   D  +GN  ++T  FD 
Sbjct: 106 MNTVDIYRLSDTPLRLLLGERIDLSADNVRQVKEDPDLTTVTIADRKLGNNATITMMFDS 165

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIH 201
            +Y L  W + D+  R + + I   K+    DP VF I + +++
Sbjct: 166 KTYDLRQWTVTDAQGRDTTVMIFNVKQGVTFDPSVFYIDHRRVN 209


>gi|13476677|ref|NP_108246.1| outer membrane lipoprotein carrier protein [Mesorhizobium loti
           MAFF303099]
 gi|14027438|dbj|BAB53707.1| outer membrane lipoprotein carrier protein [Mesorhizobium loti
           MAFF303099]
          Length = 210

 Score = 92.0 bits (227), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 79/160 (49%), Gaps = 3/160 (1%)

Query: 41  EHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF S+++M G F+Q D  G    G FF+ RP K  F Y+  S +SLI+DG ++ +YN K
Sbjct: 40  DHFSSVKSMSGNFVQSDPRGEKTSGRFFLQRPGKIRFNYTGQSGISLIADGQSVVIYNKK 99

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDR 157
           L T  +Y L      ++  +        ++ ++ + + +TI   D   F  + I++ FDR
Sbjct: 100 LKTSRLYALSKTPLKLLLDDKVEFSGNRLKGIKDDGAQVTIKLADKSAFGNSNITMVFDR 159

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
            S  L  W I D   + + + +   +E     P  F I Y
Sbjct: 160 KSLDLRRWSITDERGQSTTVTLSNVREGVRAPPGTFMIDY 199


>gi|161619920|ref|YP_001593807.1| outer membrane lipoprotein carrier protein LolA [Brucella canis
           ATCC 23365]
 gi|163844024|ref|YP_001628428.1| outer membrane lipoprotein carrier protein LolA [Brucella suis ATCC
           23445]
 gi|225853438|ref|YP_002733671.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis ATCC 23457]
 gi|254700640|ref|ZP_05162468.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           5 str. 513]
 gi|254705009|ref|ZP_05166837.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           3 str. 686]
 gi|254707473|ref|ZP_05169301.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis M163/99/10]
 gi|254708985|ref|ZP_05170796.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis B2/94]
 gi|254713586|ref|ZP_05175397.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M644/93/1]
 gi|254716060|ref|ZP_05177871.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M13/05/1]
 gi|256030512|ref|ZP_05444126.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis M292/94/1]
 gi|256045603|ref|ZP_05448483.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256059973|ref|ZP_05450157.1| outer membrane lipoprotein carrier protein LolA [Brucella neotomae
           5K33]
 gi|256112330|ref|ZP_05453251.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 3 str. Ether]
 gi|256158497|ref|ZP_05456395.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M490/95/1]
 gi|256253916|ref|ZP_05459452.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           B1/94]
 gi|256263082|ref|ZP_05465614.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 2 str. 63/9]
 gi|260562911|ref|ZP_05833397.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 1 str. 16M]
 gi|260567519|ref|ZP_05837989.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           4 str. 40]
 gi|294851236|ref|ZP_06791909.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. NVSL
           07-0026]
 gi|161336731|gb|ABX63036.1| outer membrane lipoprotein carrier protein LolA [Brucella canis
           ATCC 23365]
 gi|163674747|gb|ABY38858.1| outer membrane lipoprotein carrier protein LolA [Brucella suis ATCC
           23445]
 gi|225641803|gb|ACO01717.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis ATCC 23457]
 gi|260152927|gb|EEW88019.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 1 str. 16M]
 gi|260157037|gb|EEW92117.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           4 str. 40]
 gi|263092974|gb|EEZ17135.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 2 str. 63/9]
 gi|294819825|gb|EFG36824.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. NVSL
           07-0026]
          Length = 231

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 23  VAAVLGMGILGVGVAGAALAPVPVKAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRG 82

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 83  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 141

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 142 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 201

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 202 MIFNVRTGVRFTNDMFKIDYQRI 224


>gi|261217825|ref|ZP_05932106.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M13/05/1]
 gi|261221053|ref|ZP_05935334.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           B1/94]
 gi|261314961|ref|ZP_05954158.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis M163/99/10]
 gi|261316481|ref|ZP_05955678.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis B2/94]
 gi|261321327|ref|ZP_05960524.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M644/93/1]
 gi|261323945|ref|ZP_05963142.1| outer membrane lipoprotein carrier protein LolA [Brucella neotomae
           5K33]
 gi|261751146|ref|ZP_05994855.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           5 str. 513]
 gi|261755708|ref|ZP_05999417.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           3 str. 686]
 gi|265987554|ref|ZP_06100111.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis M292/94/1]
 gi|265992026|ref|ZP_06104583.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265993763|ref|ZP_06106320.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 3 str. Ether]
 gi|265997014|ref|ZP_06109571.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M490/95/1]
 gi|260919637|gb|EEX86290.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           B1/94]
 gi|260922914|gb|EEX89482.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M13/05/1]
 gi|261294017|gb|EEX97513.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M644/93/1]
 gi|261295704|gb|EEX99200.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis B2/94]
 gi|261299925|gb|EEY03422.1| outer membrane lipoprotein carrier protein LolA [Brucella neotomae
           5K33]
 gi|261303987|gb|EEY07484.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis M163/99/10]
 gi|261740899|gb|EEY28825.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           5 str. 513]
 gi|261745461|gb|EEY33387.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           3 str. 686]
 gi|262551482|gb|EEZ07472.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M490/95/1]
 gi|262764744|gb|EEZ10665.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 3 str. Ether]
 gi|263003092|gb|EEZ15385.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|264659751|gb|EEZ30012.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis M292/94/1]
 gi|326410000|gb|ADZ67065.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis M28]
 gi|326539717|gb|ADZ87932.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis M5-90]
          Length = 225

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 17  VAAVLGMGILGVGVAGAALAPVPVKAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRG 76

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 77  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 135

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 136 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 195

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 196 MIFNVRTGVRFTNDMFKIDYQRI 218


>gi|62290850|ref|YP_222643.1| hypothetical protein BruAb1_1978 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700762|ref|YP_415336.1| hypothetical protein BAB1_2003 [Brucella melitensis biovar Abortus
           2308]
 gi|260546114|ref|ZP_05821854.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           NCTC 8038]
 gi|62196982|gb|AAX75282.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616863|emb|CAJ11959.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
           2308]
 gi|260096221|gb|EEW80097.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           NCTC 8038]
          Length = 230

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 22  VAAVLGMGILGVGVAGAALAPVPVKAQGEDGGIAAAQQIADHFSSARTMTGEFVQFGPRG 81

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 82  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 140

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 141 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 200

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 201 MIFNVRTGVRFTNDMFKIDYQRI 223


>gi|189025066|ref|YP_001935834.1| hypothetical protein BAbS19_I18780 [Brucella abortus S19]
 gi|254690140|ref|ZP_05153394.1| hypothetical protein Babob68_08221 [Brucella abortus bv. 6 str.
           870]
 gi|254696255|ref|ZP_05158083.1| hypothetical protein Babob28_00711 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731173|ref|ZP_05189751.1| hypothetical protein Babob42_08251 [Brucella abortus bv. 4 str.
           292]
 gi|256258394|ref|ZP_05463930.1| hypothetical protein Babob9C_13833 [Brucella abortus bv. 9 str.
           C68]
 gi|297247234|ref|ZP_06930952.1| hypothetical protein BAYG_00131 [Brucella abortus bv. 5 str. B3196]
 gi|189020638|gb|ACD73360.1| hypothetical protein BAbS19_I18780 [Brucella abortus S19]
 gi|297174403|gb|EFH33750.1| hypothetical protein BAYG_00131 [Brucella abortus bv. 5 str. B3196]
          Length = 231

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 23  VAAVLGMGILGVGVAGAALAPVPVKAQGEDGGIAAAQQIADHFSSARTMTGEFVQFGPRG 82

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 83  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 141

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 142 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 201

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 202 MIFNVRTGVRFTNDMFKIDYQRI 224


>gi|23502851|ref|NP_698978.1| hypothetical protein BR2003 [Brucella suis 1330]
 gi|256370403|ref|YP_003107914.1| outer membrane lipoprotein carrier protein LolA [Brucella microti
           CCM 4915]
 gi|23348877|gb|AAN30893.1| conserved hypothetical protein [Brucella suis 1330]
 gi|256000566|gb|ACU48965.1| outer membrane lipoprotein carrier protein LolA [Brucella microti
           CCM 4915]
          Length = 230

 Score = 91.3 bits (225), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 22  VAAVLGMGILGVGVAGAALAPVPVKAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRG 81

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 82  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 140

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 141 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 200

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 201 MIFNVRTGVRFTNDMFKIDYQRI 223


>gi|260755676|ref|ZP_05868024.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 6 str. 870]
 gi|260758901|ref|ZP_05871249.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 4 str. 292]
 gi|260760625|ref|ZP_05872968.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260884703|ref|ZP_05896317.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 9 str. C68]
 gi|260669219|gb|EEX56159.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 4 str. 292]
 gi|260671057|gb|EEX57878.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260675784|gb|EEX62605.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 6 str. 870]
 gi|260874231|gb|EEX81300.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 9 str. C68]
          Length = 225

 Score = 91.3 bits (225), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 17  VAAVLGMGILGVGVAGAALAPVPVKAQGEDGGIAAAQQIADHFSSARTMTGEFVQFGPRG 76

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 77  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 135

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 136 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 195

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 196 MIFNVRTGVRFTNDMFKIDYQRI 218


>gi|260169417|ref|ZP_05756228.1| outer membrane lipoprotein carrier protein LolA [Brucella sp.
           F5/99]
 gi|261758939|ref|ZP_06002648.1| outer membrane lipoprotein carrier protein LolA [Brucella sp.
           F5/99]
 gi|261738923|gb|EEY26919.1| outer membrane lipoprotein carrier protein LolA [Brucella sp.
           F5/99]
          Length = 231

 Score = 91.3 bits (225), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 23  VAAVLGMGILGVGVAGAALAPVPVKAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRG 82

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 83  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 141

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 142 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDARKLDTTV 201

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 202 MIFNVRTGVRFTNDMFKIDYQRI 224


>gi|237816359|ref|ZP_04595352.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|237788426|gb|EEP62641.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
          Length = 258

 Score = 90.9 bits (224), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 50  VAAVLGMGILGVGVAGAALAPVPVKAQGEDGGIAAAQQIADHFSSARTMTGEFVQFGPRG 109

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 110 EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 168

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 169 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 228

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 229 MIFNVRTGVRFTNDMFKIDYQRI 251


>gi|319780772|ref|YP_004140248.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317166660|gb|ADV10198.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 227

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 83/171 (48%), Gaps = 3/171 (1%)

Query: 37  KKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAV 95
           +K  +HF S+++M G F+Q    G    G+FF+ RP K  F Y   S+  +ISDG ++ +
Sbjct: 52  QKIADHFSSVKSMSGEFVQFGPKGEQTGGKFFLERPGKIRFNYDGSSNFRVISDGQSVVI 111

Query: 96  YNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISV 153
            N +L+T  +YPL      ++  N   +  + ++ V+  +   TI   D   F  + I++
Sbjct: 112 LNKRLNTSDLYPLSKTPLKLLLDNRIDLSGDRVKSVKQEDDLTTIQLADKSVFGNSKITM 171

Query: 154 TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
            FD  ++ L  W I D+  + + + I   KE     P  F I Y     +N
Sbjct: 172 MFDPKTFDLRQWTITDAQGKDTTVMIFNTKEGVSFAPDTFAIDYTANRELN 222


>gi|225628197|ref|ZP_03786232.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225617022|gb|EEH14069.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
          Length = 258

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 50  VAAVLGMGILGVGVAGAALAPVPVKAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRG 109

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 110 EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 168

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 169 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDARKLDTTV 228

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 229 MIFNVRTGVRFTNDMFKIDYQRI 251


>gi|148559543|ref|YP_001259817.1| hypothetical protein BOV_1926 [Brucella ovis ATCC 25840]
 gi|148370800|gb|ABQ60779.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 258

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 50  VAAVLGMGILGVGVAGAALAPVPVKAQGADGCIAAAQQIADHFSSARTMTGEFVQFGPRG 109

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 110 EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 168

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 169 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITLMFDPKSYDLKQWTITDAQKLDTTV 228

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 229 MIFNVRTGVRFTNDMFKIDYQRI 251


>gi|304394438|ref|ZP_07376361.1| outer membrane lipoprotein carrier protein LolA [Ahrensia sp.
           R2A130]
 gi|303293878|gb|EFL88255.1| outer membrane lipoprotein carrier protein LolA [Ahrensia sp.
           R2A130]
          Length = 220

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 100/199 (50%), Gaps = 7/199 (3%)

Query: 2   AFLLYKSVIG--VVILFFYSAIFPFNAAYPITK--DQSVKKAIEHFLSIQTMQGTFLQ-E 56
           A +L  S I   VV++   +++    A+  +T    ++V +  +HF S+ +M G F+Q  
Sbjct: 5   ATVLRNSAIAALVVMIAGIASLMANPASAKVTNADKKAVAQISQHFSSVPSMAGEFIQFG 64

Query: 57  DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVI 116
             G    G+F++ RP K  F Y++PS +++ +DG  + + N KL TW  +PLR     ++
Sbjct: 65  PNGEQTGGKFYLQRPGKIRFDYANPSPITVKADGKTVGINNKKLKTWDFFPLRKTPLRLL 124

Query: 117 FSNNQHVIQESIQRVESNNSFITIFF--KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
            S+   V  +SI+ V+      T+    K  F  + I++ FD  +  L  W I D   + 
Sbjct: 125 LSDKIDVNDKSIKSVKREKDLTTVMLANKSVFGNSKITMMFDPETSDLRQWTITDDQGKD 184

Query: 175 SIIKILKYKENTVLDPKVF 193
           + + I   ++N  L  ++F
Sbjct: 185 TSVMIFNVQKNVKLSKRLF 203


>gi|13473591|ref|NP_105159.1| hypothetical protein mll4242 [Mesorhizobium loti MAFF303099]
 gi|14024341|dbj|BAB50945.1| mll4242 [Mesorhizobium loti MAFF303099]
          Length = 229

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 82/171 (47%), Gaps = 3/171 (1%)

Query: 37  KKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAV 95
           +K  +HF S+++M G F+Q    G    G+FF+ RP K  F Y   S+  +ISDG ++ +
Sbjct: 55  QKIADHFSSVKSMSGEFVQFGPKGEQTGGKFFLERPGKIRFNYDGASNFKVISDGKSVVI 114

Query: 96  YNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISV 153
            N K++T  +YPL      ++  +   +  + ++ V+  +   TI   D   F    I++
Sbjct: 115 LNKKMNTSDLYPLSKTPLKLLLDDRIDLSGDRVKSVKEEDDLTTIQLSDKAVFGNARITM 174

Query: 154 TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
            FD  +Y L  W I D+  + + + I   KE     P  F I Y     +N
Sbjct: 175 MFDPKTYDLRQWTITDAQGKDTTVMIFNTKEGVSFAPDTFAIDYTANRELN 225


>gi|306842864|ref|ZP_07475502.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. BO2]
 gi|306286986|gb|EFM58501.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. BO2]
          Length = 223

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 15  VAAVLGMGILGVGVAGAALAPVPVMAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRG 74

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 75  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 133

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 134 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 193

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 194 MIFNVRTGVRFTNDMFKIDYQRI 216


>gi|121602483|ref|YP_988432.1| LolA family protein [Bartonella bacilliformis KC583]
 gi|120614660|gb|ABM45261.1| LolA family protein [Bartonella bacilliformis KC583]
          Length = 210

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 92/191 (48%), Gaps = 8/191 (4%)

Query: 14  ILFFYSAIFPF--NAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMAR 70
           IL+F   +FP    +A+ + + Q +     HF +I+TM G F+Q    G   KG F++ R
Sbjct: 17  ILYFVLLLFPAFSQSAHQVARAQVIA---NHFAAIKTMTGDFVQFSPKGKKTKGTFYLER 73

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQR 130
           P K  F Y     + +++DG ++ + N  L+TW +Y L      ++  +   +  E++  
Sbjct: 74  PGKVRFTYQG-VPLQIMADGQSVGIQNRALNTWDLYQLSQTPMKLLLGDTIDISSENLLA 132

Query: 131 VESNNSFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLD 189
              ++  I I  +D  +G   I + FD  +Y LL W I+D     + ++++  +      
Sbjct: 133 FRQDSRAIEIILRDKSLGKGQIKMIFDANTYALLQWTIVDQQNLETTVQVMNVRTGVRFA 192

Query: 190 PKVFEIPYDKI 200
             +F IPY  I
Sbjct: 193 EDMFTIPYQNI 203


>gi|306837612|ref|ZP_07470483.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. NF
           2653]
 gi|306407319|gb|EFM63527.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. NF
           2653]
          Length = 223

 Score = 89.7 bits (221), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 15  VAAVLGMGILGVGVAGAALAPVPVMAQGADGGVAAAQQIADHFSSERTMTGEFVQFGPRG 74

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 75  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 133

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 134 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 193

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 194 MIFNVRTGVRFTNDMFKIDYQRI 216


>gi|254718051|ref|ZP_05179862.1| outer membrane lipoprotein carrier protein LolA [Brucella sp.
           83/13]
          Length = 231

 Score = 89.7 bits (221), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 23  VAAVLGMGILGVGVAGAALAPVPVMAQGADGGVAAAQQIADHFSSERTMTGEFVQFGPRG 82

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 83  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 141

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 142 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 201

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 202 MIFNVRTGVRFTNDMFKIDYQRI 224


>gi|265982998|ref|ZP_06095733.1| outer membrane lipoprotein carrier protein LolA [Brucella sp.
           83/13]
 gi|264661590|gb|EEZ31851.1| outer membrane lipoprotein carrier protein LolA [Brucella sp.
           83/13]
          Length = 225

 Score = 89.7 bits (221), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 17  VAAVLGMGILGVGVAGAALAPVPVMAQGADGGVAAAQQIADHFSSERTMTGEFVQFGPRG 76

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 77  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 135

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 136 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 195

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 196 MIFNVRTGVRFTNDMFKIDYQRI 218


>gi|306843438|ref|ZP_07476039.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. BO1]
 gi|306276129|gb|EFM57829.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. BO1]
          Length = 223

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++G+ +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 15  VAAVLGVGILGIGVAGAALAPVPVMAQGADGGIATAQQIADHFSSARTMTGEFVQFGPRG 74

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 75  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 133

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 134 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 193

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 194 MIFNVRTGVRFTNDMFKIDYQRI 216


>gi|254694630|ref|ZP_05156458.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 3 str. Tulya]
          Length = 231

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 95/203 (46%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P           + ++  +HF S +TM G F+Q    G
Sbjct: 23  VAAVLGMGILGVGVAGAALAPVPVKVQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRG 82

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 83  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 141

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 142 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 201

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 202 MIFNVRTGVRFTNDMFKIDYQRI 224


>gi|261214951|ref|ZP_05929232.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 3 str. Tulya]
 gi|260916558|gb|EEX83419.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 3 str. Tulya]
          Length = 223

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 95/203 (46%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P           + ++  +HF S +TM G F+Q    G
Sbjct: 15  VAAVLGMGILGVGVAGAALAPVPVKVQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRG 74

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 75  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 133

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 134 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 193

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 194 MIFNVRTGVRFTNDMFKIDYQRI 216


>gi|260464218|ref|ZP_05812411.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium
           opportunistum WSM2075]
 gi|259030021|gb|EEW31304.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium
           opportunistum WSM2075]
          Length = 226

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 82/171 (47%), Gaps = 3/171 (1%)

Query: 37  KKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAV 95
           +K  +HF ++++M G F+Q    G    G+FF+ RP K  F Y   S+  +ISDG ++ +
Sbjct: 52  QKIADHFSAVKSMSGEFVQFGPKGEQTGGKFFLERPGKIRFNYDGSSNFKVISDGKSVVI 111

Query: 96  YNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISV 153
            N K++T  +YPL      ++  +   +  + ++ V+  +   TI   D   F    I++
Sbjct: 112 LNKKMNTSDLYPLSKTPLKLLLDDRIDLSGDRVKSVKQEDDLTTIQLSDKSVFGNARITM 171

Query: 154 TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
            FD  +Y L  W I D+  + + + I   KE     P  F I Y     +N
Sbjct: 172 MFDPKTYDLRQWTITDAQGKDTTVMIFNTKEGVSFAPDTFAIDYTANRELN 222


>gi|319404824|emb|CBI78425.1| lipoprotein carrier protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 190

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/160 (31%), Positives = 77/160 (48%), Gaps = 3/160 (1%)

Query: 40  IEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNA 98
           I HF +I+ M G F+Q    G + KG F++ RP K  F Y     + +ISDG ++ V N 
Sbjct: 20  INHFAAIKVMTGDFIQFNPKGKMTKGTFYLERPGKIRFSYKG-VPLQVISDGKSVGVNNR 78

Query: 99  KLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG-NMISVTFDR 157
            L+TWS Y L       +  N  H+  E++     +   I I  +D  +G   I + FD 
Sbjct: 79  ALNTWSFYQLSQTPMKFLLGNVIHLSSENLLAFREDPKTIMIVLRDKTIGKGQIKMIFDS 138

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
            SY L  W I+D     + +KI+  + N      +F IP+
Sbjct: 139 QSYALRQWAILDQQNLETTVKIMNVRTNVRFSDDMFVIPH 178


>gi|239833025|ref|ZP_04681354.1| outer membrane lipoprotein carrier protein LolA [Ochrobactrum
           intermedium LMG 3301]
 gi|239825292|gb|EEQ96860.1| outer membrane lipoprotein carrier protein LolA [Ochrobactrum
           intermedium LMG 3301]
          Length = 230

 Score = 88.6 bits (218), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 82/163 (50%), Gaps = 4/163 (2%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF S++TM G F+Q    G    G F++ RP K  F Y++ S + +ISDG ++ + N K
Sbjct: 62  DHFSSVRTMTGEFVQFGPKGEQTGGTFYIERPGKIRFNYNN-SPIRVISDGESVVINNRK 120

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDR 157
           LDTW +YPL      ++ ++   +    +Q V+      T+   D   F  + I++ FD 
Sbjct: 121 LDTWDLYPLSKTPLKLLLADRIDLGGGRLQNVKQEPDMTTLVLGDKSIFGDSKITMMFDP 180

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
            SY L  W I D+ +  + + I   +        +F+I Y +I
Sbjct: 181 KSYELKQWTITDAQKLDTTVMIFNVRSGVRFTDDMFKIDYQRI 223


>gi|153008296|ref|YP_001369511.1| outer membrane lipoprotein carrier protein LolA [Ochrobactrum
           anthropi ATCC 49188]
 gi|151560184|gb|ABS13682.1| outer membrane lipoprotein carrier protein LolA [Ochrobactrum
           anthropi ATCC 49188]
          Length = 230

 Score = 88.6 bits (218), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 82/163 (50%), Gaps = 4/163 (2%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF S++TM G F+Q    G    G F++ RP K  F Y++ S + +ISDG ++ + N K
Sbjct: 62  DHFSSVRTMTGEFVQFGPKGEQTGGTFYIERPGKIRFNYNN-SPIRVISDGESVVINNRK 120

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDR 157
           LDTW +YPL      ++ ++   +    +Q V+      T+   D   F  + I++ FD 
Sbjct: 121 LDTWDLYPLSKTPLKLLLADRIDLGGGRLQNVKQEPDMTTLVLGDKSIFGDSKITMMFDP 180

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
            SY L  W I D+ +  + + I   +        +F+I Y +I
Sbjct: 181 KSYELKQWTITDAQKLDTTVMIFNVRSGVRFTDDMFKIDYQRI 223


>gi|17986353|ref|NP_538987.1| outer membrane lipoproteins carrier protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|17981941|gb|AAL51251.1| outer membrane lipoproteins carrier protein precursor [Brucella
           melitensis bv. 1 str. 16M]
          Length = 200

 Score = 88.2 bits (217), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 91/194 (46%), Gaps = 4/194 (2%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFM 68
           +GV +     A  P  A        + ++  +HF S +TM G F+Q    G    G F++
Sbjct: 1   MGVGVAGAALAPVPVKAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRGEQTGGTFYI 60

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI 128
            RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++   +    +
Sbjct: 61  ERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGRL 119

Query: 129 QRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
           Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + + I   +   
Sbjct: 120 QSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTGV 179

Query: 187 VLDPKVFEIPYDKI 200
                +F+I Y +I
Sbjct: 180 RFTNDMFKIDYQRI 193


>gi|222087553|ref|YP_002546090.1| outer membrane lipoproteins carrier protein [Agrobacterium
           radiobacter K84]
 gi|221725001|gb|ACM28157.1| outer membrane lipoproteins carrier protein [Agrobacterium
           radiobacter K84]
          Length = 216

 Score = 87.8 bits (216), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 54/169 (31%), Positives = 88/169 (52%), Gaps = 4/169 (2%)

Query: 35  SVKKAI-EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSN 92
           SV + I +HF SI+TM+G FLQ    G  + G FF+ RP K  F Y  PS + +I DG+N
Sbjct: 48  SVAQQIADHFSSIKTMKGGFLQIGPRGDQVSGSFFIQRPGKMRFNYDPPSRMRVICDGNN 107

Query: 93  IAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSF--ITIFFKDDFMGNM 150
           + V N +  T ++Y L     S++ +N   +  + ++ V++      IT+  +  F  + 
Sbjct: 108 VQVINDQTRTKNMYQLSKTPLSLLLANKIDLSADMVRGVDAQPDLTKITLGNRTVFGDST 167

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           I++ FD  +Y L  W ++D   + + + I   K N   D  VF I Y +
Sbjct: 168 IAMIFDSKTYDLRQWTVIDPQGKTTDVIINNVKTNVSFDDSVFRIDYTR 216


>gi|319407784|emb|CBI81435.1| lipoprotein carrier protein [Bartonella sp. 1-1C]
          Length = 190

 Score = 87.8 bits (216), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 78/160 (48%), Gaps = 3/160 (1%)

Query: 40  IEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNA 98
           I HF +I+ M G F+Q    G + KG F++ RP K  F Y     + +ISDG ++ + N 
Sbjct: 20  INHFAAIKVMTGDFIQFNPKGKMTKGTFYLERPGKIRFSYKG-VPLQIISDGKSVGINNR 78

Query: 99  KLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG-NMISVTFDR 157
            L+TWS Y L       +  N  H+  E++     + + I I  +D  +G   I + FD 
Sbjct: 79  ALNTWSFYQLSQTPMKFLLGNVIHLSSENLLAFREDPTTIMIVLRDKTIGKGQIKMIFDS 138

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
            +Y L  W I+D     + +KI+  + N      +F IP+
Sbjct: 139 QNYALRQWAILDQQNLETTVKIMNVRTNVRFSDDMFVIPH 178


>gi|319899429|ref|YP_004159526.1| lipoprotein carrier protein [Bartonella clarridgeiae 73]
 gi|319403397|emb|CBI76965.1| lipoprotein carrier protein [Bartonella clarridgeiae 73]
          Length = 210

 Score = 85.1 bits (209), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 92/199 (46%), Gaps = 9/199 (4%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKA--IEHFLSIQTMQGTFLQ-EDAG 59
           FL  +    V+ LF    +    +A+  +  Q V+      HF +I+TM G F+Q    G
Sbjct: 5   FLSLRRAFNVIFLF----LLLIGSAFSQSAKQLVRAQNIANHFAAIKTMTGDFIQFSPKG 60

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
            + KG F++ RP K  F Y     + +++DG ++ V N  L+TWS Y L      ++  +
Sbjct: 61  KITKGTFYLERPGKIRFSYKG-VPLQIVADGKSVGVNNRALNTWSFYQLSQTPMKLLLGD 119

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
              +   ++     +   + I  +D  +G   I + FD  SY L  W I+D     + ++
Sbjct: 120 TISLSSANLLAFREDPGAVMIVLRDKTIGKGQIKMIFDSQSYALRQWTILDQQNLETTVQ 179

Query: 179 ILKYKENTVLDPKVFEIPY 197
           ++  + N      +F+IPY
Sbjct: 180 VMNVRTNVRFADGMFKIPY 198


>gi|254472223|ref|ZP_05085623.1| outer membrane lipoprotein carrier protein LolA [Pseudovibrio sp.
           JE062]
 gi|211958506|gb|EEA93706.1| outer membrane lipoprotein carrier protein LolA [Pseudovibrio sp.
           JE062]
          Length = 229

 Score = 84.7 bits (208), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 94/186 (50%), Gaps = 6/186 (3%)

Query: 18  YSAIFPFNAAYPI--TKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKF 74
           +SA      A P+  T  Q++    ++F S++ M G F+Q    G  ++G+FF++RP K 
Sbjct: 33  HSAAQTTQQAQPVALTNVQAIDAVSKYFNSVRNMHGKFVQFGPTGGRVEGQFFISRPGKV 92

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVES 133
            F Y+ PS++ +I+DGS ++V + KL T  ++PL       + ++   +  ++ +  V  
Sbjct: 93  RFYYNKPSTLDIIADGSMVSVKDRKLQTQDIWPLSQTPLRFLLADKIDLKTDANVTNVVV 152

Query: 134 NNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPK 191
               ITI   D   F    +++ FD   Y+L  W + D+    + + I    EN   +P 
Sbjct: 153 EPDLITITIDDKTRFTSGRLTLIFDARDYKLKQWTVRDAQGYDTSVAIYDVVENGATNPD 212

Query: 192 VFEIPY 197
           +F+I Y
Sbjct: 213 LFKIDY 218


>gi|328541765|ref|YP_004301874.1| Outer membrane lipoprotein carrier protein LolA [polymorphum gilvum
           SL003B-26A1]
 gi|326411517|gb|ADZ68580.1| Outer membrane lipoprotein carrier protein LolA [Polymorphum gilvum
           SL003B-26A1]
          Length = 220

 Score = 81.3 bits (199), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 86/160 (53%), Gaps = 4/160 (2%)

Query: 42  HFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL 100
           +F S++TM G F+Q    G  ++G+F++ARP K  F YS P+ + +I+DG +++V + K+
Sbjct: 51  YFNSVKTMHGDFVQFGPEGDQVEGKFYLARPGKIRFYYSPPAQLDIIADGKSVSVKDRKM 110

Query: 101 DTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSFITIFFKDD--FMGNMISVTFDR 157
            T  ++PL       + ++N  + +++ +  V +    +T+  +D   F    +++ FD 
Sbjct: 111 ATQDIWPLSETPLRFLLADNIDLTKDTKVVGVMAEPDLVTVVIEDKTTFNSGKLTLIFDA 170

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
            +Y L  W + D+    + + +     N   +PK+F I Y
Sbjct: 171 RTYELKQWTVTDAQGYDTSVAVYNVVANGPTNPKLFVIDY 210


>gi|307943516|ref|ZP_07658860.1| outer membrane lipoprotein carrier protein LolA [Roseibium sp.
           TrichSKD4]
 gi|307773146|gb|EFO32363.1| outer membrane lipoprotein carrier protein LolA [Roseibium sp.
           TrichSKD4]
          Length = 214

 Score = 81.3 bits (199), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 85/160 (53%), Gaps = 4/160 (2%)

Query: 42  HFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL 100
           +F S++TM G F+Q    G   +G+F++ARP K  F YS P+ + +I+DG +++V + KL
Sbjct: 45  YFNSVKTMHGDFVQFGPDGSQSEGKFYLARPGKVRFYYSPPAKLDIIADGKSVSVKDRKL 104

Query: 101 DTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKDD--FMGNMISVTFDR 157
            T  ++PL       + + N ++  E +IQ V   +  +T+  +D   F   ++++ F+ 
Sbjct: 105 ATQDIWPLGQTPLRFLLAENINLQSEATIQNVIVESDLVTVVLEDKTTFNSGILTLIFEA 164

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
            +Y L  W + D+    + + +     N   +P +F I Y
Sbjct: 165 DTYELKQWTVTDAQGFDTSVAVYNVVSNGPTNPDLFRIDY 204


>gi|254500974|ref|ZP_05113125.1| Outer membrane lipoprotein carrier protein LolA [Labrenzia
           alexandrii DFL-11]
 gi|222437045|gb|EEE43724.1| Outer membrane lipoprotein carrier protein LolA [Labrenzia
           alexandrii DFL-11]
          Length = 212

 Score = 80.9 bits (198), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 87/168 (51%), Gaps = 4/168 (2%)

Query: 34  QSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSN 92
           Q+++    +F S++TM G F+Q    G    G+F+MARP K  F Y+ PS + +++DG +
Sbjct: 39  QTLQDLNTYFNSVKTMHGDFIQFGPDGSQSDGKFYMARPGKVRFYYNKPSVLDIVADGKS 98

Query: 93  IAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQR---VESNNSFITIFFKDDFMGN 149
           ++V + KL+T  ++PL       + S++  + Q++      VE +   +TIF +  F   
Sbjct: 99  VSVRDRKLNTQDIWPLGQTPLRFLLSDSIDLQQDTNVTNVLVEEDLVTVTIFDQTKFNSG 158

Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
            +++ FD   Y L  W + D     + + +     N   +P +F+I Y
Sbjct: 159 TLTLIFDAKDYALKQWTVTDQQGYDTSVAVYNVVSNGPSNPDLFKIDY 206


>gi|118591354|ref|ZP_01548752.1| hypothetical protein SIAM614_26943 [Stappia aggregata IAM 12614]
 gi|118436026|gb|EAV42669.1| hypothetical protein SIAM614_26943 [Stappia aggregata IAM 12614]
          Length = 215

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 81/160 (50%), Gaps = 4/160 (2%)

Query: 42  HFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL 100
           +F S++TM G F+Q    G    G+F+MARP K  F Y+ PS + +++DG +++V + KL
Sbjct: 47  YFNSVKTMHGDFIQFGPDGNQSDGKFYMARPGKVRFYYNKPSVLDIVADGKSVSVRDRKL 106

Query: 101 DTWSVYPLRYMAFSVIFSNN---QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDR 157
           +T  ++PL       + S++   Q     +   VE +   +TIF K  F    +++ FD 
Sbjct: 107 NTQDIWPLGQTPLRFLLSDDIDLQKDTNVTNVLVEEDLITVTIFDKTKFNSGTLTLIFDA 166

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
             Y L  W + D     + + +     N   +P +F+I Y
Sbjct: 167 KDYALKQWTVTDQQGYDTSVAVYNVVSNGPTNPDLFKIDY 206


>gi|295691546|ref|YP_003595239.1| outer membrane lipoprotein carrier protein LolA [Caulobacter segnis
           ATCC 21756]
 gi|295433449|gb|ADG12621.1| outer membrane lipoprotein carrier protein LolA [Caulobacter segnis
           ATCC 21756]
          Length = 218

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 89/176 (50%), Gaps = 6/176 (3%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSP 81
           P  AA    +   V KA  +  S+ + +G F+Q DA G   +G F++ RP K  F Y +P
Sbjct: 32  PVPAALTAEQKALVNKATAYVQSLGSAKGRFVQTDARGTRTQGTFYLQRPGKARFAYDAP 91

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN----NQHVIQESIQRVESNNSF 137
           + + ++S+G+N+ +++++L T+  YPL     +++ +     ++ V+   ++R+    S 
Sbjct: 92  AGLLVVSNGNNVNIWDSRLKTYESYPLSKTPLNLLLAREVRLDRGVVITDVRRLADGFSI 151

Query: 138 ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
           +    K   +G  I++ F      L+ W + D       +++  +   + LDPK+F
Sbjct: 152 VAQDAKRQALGK-IALDFSDGPVALMGWTVTDIKGGQIRVRLTDFGPASGLDPKLF 206


>gi|319782044|ref|YP_004141520.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317167932|gb|ADV11470.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 211

 Score = 78.6 bits (192), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 74/165 (44%), Gaps = 3/165 (1%)

Query: 36  VKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
            K   +H  S+++M G F+Q        +G FF+ RP K  F Y+  S +S+I+DG ++ 
Sbjct: 36  AKTIADHLSSVKSMSGDFVQSGPNAERTRGRFFLQRPGKIRFNYAGQSGISVIADGKSLV 95

Query: 95  VYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKD--DFMGNMIS 152
           VYN KL T  +Y L      ++  N        ++ V  + + +T+   D   F  + IS
Sbjct: 96  VYNRKLKTSRLYALSKTPLKLLLDNKVDFSGNRVKSVRDDGAQVTVKLSDRSTFGNSSIS 155

Query: 153 VTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
           + FD  S  L  W + D     + + I   K+        F I Y
Sbjct: 156 MVFDSKSLDLRRWSLTDEKGLTTTVNISNVKQGVRAPEGTFVIDY 200


>gi|240851284|ref|YP_002972687.1| outer membrane lipoprotein carrier protein, LolA family [Bartonella
           grahamii as4aup]
 gi|240268407|gb|ACS51995.1| outer membrane lipoprotein carrier protein, LolA family [Bartonella
           grahamii as4aup]
          Length = 202

 Score = 77.8 bits (190), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 93/203 (45%), Gaps = 9/203 (4%)

Query: 2   AFLLYKSVIGVV-ILFFYSAIFPF--NAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-ED 57
           +FL  + V G+V I+ F+   FP    A+  + K Q+V   + HF +I+TM G F+Q   
Sbjct: 4   SFLPQRRVFGLVGIIIFWCLTFPVFSQASNKVIKAQNV---VNHFAAIKTMTGDFIQFSP 60

Query: 58  AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIF 117
            G + +G F++ RP K  F Y     + +I+DG  + + N  L+TW+   L       + 
Sbjct: 61  KGKMSQGTFYLERPGKIRFIYKK-MPLQIIADGQFVGINNRALNTWNFSQLSQTPMKFLL 119

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSI 176
            +   V    +     +   +TI  +D  +G   I + FD     L  W I+D     + 
Sbjct: 120 GDKIDVSSGRLLAFREDPGAVTIVLRDKTIGAGQIRMVFDSKGSALRQWTIVDQQNLETT 179

Query: 177 IKILKYKENTVLDPKVFEIPYDK 199
           ++I+  + +      +F +P  K
Sbjct: 180 VQIMNVRTDVRFANGMFALPSKK 202


>gi|218680394|ref|ZP_03528291.1| outer membrane lipoprotein carrier protein LolA [Rhizobium etli
           CIAT 894]
          Length = 137

 Score = 77.8 bits (190), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 50/84 (59%), Gaps = 3/84 (3%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF  + TMQG F+Q    G    G+FF+ RP K  F Y  PS + +I+DG N+A+ N K
Sbjct: 52  DHFSGVTTMQGEFVQFGPRGEQTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNVAIGNTK 111

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHV 123
           L TW +YPL     S++ +  QH+
Sbjct: 112 LKTWDLYPLSKTPLSLLLA--QHI 133


>gi|158421719|ref|YP_001523011.1| putative outer membrane lipoprotein-sorting protein [Azorhizobium
           caulinodans ORS 571]
 gi|158328608|dbj|BAF86093.1| putative outer membrane lipoprotein-sorting protein [Azorhizobium
           caulinodans ORS 571]
          Length = 357

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 85/166 (51%), Gaps = 5/166 (3%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           +++K   ++ S+QT+ GTF+Q DA G    G+F+M +P +  F+Y+ P+ + LIS+G N+
Sbjct: 191 TIEKLTTYWNSVQTLVGTFVQVDADGTRKTGDFYMQKPGRVRFEYNPPTQIQLISNGQNV 250

Query: 94  AVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSFITIFFKD--DFMGN- 149
           AV + +L+T  + PL       I +    + + S +  V  +N +I +  ++    MG  
Sbjct: 251 AVRDRRLNTQDLTPLNQTPLRFILAERIDLTRNSNVLGVYQDNLYIQVIMQESVPMMGTY 310

Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
            + + FD   ++L  W + D     + + I         DP +F I
Sbjct: 311 RLQILFDAKDFQLRQWTVTDPQGYDTSVAIYDLNYTQRPDPSLFVI 356


>gi|319409387|emb|CBI83031.1| lipoprotein carrier protein [Bartonella schoenbuchensis R1]
          Length = 212

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 76/161 (47%), Gaps = 3/161 (1%)

Query: 42  HFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL 100
           HF  I+TM G F+Q    G + +G F++ RP +  F Y     + +I+DG  + V N  L
Sbjct: 44  HFSEIKTMTGDFIQFSPKGKMSEGTFYLERPGRIRFGYKG-VPLQIIADGKMVGVNNRAL 102

Query: 101 DTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG-NMISVTFDRLS 159
           +TW++Y L       +  +  ++  +++  +  +   ITI   D  +G   I + FD   
Sbjct: 103 NTWNLYQLSQTPMKFLLDDKINISSKNLLALREDPGVITIVLHDKSIGKGQIRMIFDSKD 162

Query: 160 YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
           Y L  W I+D     + ++I+  +        +F IPY  I
Sbjct: 163 YSLRQWTIVDQQNLETTVQIMNVRTGIRFVDGMFTIPYKNI 203


>gi|182677441|ref|YP_001831587.1| outer membrane lipoprotein carrier protein LolA [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182633324|gb|ACB94098.1| outer membrane lipoprotein carrier protein LolA [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 268

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 95/177 (53%), Gaps = 5/177 (2%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLI 87
           P+ +  +++KA  +F S  TM G F+Q  + G   +G+ ++ RP +  F+Y++P+++ ++
Sbjct: 92  PLDQATAIQKANAYFSSAITMVGDFVQVGSDGRRTEGKLYVQRPGRLRFEYAAPATLEIV 151

Query: 88  SDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKDD- 145
           +DG ++AV++ +  T  VY +       +  +   + Q+  +  V+S+ S +TI  +D  
Sbjct: 152 ADGLSLAVHDRRTATKDVYFISQTPLKFLLKDQVDLAQDVKVVEVQSDPSAVTIIIEDKA 211

Query: 146 -FMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
            F G + I++ FD + + L  WK+ D     +++ +         DP +F++  D +
Sbjct: 212 TFGGTSRINLVFDPVKFTLKQWKVTDPQGYETLVSLFNLDLTKKPDPALFQLTQDHL 268


>gi|312114954|ref|YP_004012550.1| outer membrane lipoprotein carrier protein LolA [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311220083|gb|ADP71451.1| outer membrane lipoprotein carrier protein LolA [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 292

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 89/181 (49%), Gaps = 8/181 (4%)

Query: 21  IFPFNAAYPITKD--QSVKKAIEHFLSIQTMQGTFLQEDAGYVMK-GEFFMARPSKFYFK 77
           + P  AA PI +   + V K  ++F  +  +QG F+Q D     K G+F++AR  K  F 
Sbjct: 102 VTPEPAAAPIQESDLEVVAKINDYFNKMTFLQGVFVQSDPDTKQKRGKFYLARGGKVRFD 161

Query: 78  YSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNS 136
           Y +PS + +I+DG  +A+ +  L+T   YPL    F ++ S +  +I ++ I  VE    
Sbjct: 162 YGAPSRLKIIADGKYLAIEDHDLNTSDRYPLEVTPFRLLLSEHVDLINDANILGVEQWTD 221

Query: 137 FITIFFKD---DFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
            + +  +D   D  G  I + F +    L  W I D+    + I++   +EN    P VF
Sbjct: 222 VVVLTVEDKKGDGSGR-IRLMFSKPDMVLKEWIITDAQGLSTKIEVANLEENKAPAPDVF 280

Query: 194 E 194
           E
Sbjct: 281 E 281


>gi|49474727|ref|YP_032769.1| Outer membrane lipoprotein carrier protein [Bartonella quintana
           str. Toulouse]
 gi|49240231|emb|CAF26701.1| Outer membrane lipoprotein carrier protein [Bartonella quintana
           str. Toulouse]
          Length = 202

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 94/205 (45%), Gaps = 13/205 (6%)

Query: 2   AFLLYKSV---IGVVILFFYSAIFPFNAAYPITKDQSVK--KAIEHFLSIQTMQGTFLQ- 55
           +FL  K +   IG+++  F    FP   A+  +  + VK  K   HF +I+TM G F+Q 
Sbjct: 4   SFLPRKRIFWFIGIIV--FCCLTFP---AFSQSSKKVVKAQKIANHFAAIKTMTGDFIQF 58

Query: 56  EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSV 115
              G + +G F++ RP K  F Y     + +I+DG  I + N  L+TW+  PL       
Sbjct: 59  SPKGKMSQGTFYLERPGKIRFIYKK-IPLQIIADGQFIGINNRALNTWNFSPLFQTPMKF 117

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRY 174
           +  +  ++    +     +   +T+  +D   G   I + FD  +Y L  W I+D     
Sbjct: 118 LLDDEINLSSGRLLAFREDPGAVTVILRDKSTGSGQIKMVFDPKTYTLRQWTIIDQQSLE 177

Query: 175 SIIKILKYKENTVLDPKVFEIPYDK 199
           + ++I+  +       K+F +P  K
Sbjct: 178 TTVQIMNVRTGVKFADKMFTLPSKK 202


>gi|163869208|ref|YP_001610460.1| lipoprotein carrier protein [Bartonella tribocorum CIP 105476]
 gi|161018907|emb|CAK02465.1| lipoprotein carrier protein [Bartonella tribocorum CIP 105476]
          Length = 202

 Score = 74.7 bits (182), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 92/203 (45%), Gaps = 9/203 (4%)

Query: 2   AFLLYKSVIGVV-ILFFYSAIFPF--NAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-ED 57
           +FL  + V G+V IL F    FP    ++  + K Q++     HF +I+TM G F+Q   
Sbjct: 4   SFLPQRRVFGLVGILVFCCLTFPAFSQSSNKVAKAQNIA---NHFAAIKTMTGDFIQFSP 60

Query: 58  AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIF 117
            G + +G F++ RP K  F Y     + +I+DG  + + N  L+TW+   L       + 
Sbjct: 61  KGKMSQGTFYLERPGKIRFIYKK-MPLQIIADGQFVGINNRALNTWNFSQLSQTPMKFLL 119

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSI 176
            +   +    +     +   +TI  +D  +G   I + FD  S+ L  W I+D     + 
Sbjct: 120 DDKIDLSSGRLLAFREDPGAVTIVLRDKTIGAGQIRMVFDSKSFALRQWTIVDQQNLETT 179

Query: 177 IKILKYKENTVLDPKVFEIPYDK 199
           ++I+  +        +F +P  K
Sbjct: 180 VQIMNVRTGVRFVQGMFTLPSKK 202


>gi|300024805|ref|YP_003757416.1| outer membrane lipoprotein carrier protein LolA [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526626|gb|ADJ25095.1| outer membrane lipoprotein carrier protein LolA [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 251

 Score = 74.3 bits (181), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 86/165 (52%), Gaps = 5/165 (3%)

Query: 36  VKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           VK+  ++F S+Q ++G F+Q DA    MKG+FF+ RP +F F YS PS   +ISDG N+A
Sbjct: 76  VKQVSDYFGSVQGLKGAFVQVDADNKRMKGKFFVKRPGRFRFDYSLPSKQIIISDGENLA 135

Query: 95  VYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSFITIFFKD---DFMGNM 150
           + +  L+      L    F ++   +  +++++ I  V+  +  I +  +D   D  G +
Sbjct: 136 IQDLDLNNEDRVSLDQTPFRMLLRKDVDLLRDAKITEVQQADDLIVLGLEDKDPDAPGKI 195

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
                 + +  L  W   D+    + +++L  +++  LD  +F+I
Sbjct: 196 KLYLATKPNIELKEWVTTDAQGLNTRVELLGLEKSNDLDSNLFKI 240


>gi|167648963|ref|YP_001686626.1| outer membrane lipoprotein carrier protein LolA [Caulobacter sp.
           K31]
 gi|167351393|gb|ABZ74128.1| outer membrane lipoprotein carrier protein LolA [Caulobacter sp.
           K31]
          Length = 212

 Score = 74.3 bits (181), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 85/163 (52%), Gaps = 7/163 (4%)

Query: 36  VKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           V +A  +  ++ + +G F+Q DA G   +G F++ RP K  F Y  P+ + ++S+G+N+ 
Sbjct: 40  VDRATAYIQTLGSAKGRFVQTDARGSQTQGLFYLQRPGKARFAYDGPAGLLVVSNGANVN 99

Query: 95  VYNAKLDTWSVYPLRYMAFSVIFSN----NQHVIQESIQRVESNNSFITIFFKDDFMGNM 150
           +Y+++L T+  YPL     +++ +     ++ V    ++++    +   +  K   +G  
Sbjct: 100 IYDSRLKTFESYPLNRTPLALLLAREVRLDRGVTITGVRKLSDGFTITAVDAKRQTLGR- 158

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
           I++ F      L  W + D     + +++  +++ + LDPK+F
Sbjct: 159 IALDFSNAPA-LTGWTVTDVKGGETRVRLADFEKTSGLDPKLF 200


>gi|217976523|ref|YP_002360670.1| outer membrane lipoprotein carrier protein LolA [Methylocella
           silvestris BL2]
 gi|217501899|gb|ACK49308.1| outer membrane lipoprotein carrier protein LolA [Methylocella
           silvestris BL2]
          Length = 227

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 91/175 (52%), Gaps = 5/175 (2%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           +++KA ++F +  TM G F+Q    G   +G+ F+ RP K  F+Y+ P+++ +++DG ++
Sbjct: 52  AIQKANDYFNTATTMIGDFVQIGPDGRRAEGKIFVQRPGKLRFEYAPPATLEIVADGLSV 111

Query: 94  AVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKD--DFMG-N 149
           AV++ K  T  VY +       +  ++  + ++  I  V S+ S + I  +D   F G +
Sbjct: 112 AVHDRKTATKDVYFISQTPLKFLLKDHVDLNRDVKIVNVASDPSSVVIQVEDTATFGGTS 171

Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
            I + FD   + L  W++ D     ++I +         DP +F++  ++I N N
Sbjct: 172 EIKLIFDPAKFTLKQWQVTDPQGYETVISLFNIDLTKKPDPNIFQLTQERIPNTN 226


>gi|49476205|ref|YP_034246.1| Outer membrane lipoprotein carrier protein [Bartonella henselae
           str. Houston-1]
 gi|49239013|emb|CAF28313.1| Outer membrane lipoprotein carrier protein [Bartonella henselae
           str. Houston-1]
          Length = 202

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 90/201 (44%), Gaps = 7/201 (3%)

Query: 3   FLLYKSVIGVV-ILFFYSAIFP-FNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           FLL + +   V IL F    FP F+ +    K    +K   HF +I+TM G F+Q    G
Sbjct: 5   FLLRRRIFAFVGILIFSCLTFPAFSQSS--NKVARAQKIANHFAAIKTMTGDFIQFSPKG 62

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
            + +G F++ RP K  F Y     + +I+DG  I + N  L+TW+   L       +  +
Sbjct: 63  KMSQGTFYLERPGKIRFIYKK-IPLQIIADGQFIGINNRALNTWNFSKLFQTPMKFLLDD 121

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
             ++    +     +   +TI  +D  +G   I + FD  +Y L  W I+D     + ++
Sbjct: 122 KINISSGRLLAFREDPGAVTIVLRDKSVGAGQIRMVFDSKTYSLRQWTIVDQQNLETTVQ 181

Query: 179 ILKYKENTVLDPKVFEIPYDK 199
           I+  +        +F +P  K
Sbjct: 182 IMNVRTGVRFADGMFTLPSKK 202


>gi|154245784|ref|YP_001416742.1| outer membrane lipoprotein carrier protein LolA [Xanthobacter
           autotrophicus Py2]
 gi|154159869|gb|ABS67085.1| outer membrane lipoprotein carrier protein LolA [Xanthobacter
           autotrophicus Py2]
          Length = 312

 Score = 72.4 bits (176), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 89/176 (50%), Gaps = 15/176 (8%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           +V +   ++ S+Q++ G F Q D  G    G+ +M +P +  F+Y +PS V LI++G ++
Sbjct: 140 TVDRVTNYYNSVQSLTGNFTQIDPDGTRRTGDVYMQKPGRVRFEYDAPSPVELIANGQSV 199

Query: 94  AVYNAKLDTWSVYPLRY------MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD-- 145
           AV + KL+T  + PL        +A  +  + +QHV       V  ++ FI++  ++   
Sbjct: 200 AVRDRKLNTQDITPLSQTPLRFLLAERIDLATDQHVAG-----VFQDDKFISVIIQEQVP 254

Query: 146 FMGN-MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
            MG   + + FD  +  L  W I D     + + +   + N   DPK+F I ++++
Sbjct: 255 MMGTYRLLILFDAKTSALKQWIITDPQGYDTQVTLSNVQVNKKPDPKLFVINFERM 310


>gi|92115723|ref|YP_575452.1| outer membrane lipoprotein carrier protein LolA [Nitrobacter
           hamburgensis X14]
 gi|91798617|gb|ABE60992.1| outer membrane lipoprotein carrier protein LolA [Nitrobacter
           hamburgensis X14]
          Length = 339

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 83/165 (50%), Gaps = 5/165 (3%)

Query: 45  SIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW 103
           S++T+ G F+Q    G    GEF++ +P K  F+Y  PS +++ISDGS++ V + KL T 
Sbjct: 174 SLRTLAGNFVQVGPDGSRSTGEFYIQKPGKVRFEYDPPSPIAMISDGSSLVVRDTKLATQ 233

Query: 104 SVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSFI--TIFFKDDFMG-NMISVTFDRLS 159
            +YPL       + S+   +++++ +  V S++ +I  TI  K   +G + + +      
Sbjct: 234 DIYPLSQTPLRYLLSDRIDLMKDTNVVSVTSDDLYISVTIEEKQALIGTSRLMLMVGAKD 293

Query: 160 YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
            +L  W + D     + + I        LDP +F+I Y +    N
Sbjct: 294 GKLKQWTVTDPQGYDTTVAIYNLNTTAKLDPALFKIDYTRYPTSN 338


>gi|85714110|ref|ZP_01045099.1| Outer membrane lipoprotein carrier protein LolA [Nitrobacter sp.
           Nb-311A]
 gi|85699236|gb|EAQ37104.1| Outer membrane lipoprotein carrier protein LolA [Nitrobacter sp.
           Nb-311A]
          Length = 413

 Score = 72.0 bits (175), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 88/178 (49%), Gaps = 15/178 (8%)

Query: 31  TKDQSVKKA-IEHFLS-IQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLI 87
           + DQ    A +  +LS ++T+ G F+Q    G    GEF++ +P K  F+Y  PS +++I
Sbjct: 231 SADQKAAAARVSAYLSSLRTLAGNFVQVGPDGSRSTGEFYIQKPGKVRFEYDPPSPIAMI 290

Query: 88  SDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSFITIFF--KD 144
           SDGS++ V + +L T  VYPL       + S+   +++++ +  V S++ +I++    K 
Sbjct: 291 SDGSSLVVRDTRLATQDVYPLSQTPLRYLLSDRLDLMKDTNVVAVTSDDLYISVIIEEKQ 350

Query: 145 DFMGN-----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
             +G      M+ V   +L      W + D     + + I        LDP +F+I Y
Sbjct: 351 ALVGTSRLMLMVGVKDGKLK----QWTVTDPQGYDTTVAIYNLNSTAKLDPALFKIDY 404


>gi|115522425|ref|YP_779336.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris BisA53]
 gi|115516372|gb|ABJ04356.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris BisA53]
          Length = 282

 Score = 72.0 bits (175), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 82/163 (50%), Gaps = 13/163 (7%)

Query: 42  HFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL 100
           +  S+QT+ G F+Q    G   +G+F++ +P K  F+Y  PS +++I+DGS++AV + KL
Sbjct: 114 YLSSLQTLVGNFVQVGPDGSRTQGDFYVQKPGKMRFEYDDPSPIAIIADGSSVAVRDRKL 173

Query: 101 DTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSFITIFFKDDFMGNMISVTFDRL- 158
            T  +YPL       + S+   +++++ +  V S+  +I++  ++      + V   RL 
Sbjct: 174 ATQDIYPLSQTPLRYLLSDRIDLLRDTNVVSVSSDELYISVIIEE----KQVVVGTSRLL 229

Query: 159 ------SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
                   +L  W + D     + + +        LDP +F+I
Sbjct: 230 LMIGVKDGQLKQWTVTDPQGYDTTVAVYNLDATKKLDPGMFKI 272


>gi|148251753|ref|YP_001236338.1| hypothetical protein BBta_0134 [Bradyrhizobium sp. BTAi1]
 gi|146403926|gb|ABQ32432.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 257

 Score = 71.2 bits (173), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 82/163 (50%), Gaps = 5/163 (3%)

Query: 38  KAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY 96
           K   +  S+QT+ G F+Q    G   KG+F++ +P K  F+Y  P+ + +I+DGS++ V 
Sbjct: 84  KVSAYLSSLQTLVGNFVQVGPDGSKTKGDFYIQKPGKVRFEYDPPTPIDIIADGSSLVVR 143

Query: 97  NAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSFITIFF--KDDFMG-NMIS 152
           + KL T  VYPL       + S+   +++++ +  V S++ ++TI    K   +G + + 
Sbjct: 144 DRKLATQDVYPLSQTPLRYLLSDRIDLLKDTNVIAVASDDLYVTITIEEKQALIGTSRLM 203

Query: 153 VTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
           +       +L  W + D     + I +        LDP +F+I
Sbjct: 204 LMLGAKDGQLKQWTVTDPQGYDTTIAVYNLDTTKKLDPAMFKI 246


>gi|75674283|ref|YP_316704.1| Outer membrane lipoprotein carrier protein LolA [Nitrobacter
           winogradskyi Nb-255]
 gi|74419153|gb|ABA03352.1| Outer membrane lipoprotein carrier protein LolA [Nitrobacter
           winogradskyi Nb-255]
          Length = 258

 Score = 71.2 bits (173), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 79/160 (49%), Gaps = 13/160 (8%)

Query: 45  SIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW 103
           S++T+ G F+Q    G    GEF++ +P K  F+Y  PS +++ISDGS++ + + +L T 
Sbjct: 92  SLRTLAGKFVQVGPDGSRSTGEFYIQKPGKVRFEYDPPSPIAMISDGSSLVIRDTRLATQ 151

Query: 104 SVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSFITIFF--KDDFMGN-----MISVTF 155
            VYPL       + S+   +++++ +  V S++ +I++    K   +G      M+ V  
Sbjct: 152 DVYPLSQTPLRYLLSDRIDLMRDTNVVAVTSDDLYISVIIEEKQALVGTSRLMFMVGVKD 211

Query: 156 DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
            +L      W I D     + + I        LDP +F I
Sbjct: 212 GKLK----QWTITDPQGYDTTVAIYNLNPTAKLDPALFRI 247


>gi|16127935|ref|NP_422499.1| hypothetical protein CC_3705 [Caulobacter crescentus CB15]
 gi|221236756|ref|YP_002519193.1| outer-membrane lipoproteins carrier protein [Caulobacter crescentus
           NA1000]
 gi|13425471|gb|AAK25667.1| hypothetical protein CC_3705 [Caulobacter crescentus CB15]
 gi|220965929|gb|ACL97285.1| outer-membrane lipoproteins carrier protein [Caulobacter crescentus
           NA1000]
          Length = 219

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 80/161 (49%), Gaps = 6/161 (3%)

Query: 38  KAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY 96
           KA  +   + + +G F+Q D  G   +G F++ RP K  F Y  P+ + ++S+G+N+ ++
Sbjct: 48  KATAYIQGLSSAKGRFVQTDQRGTQTQGTFYLQRPGKARFAYDPPAGLLVVSNGNNVNIF 107

Query: 97  NAKLDTWSVYPLRYMAFSVIFSN----NQHVIQESIQRVESNNSFITIFFKDDFMGNMIS 152
           +++L T+  YPL     +++ +     ++ V+   ++ +    + +    K   +G  IS
Sbjct: 108 DSRLKTYESYPLSKTPLNLLLAREVRLDRGVVITDVRPLADGFTIVAQDAKRQALGR-IS 166

Query: 153 VTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
           + F      L+ W + D       +++  + E   LDPK+F
Sbjct: 167 IDFSNGLVGLMGWTVTDIKGGQIRVRLSDFAETADLDPKLF 207


>gi|315497244|ref|YP_004086048.1| outer membrane lipoprotein carrier protein lola [Asticcacaulis
           excentricus CB 48]
 gi|315415256|gb|ADU11897.1| outer membrane lipoprotein carrier protein LolA [Asticcacaulis
           excentricus CB 48]
          Length = 221

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 84/178 (47%), Gaps = 7/178 (3%)

Query: 32  KDQS-VKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISD 89
           +DQ  + +A+ +  S+ T  G F Q D  G    G++++ RP K  F+Y +P S+ ++SD
Sbjct: 44  QDQGRIDRAVAYLQSLGTGGGRFEQTDYKGRTTAGKWWLQRPGKIRFEYDAPYSLLVVSD 103

Query: 90  GSNIAVYNAKLDTWSVYPLRYMAFSVIFSN----NQHVIQESIQRVESNNSFITIFFKDD 145
           G  +  ++ +L  ++ YPL     S+  S     +Q VI   +              + D
Sbjct: 104 GKTVNTWDPRLKAFNQYPLNATPLSLFLSKQIRLDQGVIVTEVTPTTDGFRLKARDRRRD 163

Query: 146 FMGNMISVTFDRL-SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
             G+++    +R  + +L  W + D   + + ++++ +  NT + P +F +   K  N
Sbjct: 164 VEGSILMTFIERGNALQLGEWTVTDQQGKGTRVRLVTFDRNTAVRPDLFVLKKPKGAN 221


>gi|146337390|ref|YP_001202438.1| putative signal peptide [Bradyrhizobium sp. ORS278]
 gi|146190196|emb|CAL74188.1| conserved hypothetical protein; putative signal peptide
           [Bradyrhizobium sp. ORS278]
          Length = 255

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 85/168 (50%), Gaps = 6/168 (3%)

Query: 34  QSVKKAIEHFLS-IQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGS 91
           ++V   +  +LS +QT+ G F+Q    G   KG+F++ +P K  F+Y  P+ + +I+DGS
Sbjct: 78  KAVAAKVSAYLSSLQTLVGNFVQVGPDGSKTKGDFYIQKPGKVRFEYEPPTPIDIIADGS 137

Query: 92  NIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSFITIFF--KDDFMG 148
           ++ V + KL T  VYPL       + S+   +++++ +  V ++  ++TI    K   +G
Sbjct: 138 SLVVRDRKLATQDVYPLSQTPLRYLLSDRIDLLKDTNVIAVTADELYVTITIEEKQALIG 197

Query: 149 -NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
            + + +       +L  W + D     + I +        LDP +F+I
Sbjct: 198 TSRLMLMLGAKDGQLKQWTVTDPQGYDTTIAVYNLDTTKKLDPAMFKI 245


>gi|27375728|ref|NP_767257.1| hypothetical protein blr0617 [Bradyrhizobium japonicum USDA 110]
 gi|27348866|dbj|BAC45882.1| blr0617 [Bradyrhizobium japonicum USDA 110]
          Length = 251

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 83/163 (50%), Gaps = 5/163 (3%)

Query: 38  KAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY 96
           K   +  S+ T+ G F+Q    G   +G+F++ +P K  F+Y +PS + +++DGS++ V 
Sbjct: 79  KVSAYLSSLSTLVGNFVQVGPDGSKTQGDFYIQKPGKVRFEYDAPSPIDIVADGSSLVVR 138

Query: 97  NAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSF--ITIFFKDDFMG-NMIS 152
           + KL T  VYPL       + S+   +++++ +  V +++ F  +TI  K   +G + + 
Sbjct: 139 DRKLATQDVYPLSQTPLRFLLSDRIDLMKDTNVVNVSADDVFVSVTIEEKQALVGTSRLL 198

Query: 153 VTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
           + F     +L  W + D     + I +        LDP +F+I
Sbjct: 199 LMFGAKDGQLKQWTVTDPQGYDTTIAVYNLDATKKLDPGMFKI 241


>gi|316931740|ref|YP_004106722.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris DX-1]
 gi|315599454|gb|ADU41989.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris DX-1]
          Length = 313

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 84/165 (50%), Gaps = 5/165 (3%)

Query: 38  KAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY 96
           K   +  S+QT+ G F+Q    G  + G+F++ +P K  F+Y  PS VS+I+DG ++ V 
Sbjct: 141 KVSAYLSSLQTLVGQFVQVGPDGSKLTGDFYIVKPGKIRFEYDEPSPVSMIADGQSVVVR 200

Query: 97  NAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNN--SFITIFFKDDFMG-NMIS 152
           + KL T  VYPL       + S+   +++++ +  + S++  S I I  K+  +G + + 
Sbjct: 201 DRKLATQDVYPLSQTPLRYLLSDRIDLLRDTNVVSITSDDLYSNIIIEEKNAIIGTSRLL 260

Query: 153 VTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
           + F     +L  W + D     + + +     +   DP +F+I Y
Sbjct: 261 LMFGTKDGQLKQWTVTDPQGYDTTVAVYNLDTSRRPDPSMFKIDY 305


>gi|298293366|ref|YP_003695305.1| outer membrane lipoprotein carrier protein LolA [Starkeya novella
           DSM 506]
 gi|296929877|gb|ADH90686.1| outer membrane lipoprotein carrier protein LolA [Starkeya novella
           DSM 506]
          Length = 252

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 79/178 (44%), Gaps = 23/178 (12%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           +V++   +F S + M G F+Q D  G   +G+FF+ +P +  F+Y  PS + L++DG ++
Sbjct: 84  TVQRINTYFNSFKNMTGNFVQVDPDGTRRQGQFFILKPGRVLFEYDPPSRIELVADGRSV 143

Query: 94  AVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMI-- 151
           AV + +L T  + PL       + S N  +         + N+ +T  ++DD    ++  
Sbjct: 144 AVRDKRLKTQDISPLSATPLRFLLSENFDL---------ARNANVTGVYQDDLFATVVIE 194

Query: 152 -----------SVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                       + FD  + +L  W + D     + + +         DP +F I  D
Sbjct: 195 ERQAMTGTYKLMIMFDAKTMQLKQWTVTDPQGYDTTVAVSNLDTGERPDPMLFVINRD 252


>gi|323138222|ref|ZP_08073294.1| outer membrane lipoprotein carrier protein LolA [Methylocystis sp.
           ATCC 49242]
 gi|322396474|gb|EFX99003.1| outer membrane lipoprotein carrier protein LolA [Methylocystis sp.
           ATCC 49242]
          Length = 257

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 91/175 (52%), Gaps = 13/175 (7%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLIS 88
           + +++++K+A   F +   M   F+Q  A G   +G+  + R  +  F+Y+ P+++ +++
Sbjct: 85  LNREEAIKRANAFFNTSPVMTADFVQIGADGKRSEGKLHVQRAGRVRFEYAQPATMEVVA 144

Query: 89  DGSNIAVYNAKLDTWSVY-----PLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFK 143
           DG+ +AV + KL T  +Y     PL+++    I       +Q+    V  ++S +TIF +
Sbjct: 145 DGAQVAVRDRKLGTQDLYFITQTPLKFLMKDKIDLEKDVTVQD----VTFDDSGVTIFIE 200

Query: 144 DD--FMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
           D   F G + + + FD  +++L  W++ D     ++I +    +    DP +F+I
Sbjct: 201 DKATFGGTSHLRLIFDPKTFKLKQWQVKDPQGYETLISLFNIDQTKTPDPGLFKI 255


>gi|86747504|ref|YP_484000.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris HaA2]
 gi|86570532|gb|ABD05089.1| Outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris HaA2]
          Length = 317

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 82/167 (49%), Gaps = 13/167 (7%)

Query: 38  KAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY 96
           K   +  S+ T+ G F+Q    G  ++G+F++ +P K  F+Y  PS VS++SDG ++AV 
Sbjct: 145 KVSAYLSSLSTLVGNFVQVGPDGSRLQGDFYIMKPGKVRFEYDEPSPVSMVSDGQSLAVR 204

Query: 97  NAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSFITIFF--KDDFMGN---- 149
           + KL T  VYPL       + S+   +++++ +  + S+  +I+I    ++  +G     
Sbjct: 205 DRKLATQDVYPLSQTPLRYLLSDRIDLLRDTNVVAISSDELYISIIIEERNAVIGTSRLM 264

Query: 150 -MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
            M+ V   +L      W + D     + + I         DP +F+I
Sbjct: 265 LMLGVKDGQLK----QWTVTDPQGYDTTVAIYNLDTTRRPDPSMFKI 307


>gi|299133178|ref|ZP_07026373.1| outer membrane lipoprotein carrier protein LolA [Afipia sp. 1NLS2]
 gi|298593315|gb|EFI53515.1| outer membrane lipoprotein carrier protein LolA [Afipia sp. 1NLS2]
          Length = 285

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 81/165 (49%), Gaps = 5/165 (3%)

Query: 38  KAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY 96
           K   +  S+Q + G F+Q    G    G F++ +P K  F+Y  PS ++L++DG+++ V 
Sbjct: 113 KVSAYLSSLQNLSGNFVQVGPDGSRTTGNFYLQKPGKIRFEYDDPSPIALVADGTSVIVR 172

Query: 97  NAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSF--ITIFFKDDFMG-NMIS 152
           + +L T  VYPL       + ++   +++++ +  + +++ +  ITI  K    G + ++
Sbjct: 173 DRRLATQDVYPLSQTPLRYLLASKLDLLRDTNVTSISADDLYISITIEEKQAVTGTSRLT 232

Query: 153 VTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
           +       +L  W + D     + + +        LDP +F+I Y
Sbjct: 233 LMVGAKDGKLKQWTVTDPQGYDTTVAVYNLDTTKKLDPALFKIDY 277


>gi|254418783|ref|ZP_05032507.1| Outer membrane lipoprotein carrier protein LolA [Brevundimonas sp.
           BAL3]
 gi|196184960|gb|EDX79936.1| Outer membrane lipoprotein carrier protein LolA [Brevundimonas sp.
           BAL3]
          Length = 227

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 77/165 (46%), Gaps = 5/165 (3%)

Query: 36  VKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           V++A  +  ++ + QGTF++    G   +G F++ RP K  F+Y+SP+ + ++SDG N+ 
Sbjct: 53  VQQAQAYLQTLTSAQGTFVETGPGGQRREGRFYLQRPGKMRFEYTSPAGLLVVSDGYNVK 112

Query: 95  VYNAKLDTWSVYPLRYMAFSVIFSNN----QHVIQESIQRVESNNSFITIFFKDDFMGNM 150
            Y+ +L+ +   PL     S   + N    Q V  + + R+ S    IT           
Sbjct: 113 RYDPRLNNFQQVPLGRTPLSTFLARNVRLDQGVRIDRVTRMSSGAFAITARDSGRPNDGA 172

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
           + + F     RL  W I D+    +  ++   +  + L   +F++
Sbjct: 173 VVLAFAGDPMRLHEWTITDAQGARTRTQLTALQPASNLASSLFQL 217


>gi|209883510|ref|YP_002287367.1| outer membrane lipoprotein carrier protein LolA [Oligotropha
           carboxidovorans OM5]
 gi|209871706|gb|ACI91502.1| outer membrane lipoprotein carrier protein LolA [Oligotropha
           carboxidovorans OM5]
          Length = 276

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 88/192 (45%), Gaps = 13/192 (6%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSK 73
           LF   +  P   A+   +     K   +  S+Q + G F+Q    G    G F+M +P K
Sbjct: 81  LFGNDSAAPRVQAFDANQRALAAKVSAYLSSVQNLSGNFVQVGPDGSRTTGTFYMLKPGK 140

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVE 132
             F+Y  PS ++L++DG+++ V + +L T  VYPL       + +++  +++++ +  + 
Sbjct: 141 IRFEYDDPSPIALVADGTSVIVRDRRLATQDVYPLSQTPLRYLLASHIDLLKDTNVTGIS 200

Query: 133 SNNSF--ITIFFKDDFMGN-----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +++ +  ITI  K    G      M+    D+L      W + D     + + +     +
Sbjct: 201 ADDLYISITIEEKQAVTGTSRLTLMVGAKDDKLK----QWTVTDPQGYDTTVAVYNLDAS 256

Query: 186 TVLDPKVFEIPY 197
              DP +F+I Y
Sbjct: 257 KKPDPSLFKIDY 268


>gi|302382163|ref|YP_003817986.1| outer membrane lipoprotein carrier protein LolA [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192791|gb|ADL00363.1| outer membrane lipoprotein carrier protein LolA [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 211

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 80/168 (47%), Gaps = 9/168 (5%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQEDAGYVMK-GEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           ++  A  +  ++ + QGTF +  AG   + G F++ RP +  F+Y+ P+ + ++SDGSN+
Sbjct: 36  TLATAQTYLQNLTSAQGTFTETGAGGQRRSGRFWLQRPGRMRFEYTDPAGLLVVSDGSNV 95

Query: 94  AVYNAKLDTWSVYPLRYMAFSVIFSNN----QHVIQESIQRVESNNSFITIFFKDDFMGN 149
             Y+ +L+ +   PL     S   + N    Q V  + + R++S    +T+  +D    N
Sbjct: 96  KRYDPRLNVFRQVPLGATPLSTFLARNVRLDQGVRIDRVTRMQSGAFALTV--RDSSRPN 153

Query: 150 MISV--TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
             SV   F     RL  W I ++S   +  ++      + L   +F +
Sbjct: 154 DGSVILAFAGNPMRLQEWTITEASGARTRTQLTSLTPASGLSASLFRL 201


>gi|90421801|ref|YP_530171.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris BisB18]
 gi|90103815|gb|ABD85852.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris BisB18]
          Length = 280

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 76/154 (49%), Gaps = 13/154 (8%)

Query: 51  GTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR 109
           G F+Q    G   KG+F++ +P K  F+Y  PS +++I+DG+++AV + KL T  +YPL 
Sbjct: 121 GNFVQVGPDGSRTKGDFYIQKPGKVRFEYDEPSPIAIIADGNSVAVRDRKLATQDIYPLS 180

Query: 110 YMAFSVIFSNNQHVIQES-IQRVESNNSFITIFFKDDFMGNMISVTFDRL-------SYR 161
                 + S+   +++++ +  V +++ FI++  ++      + V   RL         +
Sbjct: 181 QTPLRYLLSDRIDLLRDTNVVSVTADDVFISVVIEE----KQVLVGTSRLMLMIGAKDNQ 236

Query: 162 LLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
           L  W + D     + + +         DP +F+I
Sbjct: 237 LKQWTVTDPQGYDTTVAVYNLDATKKPDPGMFKI 270


>gi|46201081|ref|ZP_00055780.2| COG2834: Outer membrane lipoprotein-sorting protein
           [Magnetospirillum magnetotacticum MS-1]
          Length = 209

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 88/192 (45%), Gaps = 5/192 (2%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEF 66
           +V+  ++L    A  P            +++A ++   + T++  FLQ    G  ++G+ 
Sbjct: 3   AVLCSLLLTTAQAAQPARLPLSAQDKADIERAEDYLNGVTTLKARFLQVSPNGASVEGDA 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE 126
           +++RP K   +Y  PS + +++DGS + V++ +L   S  PL      ++   N  +   
Sbjct: 63  YLSRPGKLRLQYDPPSPLLVVADGSFLIVHDQQLGEPSYIPLGSTPAGILVRPNVRLNGG 122

Query: 127 --SIQRVESNNSF--ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
             ++ RV        I++   +D     I++ F    + L  W++ D+  + + + + + 
Sbjct: 123 DVAVTRVVRLPGVVRISVVEAEDPASGEITLVFSDKPFALRQWQVKDAQHQVTTVSLYQA 182

Query: 183 KENTVLDPKVFE 194
           +    LD K+FE
Sbjct: 183 QSGLTLDAKLFE 194


>gi|304320398|ref|YP_003854041.1| hypothetical protein PB2503_04122 [Parvularcula bermudensis
           HTCC2503]
 gi|303299300|gb|ADM08899.1| hypothetical protein PB2503_04122 [Parvularcula bermudensis
           HTCC2503]
          Length = 284

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 74/163 (45%), Gaps = 5/163 (3%)

Query: 38  KAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY 96
           KA+    SI  +Q  F Q   +G V  G  ++ RP K  F+Y  PS   +++ G  + V+
Sbjct: 113 KAVVSLESIDRLQAAFAQRSPSGGVYSGTLYLDRPGKLRFEYDDPSPQLIVATGGLVYVH 172

Query: 97  NAKLDTWSVYPLRYMAFSVIFS---NNQHVIQESIQRVESNNSFITIFFKDDFMGNMISV 153
           +  L T   YP+     S++ S   + Q  +   +QR E +   +T+   DD +   +++
Sbjct: 173 DEDLKTTDSYPVGETPLSLLLSERIDTQSAVLRGVQRYE-DRVAVTVRSTDDAVTGDLTL 231

Query: 154 TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
            F      L +W + ++    +++ +        L  ++F IP
Sbjct: 232 IFTAPDMALRSWIVTETDGSRTVVDLSNVTAPQRLANRLFRIP 274


>gi|114571485|ref|YP_758165.1| outer membrane lipoprotein carrier protein LolA [Maricaulis maris
           MCS10]
 gi|114341947|gb|ABI67227.1| outer membrane lipoprotein carrier protein LolA [Maricaulis maris
           MCS10]
          Length = 221

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 80/172 (46%), Gaps = 4/172 (2%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLI 87
           P+ ++ ++        SI T++  F+Q    G   +G   ++RP +    Y  P+ + +I
Sbjct: 38  PLDRETALAGINAALNSIDTLRSRFIQIAPDGSSAQGNLALSRPGRLRLDYDEPNPLRII 97

Query: 88  SDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKD-- 144
           +DG+ IAV +  L+T    PLR      +      + ++ +I  +E    F+ +  +D  
Sbjct: 98  ADGTTIAVEDRALETVDRIPLRSTPLWWLLKPEIDIAEDAAIVSLEREFGFLYLTLRDPS 157

Query: 145 DFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
           D M   I   F +  + L  W + D+    + + ++  + +  L+P++F IP
Sbjct: 158 DEMEGEIMFVFSQSDHALREWFVTDALGEITRVSLIDVQSDVTLNPRIFVIP 209


>gi|91974923|ref|YP_567582.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris BisB5]
 gi|91681379|gb|ABE37681.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris BisB5]
          Length = 315

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 79/160 (49%), Gaps = 13/160 (8%)

Query: 45  SIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW 103
           S+ T+ G F+Q    G  +KG+F++ +P K  F+Y  PS +S++++G ++ V + KL T 
Sbjct: 150 SLSTLVGNFVQVGPDGSKLKGDFYIMKPGKVRFEYDEPSPISMVANGQSLVVRDRKLATQ 209

Query: 104 SVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFF--KDDFMGN-----MISVTF 155
            +YPL       + S+   ++++ S+  + S+  +I+I    K+  +G      M+ V  
Sbjct: 210 DIYPLSQTPLRYLLSDRIDLLRDTSVVAITSDELYISIIIEEKNAVIGTSRLMLMLGVKD 269

Query: 156 DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
            +L      W + D     + + I         DP +F+I
Sbjct: 270 GQLK----QWTVTDPQGYDTTVAIYNLDTARRPDPAMFKI 305


>gi|218532291|ref|YP_002423107.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           chloromethanicum CM4]
 gi|254563360|ref|YP_003070455.1| hypothetical protein METDI5027 [Methylobacterium extorquens DM4]
 gi|218524594|gb|ACK85179.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           chloromethanicum CM4]
 gi|254270638|emb|CAX26642.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens DM4]
          Length = 315

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 83/176 (47%), Gaps = 13/176 (7%)

Query: 36  VKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           V  A  +F   QT+ G F+Q  A G  + G+  +A+P +  F+Y  PS + +++DG+++A
Sbjct: 132 VAAANSYFNGFQTLTGGFIQIGADGRRIGGKLTLAKPGRLRFEYDQPSPLEVVADGTSVA 191

Query: 95  VYNAKLDTWSVY-----PLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKD-DFMG 148
           V + KL T  +Y     PL+++    I       + E    V ++   + I  +D   +G
Sbjct: 192 VRDRKLGTQDLYFISQTPLKFLLREKIDLARDLTVSE----VTNDPGGVRIGLEDRSTLG 247

Query: 149 NM--ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
               I + FD     L  W+I D     + +++   ++   +D  +F I Y +  +
Sbjct: 248 GTSKIQLFFDAEMKTLSQWRITDPQGYLTTVQLSNLQKGKAVDGSLFFINYGRSED 303


>gi|240140851|ref|YP_002965331.1| hypothetical protein MexAM1_META1p4423 [Methylobacterium extorquens
           AM1]
 gi|240010828|gb|ACS42054.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens AM1]
          Length = 315

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 83/176 (47%), Gaps = 13/176 (7%)

Query: 36  VKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           V  A  +F   QT+ G F+Q  A G  + G+  +A+P +  F+Y  PS + +++DG+++A
Sbjct: 132 VAAANSYFNGFQTLTGGFIQIGADGRRIGGKLTLAKPGRLRFEYDQPSPLEVVADGTSVA 191

Query: 95  VYNAKLDTWSVY-----PLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKD-DFMG 148
           V + KL T  +Y     PL+++    I       + E    V ++   + I  +D   +G
Sbjct: 192 VRDRKLGTQDLYFISQTPLKFLLREKIDLARDLTVSE----VTNDPGGVRIGLEDRSTLG 247

Query: 149 NM--ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
               I + FD     L  W+I D     + +++   ++   +D  +F I Y +  +
Sbjct: 248 GTSKIQLFFDAEMKTLSQWRITDPQGYLTTVQLSNLQKGKAVDGSLFFINYGRSED 303


>gi|163853431|ref|YP_001641474.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           extorquens PA1]
 gi|163665036|gb|ABY32403.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           extorquens PA1]
          Length = 315

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 83/176 (47%), Gaps = 13/176 (7%)

Query: 36  VKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           V  A  +F   QT+ G F+Q  A G  + G+  +A+P +  F+Y  PS + +++DG+++A
Sbjct: 132 VAAANSYFNGFQTLTGGFIQIGADGRRIGGKLTLAKPGRLRFEYDQPSPLEVVADGTSVA 191

Query: 95  VYNAKLDTWSVY-----PLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKD-DFMG 148
           V + KL T  +Y     PL+++    I       + E    V ++   + I  +D   +G
Sbjct: 192 VRDRKLGTQDLYFISQTPLKFLLREKIDLARDLTVSE----VTNDPGGVRIGLEDRSTLG 247

Query: 149 NM--ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
               I + FD     L  W+I D     + +++   ++   +D  +F I Y +  +
Sbjct: 248 GTSKIQLFFDAEMKTLSQWRITDPQGYLTTVQLSNLQKGKAVDGSLFFINYGRSED 303


>gi|254292392|ref|YP_003058415.1| outer membrane lipoprotein carrier protein LolA [Hirschia baltica
           ATCC 49814]
 gi|254040923|gb|ACT57718.1| outer membrane lipoprotein carrier protein LolA [Hirschia baltica
           ATCC 49814]
          Length = 227

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 78/155 (50%), Gaps = 8/155 (5%)

Query: 47  QTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV 105
           +T +G F Q DA G +  G+F++ RP +  F+Y++P+   ++SDG+ +A+ + +LDT   
Sbjct: 62  KTARGGFKQTDAMGEITTGDFYLRRPGRVRFEYAAPTPYLIVSDGTTVAIEDKELDTIDR 121

Query: 106 YPLRYMAFSVIFSNNQHVIQE-SIQRVES-NNSFITIFFK-----DDFMGNMISVTFDRL 158
            PL             ++ ++ +I  V S  +S + +        D+ +  ++ + F + 
Sbjct: 122 APLSATPLKHFLKKTLNLAEDTTILDVRSLPDSHLVVIEDNPKNGDEAIDGLVFLKFSKE 181

Query: 159 SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
           +Y L+ W  +D     + + +   + N  + P++F
Sbjct: 182 NYDLMGWVTIDGLGNETRVDLFDMELNGNISPRLF 216


>gi|154251752|ref|YP_001412576.1| outer membrane lipoprotein carrier protein LolA [Parvibaculum
           lavamentivorans DS-1]
 gi|154155702|gb|ABS62919.1| outer membrane lipoprotein carrier protein LolA [Parvibaculum
           lavamentivorans DS-1]
          Length = 243

 Score = 62.0 bits (149), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/176 (20%), Positives = 88/176 (50%), Gaps = 5/176 (2%)

Query: 33  DQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGS 91
           ++++++A  +  +++ +QG FLQ    G V +G+F++ RP +  F+Y  P ++ +++DG+
Sbjct: 66  EKALEQASAYLGALENLQGNFLQVGPDGSVAEGKFYLRRPGRLRFEYEPPENLLVVADGT 125

Query: 92  NIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNS--FITIFFKDDFMG 148
            +AV ++       YP+     +++   N  + + + +  VE+      IT+  +     
Sbjct: 126 WVAVKDSSAPAQR-YPMASTPLNLLLGKNVDLTESARVLNVETQPGALLITLADRSGEAP 184

Query: 149 NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
             I++ FD+ + +L  W + D+    + + +   ++    D  +F +  D+   I 
Sbjct: 185 GKITLIFDQPALQLRQWVVTDAQGLQTTVALRNVQQGIRADNALFVLRDDQRPEIG 240


>gi|170743017|ref|YP_001771672.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           sp. 4-46]
 gi|168197291|gb|ACA19238.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           sp. 4-46]
          Length = 313

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 83/172 (48%), Gaps = 5/172 (2%)

Query: 36  VKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           V++A  +F S+ T+ G F+Q  A G  + G+ ++A+P +  F Y  PS + +++DG+++A
Sbjct: 129 VERANGYFNSVSTLTGNFVQIAADGRKIGGKLYLAKPGRLRFDYDQPSPLEVVADGTSVA 188

Query: 95  VYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKD-DFMGNM-- 150
           V + KL T  +Y +       +  +   + ++ S+  V +    + I  +D   +G    
Sbjct: 189 VRDRKLATQDLYFISQTPLKFLLRDRIDLARDLSVTDVSTEPGGVRISLEDRSTLGGTSR 248

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
           I + FD     L  W+I D     + + +   +    +D  +F I Y +  +
Sbjct: 249 IVLVFDEAMKSLSQWRITDPQGYQTTVLLSNLQRGRPIDGMMFVINYGRPED 300


>gi|329891193|ref|ZP_08269536.1| outer membrane lipocarrier protein LolA family protein
           [Brevundimonas diminuta ATCC 11568]
 gi|328846494|gb|EGF96058.1| outer membrane lipocarrier protein LolA family protein
           [Brevundimonas diminuta ATCC 11568]
          Length = 213

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 83/171 (48%), Gaps = 10/171 (5%)

Query: 33  DQSV-KKAIEHFLSIQTMQGTFLQEDAGYVMK-GEFFMARPSKFYFKYSSPSSVSLISDG 90
           DQ+V ++A  +  ++ T QGTF++       + G +++ RP K  F+Y+ P  + +++DG
Sbjct: 35  DQAVLRQAQTYLTAMTTAQGTFVETGPNNQRRTGRYYLQRPGKMRFEYTEPEGLLVVADG 94

Query: 91  SNIAVYNAKLDTWSVYPLRYMAFSVIFSN----NQHVIQESIQRVESNNSFITIFFKDDF 146
           +N++ ++ +L+ +   PL     S   +     +Q V  + I R++S    IT   +D  
Sbjct: 95  NNVSRWDPRLNVFRQAPLGQTPLSTFLAREVRLDQGVKIDRITRMDSGAFAITA--RDAR 152

Query: 147 MGNMISV--TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
             N  SV   F     RL  W I D+    + +++   +    L   +F++
Sbjct: 153 RPNEGSVILAFAGSPVRLQEWTITDAQGSRTRVQLTTLQPAPGLAASLFQL 203


>gi|83309116|ref|YP_419380.1| Outer membrane lipoprotein-sorting protein [Magnetospirillum
           magneticum AMB-1]
 gi|82943957|dbj|BAE48821.1| Outer membrane lipoprotein-sorting protein [Magnetospirillum
           magneticum AMB-1]
          Length = 218

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 87/176 (49%), Gaps = 7/176 (3%)

Query: 26  AAYPIT-KDQS-VKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPS 82
           A  P+T +D++ + +A E+   + T++  FLQ    G  ++G+ +++RP K   +Y  PS
Sbjct: 28  ARTPLTAQDKADIARAEEYLNGVTTLKARFLQVSPNGASVEGDAYLSRPGKLRLQYDPPS 87

Query: 83  SVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHV--IQESIQRVESNNSF--I 138
            + +++DGS + V++++L   S  PL      ++      +     ++ RV        I
Sbjct: 88  PLLVVADGSFLIVHDSQLGEPSYIPLGSTPAGILVRPGVKLDGADVAVTRVVRLPGVVRI 147

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
           ++   +D     I++ F    + L  W++ D+  + + + + + +    LD K+FE
Sbjct: 148 SVVEAEDPAAGEITLVFSDKPFALRQWQVKDAQHQVTTVSLYQSQSGLSLDSKLFE 203


>gi|188583703|ref|YP_001927148.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           populi BJ001]
 gi|179347201|gb|ACB82613.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           populi BJ001]
          Length = 314

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 83/176 (47%), Gaps = 13/176 (7%)

Query: 36  VKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           V  A  +F   QT+ G F+Q  A G  + G+  +A+P +  F+Y  PS + +++DG+++A
Sbjct: 131 VAAANAYFNGFQTLTGGFIQIGADGRRIGGKLTLAKPGRLRFEYDQPSPLEVVADGTSVA 190

Query: 95  VYNAKLDTWSVY-----PLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKD-DFMG 148
           V + KL T  +Y     PL+++    I       + E    V ++   + I  +D   +G
Sbjct: 191 VRDRKLGTQDLYFISQTPLKFLLRDKIDLARDLTVTE----VTNDPGGVRIALEDRSTLG 246

Query: 149 NM--ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
               I + FD     L  W+I D     + +++   ++   +D  +F I Y +  +
Sbjct: 247 GTSKIQLFFDGELKTLSQWRITDPQGYLTTVQLSNLQKGKAVDGSLFFINYGRSED 302


>gi|170750146|ref|YP_001756406.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656668|gb|ACB25723.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           radiotolerans JCM 2831]
          Length = 302

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 93/200 (46%), Gaps = 16/200 (8%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMAR 70
           V  +   +AI   ++A P T    + +A  +F  I T+ G F+Q  A G  + G+  +A+
Sbjct: 98  VAAVGAPAAIVTGDSADPATL---LAQANAYFNGINTLSGNFVQIGADGRRIGGKLTLAK 154

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY-----PLRYMAFSVIFSNNQHVIQ 125
           P +  F Y  PS + +++DG+++AV + KL+T  +Y     PL+++    I       + 
Sbjct: 155 PGRLRFDYDQPSPLEVVADGTSVAVRDRKLNTQDLYFIAQTPLKFLLREKIDLARDLTVT 214

Query: 126 ESIQRVESNNSFITIFFKDDF-MGNM--ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
           +    V S+   + I  +D   +G    I + FD     L  W+I D     + + +   
Sbjct: 215 D----VASDPGSVRISLEDRATLGGTSKIQLFFDAEMKTLSQWRITDPQGYVTTVTLSNL 270

Query: 183 KENTVLDPKVFEIPYDKIHN 202
           ++   +D  +F I Y +  +
Sbjct: 271 QKGKSVDGSLFFINYGRSED 290


>gi|329847404|ref|ZP_08262432.1| outer membrane lipocarrier protein LolA family protein
           [Asticcacaulis biprosthecum C19]
 gi|328842467|gb|EGF92036.1| outer membrane lipocarrier protein LolA family protein
           [Asticcacaulis biprosthecum C19]
          Length = 223

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 89/189 (47%), Gaps = 19/189 (10%)

Query: 17  FYSAIFP--FNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSK 73
           F   I P  FNAA        + KA ++  ++ T QG F Q D  G    G ++++RP K
Sbjct: 33  FGGLITPPTFNAA----DKGRIDKATQYLQALTTAQGRFEQTDFRGRKTLGNWYLSRPGK 88

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN----NQHVIQESIQ 129
             F+Y +P S+ +++DG  + +++ +L ++  YPL     S+  S     +Q+V+   + 
Sbjct: 89  IRFEYDAPYSLLIVADGQKVKMWDPRLKSFDEYPLGETPLSLFLSRQIRLDQNVV---VT 145

Query: 130 RVESNNSFITIFFKDDF--MGNMISVTFDRLS---YRLLNWKIMDSSRRYSIIKILKYKE 184
           +V+S+    T+  +D    +   I++ FD+       L  W + D+  + + + +  +  
Sbjct: 146 QVKSSALGFTLSARDRRKQVEGHIALVFDQAGNGNLTLREWTVTDAQGKATRVHLTSFNR 205

Query: 185 NTVLDPKVF 193
                  +F
Sbjct: 206 GGGFKSDLF 214


>gi|114798962|ref|YP_762219.1| LolA family outer membrane lipoprotein carrier protein [Hyphomonas
           neptunium ATCC 15444]
 gi|114739136|gb|ABI77261.1| outer membrane lipoprotein carrier protein, LolA family [Hyphomonas
           neptunium ATCC 15444]
          Length = 220

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 79/166 (47%), Gaps = 12/166 (7%)

Query: 36  VKKAIEHFLSIQTMQGTFLQ--EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           +K+A      ++T +G F Q   D  Y   G+F M RP K  F Y  P  + ++SDG+ +
Sbjct: 51  LKQASSALAGVKTARGRFEQYSPDGAYST-GQFAMQRPGKVRFDYDDPVPLLMVSDGTTV 109

Query: 94  AVYNAKLDTWSVYPL------RYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFM 147
           A+ +A L+T    PL        ++  + F +  +V+   ++R     + IT+  K   M
Sbjct: 110 ALQDADLETTDRVPLGSTPLSLLLSDRLDFESQANVL--DVRRANGTTN-ITVQDKAGEM 166

Query: 148 GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
              +++        L+ W+ +D++   + +++   +    L+P++F
Sbjct: 167 EGTLTLVLSEADNSLVGWRSVDANGGNTSVQLSDIETGAKLNPRLF 212


>gi|149915476|ref|ZP_01904003.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseobacter sp. AzwK-3b]
 gi|149810765|gb|EDM70606.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseobacter sp. AzwK-3b]
          Length = 202

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 73/176 (41%), Gaps = 6/176 (3%)

Query: 27  AYPITKDQSVKKAIEHFL-SIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSV 84
           A P   ++    AI  +L  +QT QG F Q  D G +  G  ++ RP +  F+Y  P   
Sbjct: 17  ALPAAAEKLSLGAISGYLNGLQTAQGAFTQINDDGTISTGRIYIKRPGRVRFEYDPPDQT 76

Query: 85  SLISDGSNIAVYNAKLDTW-SVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSFITIFF 142
            +++DG  + + + K +T    YPL      +I + N  + +E  +    S+ +  TI  
Sbjct: 77  LVVADGDTVGIVDPKSNTGPEAYPLHRTPLKIILARNVDLTRERMVTGHASDGTSTTIRA 136

Query: 143 KDDFMG--NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
           +D        I + F      L  W I DS    + + +   +    L    F IP
Sbjct: 137 QDPDNPEYGSIDLVFTADPIELRQWVINDSGGGRTTVVLGDLRTGMQLANDRFVIP 192


>gi|220922844|ref|YP_002498146.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           nodulans ORS 2060]
 gi|219947451|gb|ACL57843.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           nodulans ORS 2060]
          Length = 332

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 83/172 (48%), Gaps = 5/172 (2%)

Query: 36  VKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           +++A  +F  + T+ G F+Q  A G  + G+ ++A+P +  F Y  PS + +++DG+++A
Sbjct: 148 IERANAYFNGVSTLTGNFVQIGADGRKIGGKLYLAKPGRLRFDYDQPSPLEVVADGTSVA 207

Query: 95  VYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKD-DFMGNM-- 150
           V + KL T  +Y +       +  +   + ++ ++  V ++   + I  +D   +G    
Sbjct: 208 VRDRKLATQDLYFISQTPLKFLLRDRIDLARDLTVTDVSADPGGVRISLEDRSTLGGTSR 267

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
           I + FD     L  W+I D     + + +   +    +D  +F I Y +  +
Sbjct: 268 IVLLFDEAMKSLSQWRITDPQGYQTTVLLSNLQRGRPIDGMMFVINYGRAED 319


>gi|126733903|ref|ZP_01749650.1| Putative outer membrane lipoprotein carrier protein [Roseobacter
           sp. CCS2]
 gi|126716769|gb|EBA13633.1| Putative outer membrane lipoprotein carrier protein [Roseobacter
           sp. CCS2]
          Length = 201

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 79/167 (47%), Gaps = 12/167 (7%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEF 66
           S+I  V L  Y       A+    +  S+ +   +   +QT QG F Q +A G +  G+ 
Sbjct: 7   SIIAAVALTLY-------ASAASAQQLSLGQISAYLNQLQTAQGGFTQINADGTLSTGQI 59

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW-SVYPLRYMAFSVIFSNNQHVIQ 125
           ++ RP +  F+Y++PS   +++ G  +A+++A+ +T    YPL     S+I   N ++ +
Sbjct: 60  YIKRPGRIRFEYNAPSDSLVLASGGQLAIFDARSNTGPERYPLNQTPLSIILQENVNLER 119

Query: 126 ES-IQRVESNNSFITIFFKDDFMGN--MISVTFDRLSYRLLNWKIMD 169
           E  +  V S+ +  T+  +D    N   I + F      L  W + D
Sbjct: 120 EDMVTNVVSDGTTTTVTAQDPDNPNYGSIQMVFTANPVELRQWIVTD 166


>gi|296448304|ref|ZP_06890196.1| outer membrane lipoprotein carrier protein LolA [Methylosinus
           trichosporium OB3b]
 gi|296254181|gb|EFH01316.1| outer membrane lipoprotein carrier protein LolA [Methylosinus
           trichosporium OB3b]
          Length = 314

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 86/177 (48%), Gaps = 9/177 (5%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLI 87
           P+ + +++K+A     +   M   F+Q    G   +G  F+ +  +  F+Y+ P+++ ++
Sbjct: 140 PLDRAEAIKRAEASLNASPVMTADFVQIGGDGRRAEGRLFIHKVGRMRFEYAQPATMEVV 199

Query: 88  SDGSNIAVYNAKLDTWSVY-----PLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFF 142
           SDG  +AV + KL+T  +Y     PL+++    I       + + +  ++   + I I  
Sbjct: 200 SDGVTVAVRDRKLNTQDLYFIAQTPLKFLLNEKIDLEKDVKLLDVV--IDDAGAAIIIED 257

Query: 143 KDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           K    G + I + FD  ++ L  W++ D     +++ +     ++  DPK+F++  D
Sbjct: 258 KATLGGTSKIKLLFDAKTFDLKQWQVTDPQGYETLVSLFNIDRDSAPDPKLFKVARD 314


>gi|39933357|ref|NP_945633.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris CGA009]
 gi|39652982|emb|CAE25724.1| unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 313

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 77/158 (48%), Gaps = 5/158 (3%)

Query: 45  SIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW 103
           S+QT+ G F+Q    G  + G+F++ +P +  F+Y  PS +S+I+DG ++ V + KL T 
Sbjct: 148 SLQTLVGQFVQVGPDGSKLTGDFYIMKPGRVRFEYDDPSPISMIADGQSVVVRDRKLATQ 207

Query: 104 SVYPLRYMAFS-VIFSNNQHVIQESIQRVESNN--SFITIFFKDDFMG-NMISVTFDRLS 159
            VYPL       ++      +   ++  + S++  S I I  K+  +G + + + F    
Sbjct: 208 DVYPLSQTPLRYLLSDRLDLLRDTNVVSITSDDLYSNIIIEEKNAVIGTSRLLLMFGTKD 267

Query: 160 YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
            +L  W + D     + + +         DP +F+I Y
Sbjct: 268 GQLKQWTVTDPQGYDTTVAVYNLDTTRRPDPSMFKIDY 305


>gi|192288714|ref|YP_001989319.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris TIE-1]
 gi|192282463|gb|ACE98843.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris TIE-1]
          Length = 313

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 77/158 (48%), Gaps = 5/158 (3%)

Query: 45  SIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW 103
           S+QT+ G F+Q    G  + G+F++ +P +  F+Y  PS +S+I+DG ++ V + KL T 
Sbjct: 148 SLQTLVGQFVQVGPDGSKLTGDFYIMKPGRVRFEYDDPSPISMIADGQSVVVRDRKLATQ 207

Query: 104 SVYPLRYMAFS-VIFSNNQHVIQESIQRVESNN--SFITIFFKDDFMG-NMISVTFDRLS 159
            VYPL       ++      +   ++  + S++  S I I  K+  +G + + + F    
Sbjct: 208 DVYPLSQTPLRYLLSDRLDLLRDTNVVSITSDDLYSNIIIEEKNAVIGTSRLLLMFGTKD 267

Query: 160 YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
            +L  W + D     + + +         DP +F+I Y
Sbjct: 268 GQLKQWTVTDPQGYDTTVAVYNLDTTRRPDPSMFKIDY 305


>gi|163796427|ref|ZP_02190387.1| Outer membrane lipoprotein-sorting protein [alpha proteobacterium
           BAL199]
 gi|159178277|gb|EDP62821.1| Outer membrane lipoprotein-sorting protein [alpha proteobacterium
           BAL199]
          Length = 211

 Score = 57.8 bits (138), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 98/216 (45%), Gaps = 19/216 (8%)

Query: 1   MAFLLYKSVIGVVI---LFFYSAIFPFNAAYPITKDQSVKKAIE-HFLSIQTMQGTFLQE 56
           M   L  +++GV++   L+  SA     AA    +D++    +E +F  I +M+  FLQ 
Sbjct: 1   MRRTLTSALMGVLVVAGLWTGSA----TAASLSAEDKADLARVEAYFNGITSMRSNFLQA 56

Query: 57  DA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSV 115
            + G V KG  ++ RP +  F+Y  PS + + SDG  +   + +L   +  PL     SV
Sbjct: 57  SSTGLVAKGRVWLRRPGRMRFEYDPPSPILITSDGILVTYQDLELKQTNQIPLFTSPLSV 116

Query: 116 IFSNN----QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS 171
           +   N    + +I + ++R ESN   + I  + +     +++ F      L  W I+D+ 
Sbjct: 117 LVEENVTFGEELIVDEVKR-ESNVLRVRIRLRKEPDQGYVTLVFQDRPMSLKQWTIVDAQ 175

Query: 172 RRYSIIKILKYK-----ENTVLDPKVFEIPYDKIHN 202
           +    + +L  +      N +  PK    P D++  
Sbjct: 176 QVSVKVALLDPEFGVTIPNELFRPKDLGRPGDEVGR 211


>gi|159042614|ref|YP_001531408.1| outer membrane lipoprotein carrier protein [Dinoroseobacter shibae
           DFL 12]
 gi|157910374|gb|ABV91807.1| outer membrane lipoprotein carrier protein [Dinoroseobacter shibae
           DFL 12]
          Length = 234

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 70/159 (44%), Gaps = 5/159 (3%)

Query: 45  SIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD-T 102
            +  +Q  F Q +A G    G  ++ RP +  F+Y  P+ V ++  G  +A+++AK D T
Sbjct: 70  GLDLVQARFTQRNADGSTSTGTLYLRRPGRARFEYDPPAEVLVMVGGGTVAIFDAKGDPT 129

Query: 103 WSVYPLRYMAFSVIFSNNQHV-IQESIQRVESNNSFITIFFKDDFMG--NMISVTFDRLS 159
              YPLR    +VI S    +   ++I   + +    T+   D        I++ F    
Sbjct: 130 PESYPLRRTPLNVILSREVDLEGSDAIFGHQLDGDLTTVLAHDPAHPEYGRIALQFAADP 189

Query: 160 YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
            RL  W I+  +   ++I++        L   +F IP +
Sbjct: 190 VRLARWVIVGETGEQTVIELGPLTRPAQLSSNLFNIPGE 228


>gi|144897973|emb|CAM74837.1| Outer-membrane lipoprotein carrier protein [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 215

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 74/164 (45%), Gaps = 5/164 (3%)

Query: 36  VKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           V +A  +   I T++  F Q    G V +G  +  RP +   +Y  PS + +++DG  + 
Sbjct: 38  VVRAEAYMNGITTLKARFQQFAPNGNVSEGTAYFWRPGRMRLQYDPPSPILVVADGDFLI 97

Query: 95  VYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE--SIQRVESNNSF--ITIFFKDDFMGNM 150
           V++ +L   S  PL      V+   N  +  +  ++ RV        I++   DD     
Sbjct: 98  VHDQELGEPSYIPLGSTPAGVLVRENVQLNGKDLAVSRVTRAPGVLNISVVESDDPAQGE 157

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
           I++ F    + L  W+++D+    + + + + +    LD K+F+
Sbjct: 158 ITLVFTEQPFALRQWRVLDAQGSITTVSLYETQSGMTLDRKLFQ 201


>gi|83952503|ref|ZP_00961234.1| Putative outer membrane lipoprotein carrier protein [Roseovarius
           nubinhibens ISM]
 gi|83836176|gb|EAP75474.1| Putative outer membrane lipoprotein carrier protein [Roseovarius
           nubinhibens ISM]
          Length = 206

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 73/182 (40%), Gaps = 11/182 (6%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVK-KAIEHFL-SIQTMQGTFLQ-EDAGYVMKGEFFMAR 70
           IL   +A     A  P T  + +    I  +L  I T  G F Q  D G V KG   + R
Sbjct: 7   ILATGAACVALAAPIPATAAEKLSLGEISRYLNGITTASGDFTQINDDGTVSKGRVIIKR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKL-DTWSVYPLRYMAFSVIFSNNQHVIQESIQ 129
           P +  F+Y+ P    ++SDGS + V + K  +    +PL     S+I + N  + +  + 
Sbjct: 67  PGRVRFEYAPPDRTLVVSDGSTVGVIDGKSNEPPQGFPLNRTPLSIILARNVDLTRARMV 126

Query: 130 RVESNNSFITIFFKDDFM----GNMISVTFDRLSYRLLNWKI--MDSSRRYSIIKILKYK 183
                +   TI    D      GN I + F      L  W I   D +R   ++  L+  
Sbjct: 127 TGHRVDGAKTIVQAQDPAHPEYGN-IELVFTGSPVELRQWIINDGDGARTTVVLGGLRKG 185

Query: 184 EN 185
            N
Sbjct: 186 GN 187


>gi|110677451|ref|YP_680458.1| outer membrane lipoprotein carrier protein, putative [Roseobacter
           denitrificans OCh 114]
 gi|109453567|gb|ABG29772.1| outer membrane lipoprotein carrier protein, putative [Roseobacter
           denitrificans OCh 114]
          Length = 186

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 62/132 (46%), Gaps = 5/132 (3%)

Query: 45  SIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW 103
           S++T++GTF Q  D G V  G+ ++ RP +  F+Y  P    +I+  S + + + K +  
Sbjct: 23  SLETLKGTFRQINDDGSVSTGQLYIRRPGRMRFEYDPPEQALVIAAASAVVIIDRKSNQP 82

Query: 104 S-VYPLRYMAFSVIFSNNQHVIQESI---QRVESNNSFITIFFKDDFMGNMISVTFDRLS 159
           S  YPL     S++   +  + + ++    R +   + +T    D+     + + F    
Sbjct: 83  SETYPLSRTPLSLLLGRDIDLTRAAMVRNARFDGTATIVTAEDPDNLENGFLEMYFTDQP 142

Query: 160 YRLLNWKIMDSS 171
            RL  W I D+S
Sbjct: 143 TRLEQWVIHDAS 154


>gi|197106968|ref|YP_002132345.1| outer membrane lipoprotein carrier protein LolA [Phenylobacterium
           zucineum HLK1]
 gi|196480388|gb|ACG79916.1| outer membrane lipoprotein carrier protein LolA [Phenylobacterium
           zucineum HLK1]
          Length = 215

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 81/173 (46%), Gaps = 4/173 (2%)

Query: 36  VKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           V++A  +  S++  +  F+Q D+ G  + G+ F+ RP K  F Y  PS + ++SDG  ++
Sbjct: 39  VERAAAYLESLKEAKARFVQTDSRGRSIGGDVFLKRPGKARFDYDPPSGLLVVSDGGVVS 98

Query: 95  VYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKDD--FMGNMI 151
           V + +L T+  YPL     SV  + N  + +  ++ RV       +I  +D        I
Sbjct: 99  VQDTRLKTFDRYPLSATPLSVFLAKNIRLDKGVTVTRVSRMADGFSITARDGNKRTAGQI 158

Query: 152 SVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
            +TF      L  W I D+  R + +++   +  + L   +F +   +  N+ 
Sbjct: 159 MLTFRDEPMTLTGWTITDAQGRQTRVQLQGLQRASGLAGSLFVLKDPRPKNVG 211


>gi|83855249|ref|ZP_00948779.1| outer membrane lipoprotein carrier protein LolA, putative
           [Sulfitobacter sp. NAS-14.1]
 gi|83843092|gb|EAP82259.1| outer membrane lipoprotein carrier protein LolA, putative
           [Sulfitobacter sp. NAS-14.1]
          Length = 201

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 80/177 (45%), Gaps = 8/177 (4%)

Query: 26  AAYPITKDQSVKKAIEHFLS-IQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSS 83
           A  P   D+    AI  +L+ ++T +G F Q  D G +  G  ++ RP K  F+Y++P S
Sbjct: 18  AVMPAAADKLPLNAISGYLNDLKTAKGEFTQINDDGSISTGTIYIKRPGKVRFEYNAPDS 77

Query: 84  VSLISDGSNIAVYNAKLDTWS-VYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFF 142
             +++  + + +Y+ K +  +  YPL     S+I + N ++ Q  +    + +   T   
Sbjct: 78  GIVVAGSNTVVIYDKKSNQPAETYPLSKTPLSIILAANVNLGQAKMVTGHNYDGTATTVR 137

Query: 143 KDDFM----GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
             D      GN I + F      L  W I D +   + + +   ++   L  K+F++
Sbjct: 138 AQDPAHPEYGN-IELKFTGNPVELRQWIINDGNGTKTTVVLGDLQKGGSLPNKLFDV 193


>gi|83941771|ref|ZP_00954233.1| outer membrane lipoprotein carrier protein LolA, putative
           [Sulfitobacter sp. EE-36]
 gi|83847591|gb|EAP85466.1| outer membrane lipoprotein carrier protein LolA, putative
           [Sulfitobacter sp. EE-36]
          Length = 200

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 80/177 (45%), Gaps = 8/177 (4%)

Query: 26  AAYPITKDQSVKKAIEHFLS-IQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSS 83
           A  P   D+    AI  +L+ ++T +G F Q  D G +  G  ++ RP K  F+Y++P S
Sbjct: 17  AVMPAAADKLPLNAISGYLNDLKTAKGEFTQINDDGSISTGTIYIKRPGKVRFEYNAPDS 76

Query: 84  VSLISDGSNIAVYNAKLDTWS-VYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFF 142
             +++  + + +Y+ K +  +  YPL     S+I + N ++ Q  +    + +   T   
Sbjct: 77  GIVVAGSNTVVIYDKKSNQPAETYPLSKTPLSIILAANVNLGQAKMVTGHNYDGTATTVR 136

Query: 143 KDDFM----GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
             D      GN I + F      L  W I D +   + + +   ++   L  K+F++
Sbjct: 137 AQDPAHPEYGN-IELKFTGNPVELRQWIINDGNGTKTTVVLGDLQKGGSLPNKLFDV 192


>gi|149204851|ref|ZP_01881813.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseovarius sp. TM1035]
 gi|149141721|gb|EDM29776.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseovarius sp. TM1035]
          Length = 201

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 65/157 (41%), Gaps = 5/157 (3%)

Query: 45  SIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW 103
            ++T QG F Q  + G +  G   + RP +  F+Y  P    +++DG  + + + + +  
Sbjct: 36  GLRTAQGAFTQINEDGTISTGRILIKRPGRVRFEYDPPEQALVVADGDTVGIIDPRSNDG 95

Query: 104 SV-YPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG---NMISVTFDRLS 159
            V YPL      +I + N  + +E +    +++   T     D        I + F    
Sbjct: 96  PVGYPLHRTPLKIILARNVDLTRERMVVGHASDGTSTTVRAQDPANPEYGSIDLVFTGSP 155

Query: 160 YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
             L  W I D S   + + +   + +  L+ + F IP
Sbjct: 156 VELRQWVIHDGSGSQTTVVLGDMQRDVRLNDESFVIP 192


>gi|163734297|ref|ZP_02141737.1| outer membrane lipoprotein carrier protein, putative [Roseobacter
           litoralis Och 149]
 gi|161392305|gb|EDQ16634.1| outer membrane lipoprotein carrier protein, putative [Roseobacter
           litoralis Och 149]
          Length = 200

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 87/193 (45%), Gaps = 12/193 (6%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEF 66
           S+I  ++L    ++ P  AA    +   + +   +  S++T++G F Q  D G V  G+ 
Sbjct: 2   SLISRILLVACLSLVP--AASGAAEQLKLAEISAYLNSLETLKGDFRQINDDGSVSTGQL 59

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS-VYPLRYMAFSVIFSNNQHVIQ 125
           +M RP +  F+Y  P    +I+  S + + + K +  S  YPL     S++   +  + +
Sbjct: 60  YMRRPGRMRFEYDPPEQALVIAAASAVVIIDRKSNQPSETYPLSRTPLSLLLGRDIDLTR 119

Query: 126 ESI---QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
            ++    R +   + +T    D+     + + F     RL  W I D+S   + + + ++
Sbjct: 120 AAMVRNARFDGTWTIVTAEDPDNLENGYLEMYFTDQPTRLEQWVIHDASGGRTRVVLGEF 179

Query: 183 K-----ENTVLDP 190
           +      N++ DP
Sbjct: 180 ETGINLPNSLFDP 192


>gi|254487598|ref|ZP_05100803.1| outer membrane lipoprotein carrier protein LolA [Roseobacter sp.
           GAI101]
 gi|214044467|gb|EEB85105.1| outer membrane lipoprotein carrier protein LolA [Roseobacter sp.
           GAI101]
          Length = 201

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 79/174 (45%), Gaps = 8/174 (4%)

Query: 29  PITKDQSVKKAIEHFL-SIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSL 86
           P T +Q    AI  +L +++T +G F Q  D G +  G  ++ RP K  F+Y++P S  +
Sbjct: 20  PATAEQLSLGAISKYLNAMKTAKGDFTQINDDGSISTGTIYIKRPGKVRFEYNAPDSGIV 79

Query: 87  ISDGSNIAVYNAKLDTWS-VYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD 145
           I+  + + +Y+ K +  +  YPL     S+I + N ++ Q  +    S +   T     D
Sbjct: 80  IAGSNTVVIYDKKSNQPAETYPLSKTPLSIILAANVNLGQARMVTGHSYDGTATTVRAQD 139

Query: 146 FM----GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
                 GN I + F      L  W I + +   + + +   ++   L   +F++
Sbjct: 140 PQHPEYGN-IELKFTDNPIELRQWIINNGNGDQTTVVLGDMQKGVSLPNSLFDV 192


>gi|85704070|ref|ZP_01035173.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseovarius sp. 217]
 gi|85671390|gb|EAQ26248.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseovarius sp. 217]
          Length = 201

 Score = 52.0 bits (123), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 65/157 (41%), Gaps = 5/157 (3%)

Query: 45  SIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL-DT 102
            ++T QG F Q  + G +  G   + RP +  F+Y  P    +++DG  + + + +  D 
Sbjct: 36  GLKTAQGAFTQINEDGTISTGRILIKRPGRVRFEYDPPEEALVVADGDTVGIIDPRSNDG 95

Query: 103 WSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSFITIFFKDDFMG--NMISVTFDRLS 159
              YPL      +I + N  + +E  +    S+ +  T+  +D        I + F    
Sbjct: 96  PQGYPLNRTPLKIILARNVDLTRERMVVGYGSDGTSTTVRAQDPANPEYGSIDLVFTGNP 155

Query: 160 YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
             L  W I D S   + + +   + +  L+   F IP
Sbjct: 156 VELRQWVIHDGSGSQTTVVLGDMQRDVRLNDDSFVIP 192


>gi|255263615|ref|ZP_05342957.1| outer membrane lipoprotein carrier protein LolA [Thalassiobium sp.
           R2A62]
 gi|255105950|gb|EET48624.1| outer membrane lipoprotein carrier protein LolA [Thalassiobium sp.
           R2A62]
          Length = 199

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 80/181 (44%), Gaps = 19/181 (10%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYV 61
           FL+  +V G+V        FP  A     ++ S+     +   IQT    F Q +A G +
Sbjct: 6   FLMGTAVAGLVG-------FPAAA-----QELSLGDMSRYLNDIQTATAEFTQINADGTI 53

Query: 62  MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW-SVYPLRYMAFSVIFSNN 120
             G+ ++ RP +  F+Y+ P    ++++G  +A+++ + +     +PL     S+I + N
Sbjct: 54  STGQLYIKRPGRIRFEYNPPEQSLVLANGGQVAIFDPRSNNGPERFPLSQTPLSIILARN 113

Query: 121 QHVIQESIQRVESNNSFITIFFKDDF----MGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
             + +  +    +++   T     D     MGN I + F      L  W + D++ + + 
Sbjct: 114 VDLARSGMVSGRTSDGTTTTIRAQDPDRPDMGN-IQLVFTGNPVELRQWVVTDNAGQQTT 172

Query: 177 I 177
           I
Sbjct: 173 I 173


>gi|121998176|ref|YP_001002963.1| outer membrane lipoprotein carrier protein LolA [Halorhodospira
           halophila SL1]
 gi|189028553|sp|A1WWU9|LOLA_HALHL RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|121589581|gb|ABM62161.1| outer membrane lipoprotein carrier protein LolA [Halorhodospira
           halophila SL1]
          Length = 208

 Score = 51.2 bits (121), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 51/85 (60%), Gaps = 7/85 (8%)

Query: 38  KAIE-HFLSIQTMQGTFLQ---EDAGYVMK---GEFFMARPSKFYFKYSSPSSVSLISDG 90
           +A+E ++  ++T+QG F Q   +D G V++   G+F + RP +F++ Y+ P S  +I+DG
Sbjct: 25  QALEDYYRDVETVQGVFNQFTLDDRGQVIEESSGDFAIHRPDRFHWSYAGPFSQEIIADG 84

Query: 91  SNIAVYNAKLDTWSVYPLRYMAFSV 115
             + VY+ +LD  +V   R +  S 
Sbjct: 85  ERLWVYDVELDQVTVRDQRAVLGSA 109


>gi|114320864|ref|YP_742547.1| outer membrane lipoprotein carrier protein LolA [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|122941173|sp|Q0A7Y0|LOLA_ALHEH RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|114227258|gb|ABI57057.1| outer membrane lipoprotein carrier protein LolA [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 214

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 50/88 (56%), Gaps = 8/88 (9%)

Query: 29  PITKDQSVKKA--IEHFLSIQTMQGTFLQE---DAGYVMK---GEFFMARPSKFYFKYSS 80
           P+  +Q+  +A    ++  + ++QG F Q+   ++G +++   GEF++ RP +F + Y+ 
Sbjct: 21  PVLAEQAATRADLARYYDDVTSLQGRFTQQTHDESGRILEESSGEFWIERPDRFRWNYAE 80

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVYPL 108
           P    ++SDG  + VY+  LD  +V  L
Sbjct: 81  PWPQEIVSDGERLWVYDQDLDQVTVRSL 108


>gi|83595027|ref|YP_428779.1| outer membrane lipoprotein carrier protein LolA [Rhodospirillum
           rubrum ATCC 11170]
 gi|83577941|gb|ABC24492.1| Outer membrane lipoprotein carrier protein LolA [Rhodospirillum
           rubrum ATCC 11170]
          Length = 221

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 76/171 (44%), Gaps = 7/171 (4%)

Query: 30  ITKDQSVKKA-IEHFL-SIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSL 86
           +T+DQ    A +E +L  ++ +Q  FLQ    G   +G   ++RP++   +Y  P+ + +
Sbjct: 37  LTQDQRAFVARVEGYLNGVRRVQARFLQVSSTGNYAEGTVSISRPNRMRLQYDPPADLLM 96

Query: 87  ISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQ----RVESNNSFITIFF 142
           +++GS +  Y+ +LD  S   L      V+  +   +   +I     R       I +  
Sbjct: 97  VANGSQLVYYDRELDQVSYIGLDSTPLGVLLRDKIELSDPNITVTAYREAKGVVEIALVQ 156

Query: 143 KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
            +D     +++ F      L  W+++D+      + +   +    LDPK+F
Sbjct: 157 TNDPGQGTLTLVFTTDPLELRQWRVLDAQNVEVSVSLFNPQVGLALDPKLF 207


>gi|114327250|ref|YP_744407.1| outer-membrane lipoproteins carrier protein [Granulibacter
           bethesdensis CGDNIH1]
 gi|114315424|gb|ABI61484.1| outer-membrane lipoproteins carrier protein [Granulibacter
           bethesdensis CGDNIH1]
          Length = 231

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/194 (18%), Positives = 83/194 (42%), Gaps = 11/194 (5%)

Query: 7   KSVIGVVILFFYSAIF-PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKG 64
           + ++G ++     A+  P  A    + D  + +   +   I T++  F Q    G V +G
Sbjct: 33  RQILGGILASLAGAVVVPARAEE--SDDALLARIAAYLNGIHTLRARFRQTAPDGQVTQG 90

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFS-----N 119
             ++ RP    F+Y  P+ + L++    +   + ++   S  PL     S++ S     N
Sbjct: 91  TVWLERPGHIRFQYDPPTPLLLVATNGEVIFQDFQVHQVSRIPLDRTPLSILLSDHIDFN 150

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
               ++E I R       +++  + D    ++++ F     +L+ W ++D   + + +++
Sbjct: 151 GAAAVRE-ISRTPGVIQ-LSVVRRTDPGAGLLAIVFSADPLKLIQWTVVDPQHKITRVEL 208

Query: 180 LKYKENTVLDPKVF 193
              +    +DP +F
Sbjct: 209 SNIQTGIPVDPTLF 222


>gi|296282149|ref|ZP_06860147.1| outer membrane lipoprotein-sorting protein [Citromicrobium
           bathyomarinum JL354]
          Length = 222

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/157 (19%), Positives = 73/157 (46%), Gaps = 8/157 (5%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           S+  A+     I TM+ +F Q D +G  ++G   + RP K  F+YS    + ++S+G ++
Sbjct: 43  SLDDAVAALRGISTMRASFTQTDRSGQTVRGTMTLKRPGKIRFEYSKDVPLLIVSNGKSL 102

Query: 94  AVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG--NMI 151
            + + +++    +P+       +   N+ V +    R   N + +++  +D       +I
Sbjct: 103 TMVDYEVNQVQRWPISNSPLGALLDPNRDVKKYGKLRNTGNPNVLSVEVRDPKKPEYGVI 162

Query: 152 SVTFDRLS-----YRLLNWKIMDSSRRYSIIKILKYK 183
           ++ F R +     + L NW  +D+    + +++   +
Sbjct: 163 TLIFVRKAGAPGGWELTNWVSLDAQNNRTTVRLANQR 199


>gi|254460832|ref|ZP_05074248.1| outer membrane lipoprotein carrier protein LolA [Rhodobacterales
           bacterium HTCC2083]
 gi|206677421|gb|EDZ41908.1| outer membrane lipoprotein carrier protein LolA [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 201

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 47/95 (49%), Gaps = 3/95 (3%)

Query: 29  PITKDQSVKKAIEHFLS-IQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSL 86
           P+  ++    A+  +L+ + T +G F Q  D G +  G  F+ RP +  F+Y+ P    +
Sbjct: 19  PVAAEKISLNALSRYLNQLSTAKGAFTQVNDDGTISTGTIFIKRPGRIRFEYNPPEKALV 78

Query: 87  ISDGSNIAVYNAKL-DTWSVYPLRYMAFSVIFSNN 120
           ++ G  + +Y+ K  +    YPL     S+I + N
Sbjct: 79  LASGGTVVIYDPKTNEPPESYPLARTPLSIILAKN 113


>gi|260432333|ref|ZP_05786304.1| outer membrane lipoprotein carrier protein LolA [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260416161|gb|EEX09420.1| outer membrane lipoprotein carrier protein LolA [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 198

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 73/160 (45%), Gaps = 6/160 (3%)

Query: 40  IEHFL-SIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
           I ++L  ++T+Q TF Q  D G +  G+ ++ RP K  F+Y  P+S  ++++   + V++
Sbjct: 28  ISNYLNGLKTVQTTFTQINDDGSLSTGKLWLQRPGKMRFEYDPPNSAVVLANAGTVMVFD 87

Query: 98  AKLD-TWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG---NMISV 153
            K +     YPL+    S++ + N ++ Q  +    + +   T+    D        I +
Sbjct: 88  PKSNQPPEQYPLKRTPLSLVLARNVNLSQADMVVGHTFDGTATVVTAQDPKNPDSGRIEL 147

Query: 154 TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
            F      L  W I D++   + + +     N  +D  +F
Sbjct: 148 MFTSDPIELRKWVIYDNTGGQTTVLLGSLDGNVRVDSDLF 187


>gi|149184982|ref|ZP_01863299.1| outer membrane lipoprotein-sorting protein [Erythrobacter sp.
           SD-21]
 gi|148831093|gb|EDL49527.1| outer membrane lipoprotein-sorting protein [Erythrobacter sp.
           SD-21]
          Length = 220

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 79/171 (46%), Gaps = 13/171 (7%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFY 75
           FY+A  P  AA   T D  + +A+E    I TM+  F+Q D  G  + G   + RP K  
Sbjct: 28  FYAAPAPVEAA---TGD--LDQAVEALRGISTMRANFVQTDRNGQAVSGVMTLKRPGKIR 82

Query: 76  FKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNN 135
           F+Y     + ++S+G ++ + + +++    +P++      +   ++ V +       S++
Sbjct: 83  FEYEKGVPLLVVSNGKSMYMIDYEVNQVQRWPIKNSPLGALVDPSRDVKKYGRLVPTSHS 142

Query: 136 SFITIFFKDDFMG--NMISVTFDR-----LSYRLLNWKIMDSSRRYSIIKI 179
             ++I  +D       +I++ F R        RL +W  +DS    + +++
Sbjct: 143 DVVSIEVRDPKRPEFGVITLIFARDASAPGGLRLTHWVALDSQNHRTTVRL 193


>gi|126724347|ref|ZP_01740190.1| Putative outer membrane lipoprotein carrier protein
           [Rhodobacterales bacterium HTCC2150]
 gi|126705511|gb|EBA04601.1| Putative outer membrane lipoprotein carrier protein
           [Rhodobacterales bacterium HTCC2150]
          Length = 202

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 72/153 (47%), Gaps = 13/153 (8%)

Query: 42  HFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL 100
           +F  ++  Q  F Q +A G +  G  ++ RP +  F+Y+ P    +I+ GS +A+++AK 
Sbjct: 35  YFNDLKRAQTEFTQINADGTISTGTLYLHRPGRIRFEYNPPEESLVIAGGSQVAIFDAKS 94

Query: 101 DT-WSVYPLRYMAFSVIFSNNQHVIQES--IQRVESNNSFITIFFKD----DFMGNMISV 153
           +T    +PL+    ++I   N ++      +   +  NS  T+  +D    D+    I +
Sbjct: 95  NTPPEQFPLKRTPLNIILERNVNLTNSKMVVGHQDGGNS-TTVIAQDPEHPDY--GSIEL 151

Query: 154 TFDRLSYRLLNWKIMD--SSRRYSIIKILKYKE 184
            F      L  W I D   S+   I+ +++ KE
Sbjct: 152 VFTADPVELRQWVINDGGGSQTTVILGLMERKE 184


>gi|326388589|ref|ZP_08210182.1| outer membrane lipoprotein carrier protein LolA [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326206840|gb|EGD57664.1| outer membrane lipoprotein carrier protein LolA [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 231

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 46/92 (50%), Gaps = 1/92 (1%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           +V +AI    +I TM+  F+Q DA G  + G   M RP K  F+Y     + ++SDG+ +
Sbjct: 52  AVDEAIAALRAITTMRADFVQTDANGGRLNGTLTMKRPGKIRFQYQPGVPLLIVSDGAAL 111

Query: 94  AVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQ 125
            + + ++     +P+R      +   N+ V +
Sbjct: 112 TMIDYEVRQVQRWPIRNSPLGALLDPNKDVAR 143


>gi|84500687|ref|ZP_00998936.1| outer membrane lipoprotein carrier protein LolA, putative
           [Oceanicola batsensis HTCC2597]
 gi|84391640|gb|EAQ03972.1| outer membrane lipoprotein carrier protein LolA, putative
           [Oceanicola batsensis HTCC2597]
          Length = 200

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 61/154 (39%), Gaps = 5/154 (3%)

Query: 45  SIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD-T 102
            I T Q  F Q    G V  G  ++ RP K  F+Y  P+   +I+D   + +++ K D T
Sbjct: 37  GITTAQAKFTQIAGDGTVSTGTLYLKRPGKMRFEYDPPNKSYVIADHGAVGIFDEKGDET 96

Query: 103 WSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG---NMISVTFDRLS 159
              YPLR    S+I   +  + + ++      +   TI    D        I + F    
Sbjct: 97  VEQYPLRRTPLSIILDRHVDLGRANMVTGHREDGPSTIVRAQDPKNPEYGFIELVFTGDP 156

Query: 160 YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
             L  W + D S   + + + + K    L   +F
Sbjct: 157 VELRQWVVHDDSGSATTVILGEMKTGIQLSQSLF 190


>gi|84517261|ref|ZP_01004616.1| putative outer membrane lipoprotein carrier protein [Loktanella
           vestfoldensis SKA53]
 gi|84508936|gb|EAQ05398.1| putative outer membrane lipoprotein carrier protein [Loktanella
           vestfoldensis SKA53]
          Length = 202

 Score = 48.5 bits (114), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           S+ +  ++   +QT QG F Q +  G +  G+ ++ RP +  F+Y+ P    +++ G  +
Sbjct: 27  SLPQISDYLNQLQTAQGGFTQVNGDGTLSTGQIYIKRPGRIRFEYNPPQESLVMAGGGQL 86

Query: 94  AVYNAKLDTW-SVYPLRYMAFSVIFSNN 120
           A+++ + +T    YPL     +VI   N
Sbjct: 87  AIFDPRSNTGPDRYPLSQTPLNVILQRN 114


>gi|254509851|ref|ZP_05121918.1| outer membrane lipoprotein carrier protein LolA [Rhodobacteraceae
           bacterium KLH11]
 gi|221533562|gb|EEE36550.1| outer membrane lipoprotein carrier protein LolA [Rhodobacteraceae
           bacterium KLH11]
          Length = 198

 Score = 48.1 bits (113), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 72/160 (45%), Gaps = 6/160 (3%)

Query: 40  IEHFLS-IQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
           I ++L+ ++T+Q TF Q  D G +  G+ ++ RP K  F+Y  P+   +++    + +++
Sbjct: 28  ISNYLNQMKTVQTTFTQVNDDGSLSTGKLWLQRPGKMRFEYDPPNDAVVLARAGTVQIFD 87

Query: 98  AKLD-TWSVYPLRYMAFSVIFSNNQHVIQESI---QRVESNNSFITIFFKDDFMGNMISV 153
            K +     YPL+    S++ + N ++ Q ++      +   + +T     +     I +
Sbjct: 88  PKSNQPPEQYPLKRTPLSLVLARNVNLGQANMVVGHDFDGTATVVTAQDPKNPENGRIEL 147

Query: 154 TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
            F      L  W I D++   + + +    E    D  VF
Sbjct: 148 MFTADPVELRKWVIHDNAGSQTTVLLGPLAEGGRFDSSVF 187


>gi|84687991|ref|ZP_01015855.1| Putative outer membrane lipoprotein carrier protein [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84664023|gb|EAQ10523.1| Putative outer membrane lipoprotein carrier protein
           [Rhodobacterales bacterium HTCC2654]
          Length = 195

 Score = 48.1 bits (113), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 70/157 (44%), Gaps = 7/157 (4%)

Query: 45  SIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW 103
            ++T Q  F Q +A G +  G  ++ RP +  F+Y+ P    +++    +A+++AK +T 
Sbjct: 31  GLKTAQAEFTQINADGTISTGTIYIKRPGRARFEYNPPEQTLVLASAGQLAIFDAKSNTG 90

Query: 104 -SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFM----GNMISVTFDRL 158
              YPL     ++I + N  + +  +    + +   T     D      GN I +TF   
Sbjct: 91  PEQYPLARTPLNLILAQNVDLGRNGMVVGHNYDGTATTVTAQDPEHPEYGN-IQLTFTGN 149

Query: 159 SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
              L  W I D + + + + + + ++   +  + F I
Sbjct: 150 PTELRQWVITDDAGQQTTVVLGELRKGGTISDRNFSI 186


>gi|153871550|ref|ZP_02000694.1| Outer membrane lipoprotein carrier protein LolA [Beggiatoa sp. PS]
 gi|152071984|gb|EDN69306.1| Outer membrane lipoprotein carrier protein LolA [Beggiatoa sp. PS]
          Length = 202

 Score = 47.8 bits (112), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 49/81 (60%), Gaps = 7/81 (8%)

Query: 35  SVKKAIEHFL-SIQTMQGTFLQE---DAGYVM---KGEFFMARPSKFYFKYSSPSSVSLI 87
           S  + +++FL  +QT++G F QE   + G ++   +G+ +M RP +F ++Y  P +  ++
Sbjct: 18  SANENLDNFLQGLQTLRGQFYQELYNEKGTLLERSQGKMYMQRPDQFRWEYEQPYNQLIV 77

Query: 88  SDGSNIAVYNAKLDTWSVYPL 108
           +DG NI +Y+  L+  ++  L
Sbjct: 78  ADGKNIFIYDIDLEQVTLRSL 98


>gi|114769831|ref|ZP_01447441.1| Putative outer membrane lipoprotein carrier protein [alpha
           proteobacterium HTCC2255]
 gi|114549536|gb|EAU52418.1| Putative outer membrane lipoprotein carrier protein [alpha
           proteobacterium HTCC2255]
          Length = 210

 Score = 47.8 bits (112), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 27/130 (20%), Positives = 63/130 (48%), Gaps = 4/130 (3%)

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW-SVYPLRYMAFSVIF 117
           G +  G+ ++ RP K   +Y +P++  +I+   N+A+++ K     +++PL+    +++ 
Sbjct: 62  GSIDAGKLYIRRPGKMRLEYEAPNNALVIAGAGNVAIFDDKTKNGPTIFPLKKTPLNLLL 121

Query: 118 SNNQHVIQESI--QRVESN-NSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
             + ++I+  +  +  E N N+FI +          I + F      L +W I + S + 
Sbjct: 122 KKDVNLIKNKMVSEHTEKNKNTFIVVQDPKRLSQGKIKMVFSNQPILLESWTITNQSNQK 181

Query: 175 SIIKILKYKE 184
           + I +   +E
Sbjct: 182 TKIMLNNLRE 191


>gi|87201201|ref|YP_498458.1| outer membrane lipoprotein carrier protein LolA [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87136882|gb|ABD27624.1| outer membrane lipoprotein carrier protein LolA [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 228

 Score = 47.8 bits (112), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/167 (18%), Positives = 75/167 (44%), Gaps = 8/167 (4%)

Query: 36  VKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           V +A+    S+ T++  F+Q D +G  + G   + RP K  F+Y     + ++ DG  + 
Sbjct: 51  VDRAVTALRSVSTLRANFVQTDRSGQSVSGVLTLKRPGKIRFQYQKGVPLLIVGDGKALT 110

Query: 95  VYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG--NMIS 152
           + + ++     +P+R      +   ++ V + + Q   ++   +++  +D        I+
Sbjct: 111 MIDYEVRQVQRWPIRNSPLGALLDPSKDVARFAKQLPTNDRDVVSLQVRDPKHPEYGTIT 170

Query: 153 VTFDR-----LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
           + F R        +L +W  +DS  + + +++  ++    +D K F 
Sbjct: 171 MIFVRNGAAPGGLQLDSWVALDSQNKRTTVRLSGHQYGVAVDDKTFR 217


>gi|71083032|ref|YP_265751.1| Outer membrane lipoprotein carrier protein [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|91762543|ref|ZP_01264508.1| Outer membrane lipoprotein carrier protein [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|71062145|gb|AAZ21148.1| Outer membrane lipoprotein carrier protein [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|91718345|gb|EAS84995.1| Outer membrane lipoprotein carrier protein [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 184

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 84/187 (44%), Gaps = 12/187 (6%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARP 71
           ++IL F+S   P N++    KD    K I        +   F Q        G+  +  P
Sbjct: 5   IIILLFFSFYLPGNSS---PKD----KIISQMKLTNNLNFNFKQTINDKSEDGKCIIEYP 57

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQ--ESIQ 129
            K +  Y++ +   L+S+GS++ +      ++  YPL       +  + +++I   E ++
Sbjct: 58  KKIFCVYNNANKKILVSNGSSLVIETNNKGSYYRYPLNKTPLEFLL-DKEYLISKIEKLE 116

Query: 130 RVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLD 189
             + +N ++   FK     N I++ FD+    L+ W+  D  +  SI  I   K+N  +D
Sbjct: 117 PRDIDNKYLN--FKIFENNNEINIFFDKKDLNLIGWQTKDIYQNLSITFISSIKKNQEID 174

Query: 190 PKVFEIP 196
             +F++P
Sbjct: 175 GNIFKLP 181


>gi|192358939|ref|YP_001983015.1| outer membrane lipoprotein carrier protein LolA [Cellvibrio
           japonicus Ueda107]
 gi|190685104|gb|ACE82782.1| outer membrane lipoprotein carrier protein LolA [Cellvibrio
           japonicus Ueda107]
          Length = 207

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQ--EDA-GYVMK---GEFFMARPSKFYFKYSSPSS 83
           +  DQ+  +  +H  ++ ++QG F Q   DA G + +   G+F + RP KFY+  + P  
Sbjct: 20  MADDQAATQLRKHLDAMNSLQGQFTQTVRDAQGEIQEQSHGDFMLMRPGKFYWNTAEPMP 79

Query: 84  VSLISDGSNIAVYNAKLDTWSV 105
             L+S+  NI +Y+  L+T +V
Sbjct: 80  QLLVSNNKNIWLYDPDLETVNV 101


>gi|163745445|ref|ZP_02152805.1| outer membrane lipoprotein carrier protein LolA [Oceanibulbus
           indolifex HEL-45]
 gi|161382263|gb|EDQ06672.1| outer membrane lipoprotein carrier protein LolA [Oceanibulbus
           indolifex HEL-45]
          Length = 201

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 64/138 (46%), Gaps = 7/138 (5%)

Query: 46  IQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS 104
           ++T +G F Q  D G +  G  ++ RP K  F+Y++P S  +++  + + +Y+ K +  +
Sbjct: 38  LKTAKGDFTQINDDGSISTGTIYIKRPGKVRFEYNAPDSGLVVAGANTVVIYDKKSNQPA 97

Query: 105 -VYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFM----GNMISVTFDRLS 159
             YPL     S+I ++N ++ +  +    S +   T     D      GN I + F    
Sbjct: 98  ETYPLARTPLSIILADNVNLGRAKMVTGHSYDGTATTVTAQDPANPQYGN-IQMKFTGNP 156

Query: 160 YRLLNWKIMDSSRRYSII 177
            +L  W I D +   + +
Sbjct: 157 VQLRQWVINDGNGSATTV 174


>gi|288962145|ref|YP_003452440.1| hypothetical protein AZL_d00700 [Azospirillum sp. B510]
 gi|288914411|dbj|BAI75896.1| hypothetical protein AZL_d00700 [Azospirillum sp. B510]
          Length = 222

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 76/168 (45%), Gaps = 7/168 (4%)

Query: 32  KDQSVKKAIEHFL-SIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISD 89
           +DQ+V   +E +L  I T+Q  FLQ    G    G F + RP +   +Y  P    +++D
Sbjct: 41  QDQAVVAKVEAYLNGITTLQSKFLQVAPNGRQATGTFSLWRPGRMRLEYDRPLKDFIVAD 100

Query: 90  GSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFF---KDD 145
           GS +  ++ ++   S  P+       I  ++  +  + ++  V  +   I +     KD 
Sbjct: 101 GSFVFYWDGEMRQQSSAPIGSTLADFILRSDIRLSGDVTVTEVFQSPGVIEVSLLETKDP 160

Query: 146 FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
             G +  V  DR  ++L  W+++D+    + + +L  + +   D  +F
Sbjct: 161 GKGTLTLVFEDR-PFQLRKWRVLDAQGLTTEVALLNPRTDVTFDRDMF 207


>gi|329114602|ref|ZP_08243361.1| Outer Membrane Lipoprotein Carrier Protein LolA [Acetobacter
           pomorum DM001]
 gi|326696082|gb|EGE47764.1| Outer Membrane Lipoprotein Carrier Protein LolA [Acetobacter
           pomorum DM001]
          Length = 231

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/171 (19%), Positives = 74/171 (43%), Gaps = 5/171 (2%)

Query: 33  DQSVKKAIEHFLS-IQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           D++  K IE  L+  +T Q    Q DA G    G  +M RP +    Y  PS + L+++G
Sbjct: 59  DKAWLKRIEQALNQSKTFQARIQQLDAEGKRTTGTVWMKRPGQMRLAYDPPSPLLLVANG 118

Query: 91  SNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITI-FFKDDFMG 148
             +   + +LD  +V P+      ++   +  +  + ++   + +N  + +   +    G
Sbjct: 119 GKVVFRDNQLDQTTVIPIERTPLGLLLRPHVSLTDDVTVTGFQHDNGLVQVTLVRTSSPG 178

Query: 149 NM-ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           +  +++ F      L +W ++D+  R + + +        +    F +P +
Sbjct: 179 DGSLTLVFYETPVALRSWSVLDAQGRETRVTLFDVHAGADIPASTFVLPAE 229


>gi|310817198|ref|YP_003965162.1| twin-arginine translocation pathway signal [Ketogulonicigenium
           vulgare Y25]
 gi|308755933|gb|ADO43862.1| twin-arginine translocation pathway signal [Ketogulonicigenium
           vulgare Y25]
          Length = 197

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/178 (19%), Positives = 72/178 (40%), Gaps = 6/178 (3%)

Query: 24  FNAAYPITKDQSVKKAIEHFL-SIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSP 81
              A P    Q     I  +L  + T +G F Q +A G    G  ++ RP +  F+Y  P
Sbjct: 12  LGGALPAFAQQVTLNDISAYLNGLTTAEGRFTQANADGSQSAGAIYIKRPGRMRFEYDPP 71

Query: 82  SSVSLISDGSNIAVYNAKLD-TWSVYPLRYMAFSVIFSNNQHVIQESIQR---VESNNSF 137
            +  +++ G  +A+++ + +     YPL     ++I   N  + + ++ R   V+ N + 
Sbjct: 72  DNGRMLASGGQLAIFDPRSNLPPDRYPLNQTPLNIILERNVDLGRRNMVRGMQVDGNRAI 131

Query: 138 ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
           +T           I + F      L  W ++D +   +   + + +    +   +F I
Sbjct: 132 VTAQDPSHPEYGAIELVFQISPMTLWQWTVIDQAGGRTTTTLSEIRIGGQISDSIFNI 189


>gi|258542799|ref|YP_003188232.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256633877|dbj|BAH99852.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256636936|dbj|BAI02905.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256639989|dbj|BAI05951.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256643045|dbj|BAI09000.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256646100|dbj|BAI12048.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256649153|dbj|BAI15094.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256652140|dbj|BAI18074.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256655197|dbj|BAI21124.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 231

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/171 (19%), Positives = 74/171 (43%), Gaps = 5/171 (2%)

Query: 33  DQSVKKAIEHFLS-IQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           D++  K IE  L+  +T Q    Q DA G    G  +M RP +    Y  PS + L+++G
Sbjct: 59  DKAWLKRIEQALNQSKTFQARIQQLDAEGKRTTGTVWMKRPGQMRLAYDPPSPLLLVANG 118

Query: 91  SNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITI-FFKDDFMG 148
             +   + +LD  +V P+      ++   +  +  + ++   + +N  + +   +    G
Sbjct: 119 GKVVFRDNQLDQTTVIPIERTPLGLLLRPHVSLTDDVTVTGFQHDNGLVQVTLVRTSSPG 178

Query: 149 N-MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           +  +++ F      L +W ++D+  R + + +        +    F +P +
Sbjct: 179 DGSLTLVFYETPVALRSWSVLDAQGRETRVTLFDVHAGADIPASTFVLPAE 229


>gi|209966057|ref|YP_002298972.1| outer membrane lipoprotein carrier protein LolA,putative
           [Rhodospirillum centenum SW]
 gi|209959523|gb|ACJ00160.1| outer membrane lipoprotein carrier protein LolA,putative
           [Rhodospirillum centenum SW]
          Length = 240

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 72/160 (45%), Gaps = 7/160 (4%)

Query: 40  IEHFL-SIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
           +E +L  I T++  FLQ  D G  +KG F +ARP +    Y  P    +++DG  +  ++
Sbjct: 70  VEAYLNGIGTLRSRFLQVADDGSSVKGTFALARPGRMRIDYDPPVGNFIVADGRFVYFWD 129

Query: 98  AKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFF---KDDFMGNMISV 153
           A+L   S  P+       +      +  + ++  V  +   + +     KD  +G + ++
Sbjct: 130 AELKQQSNAPIGSTLADFLLRPQISLSGDVTVTEVAHDGGVLEVTLAQTKDPALGRL-TL 188

Query: 154 TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
            F+   + L  W+++D+    + I +L  +    L  + F
Sbjct: 189 VFEERPFALRKWRVLDAQGLTTEISLLSPETGVELKDEQF 228


>gi|221640987|ref|YP_002527249.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides KD131]
 gi|221161768|gb|ACM02748.1| Outer membrane lipoprotein carrier protein LolA precursor
           [Rhodobacter sphaeroides KD131]
          Length = 200

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 45  SIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD-T 102
            + T +  F Q +A G V  G  F+ RP +  F+Y+ P    +++ G  +A+++AK +  
Sbjct: 36  GLSTAEADFTQVNADGSVSTGRIFIKRPGRVRFEYAPPEKSLVVAGGGQVAIFDAKSNQP 95

Query: 103 WSVYPLRYMAFSVIFSNN 120
              YPL     S+I + N
Sbjct: 96  PEQYPLSRTPLSLILAQN 113


>gi|254474341|ref|ZP_05087727.1| outer membrane lipoprotein carrier protein LolA [Ruegeria sp. R11]
 gi|214028584|gb|EEB69419.1| outer membrane lipoprotein carrier protein LolA [Ruegeria sp. R11]
          Length = 195

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 67/164 (40%), Gaps = 5/164 (3%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           S+ +  ++   I T Q  F Q  D G +  G+ +M RP K  F+Y +P+S  +I+    +
Sbjct: 24  SLNEVSQYLNGITTAQAPFSQINDDGSLSTGKLYMHRPGKMRFEYDAPNSGVVIAGAGAV 83

Query: 94  AVYNAKLD-TWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG---N 149
            + + K +     YPL+    S+I +    + Q ++      +   TI    D       
Sbjct: 84  VIQDPKSNQPPETYPLKRTPLSLILARTVKLGQANMVVGHDFDGTSTIVRAQDPKNPEYG 143

Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
            I + F      L  W I D S   + + +   +    L  ++F
Sbjct: 144 SIEMMFTDSPVELRKWVIHDGSGGKTTVILGGLETGVTLSSRLF 187


>gi|332559961|ref|ZP_08414283.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides WS8N]
 gi|332277673|gb|EGJ22988.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides WS8N]
          Length = 197

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 45  SIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD-T 102
            + T +  F Q +A G V  G  F+ RP +  F+Y+ P    +++ G  +A+++AK +  
Sbjct: 33  GLSTAEADFTQVNADGSVSTGRIFIKRPGRVRFEYAPPEKSLVVAGGGQVAIFDAKSNQP 92

Query: 103 WSVYPLRYMAFSVIFSNN 120
              YPL     S+I + N
Sbjct: 93  PEQYPLSRTPLSLILAQN 110


>gi|77462034|ref|YP_351538.1| putative outer membrane lipoprotein carrier protein [Rhodobacter
           sphaeroides 2.4.1]
 gi|126460924|ref|YP_001042038.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides ATCC 17029]
 gi|77386452|gb|ABA77637.1| Putative outer membrane lipoprotein carrier protein [Rhodobacter
           sphaeroides 2.4.1]
 gi|126102588|gb|ABN75266.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 212

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 39  AIEHFL-SIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY 96
           A+  +L  + T +  F Q +A G V  G  F+ RP +  F+Y+ P    +++ G  +A++
Sbjct: 41  ALSSYLNGLSTAEADFTQVNADGSVSTGRIFIKRPGRVRFEYAPPEKSLVVAGGGQVAIF 100

Query: 97  NAKLD-TWSVYPLRYMAFSVIFSNN 120
           +AK +     YPL     S+I + N
Sbjct: 101 DAKSNQPPEQYPLSRTPLSLILAQN 125


>gi|114767089|ref|ZP_01445972.1| outer membrane lipoprotein carrier protein LolA, putative
           [Pelagibaca bermudensis HTCC2601]
 gi|114540742|gb|EAU43808.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseovarius sp. HTCC2601]
          Length = 193

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 72/175 (41%), Gaps = 7/175 (4%)

Query: 27  AYPITKDQSVKKAIEHFL-SIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSV 84
           A P    Q     + ++L SIQ+ +  F Q ++ G +  G+  + RP K  F+Y+ P   
Sbjct: 16  ALPAAAQQLSLNTLSNYLNSIQSAESPFTQINSDGSISTGKILIKRPGKVRFEYNPPEQA 75

Query: 85  SLISDGSNIAVYNAKLDTW-SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFK 143
            +++    + V++ K+      YPL     S+I   N ++ Q  +      +   TI   
Sbjct: 76  LVLAWSGAVYVFDRKVGGQPETYPLNQTPLSIILDRNVNLAQAGMVTGHQYDGTATIVTA 135

Query: 144 DDFMG---NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
            D        I + F      L  W I D +   + + +L   E T L   VF++
Sbjct: 136 QDPKRPEYGSIQMKFTGNPVELRQWVIRDGNGSTTTV-VLGGLEKTSLPNSVFDV 189


>gi|103488147|ref|YP_617708.1| outer membrane lipoprotein carrier protein LolA [Sphingopyxis
           alaskensis RB2256]
 gi|98978224|gb|ABF54375.1| outer membrane lipoprotein carrier protein LolA [Sphingopyxis
           alaskensis RB2256]
          Length = 206

 Score = 45.4 bits (106), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/195 (20%), Positives = 77/195 (39%), Gaps = 15/195 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQ-------TMQGTFLQEDA-GYVMKGEF 66
           + F+  I PF AA       ++ ++     S+Q       TM   F+Q D  G  + G+ 
Sbjct: 1   MTFHKMIAPFAAAGLALATPAIGQSASALSSVQAHLKASDTMTADFVQTDRNGQRLSGKL 60

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE 126
            + RP K  F+Y     + ++ DGS + V + ++     +P++      +   ++ + + 
Sbjct: 61  TLKRPGKIRFQYQKGVPMLIVGDGSRLTVIDYEVRQVQSWPVKNSPLGALLDPDRDLAKY 120

Query: 127 SIQRVESNNSFITIFFKDDFMG--NMISVTFDR-----LSYRLLNWKIMDSSRRYSIIKI 179
           +      N   +++  KD        I++ F R        RL  W  +DS    + I +
Sbjct: 121 ARILPTGNKDVLSVEVKDPERPEYGTITMVFVRDASAPAGLRLRGWVALDSQNNRTRIDL 180

Query: 180 LKYKENTVLDPKVFE 194
              + N  +    F 
Sbjct: 181 SNQRFNVAVADSAFR 195


>gi|254449700|ref|ZP_05063137.1| twin-arginine translocation pathway signal [Octadecabacter
           antarcticus 238]
 gi|198264106|gb|EDY88376.1| twin-arginine translocation pathway signal [Octadecabacter
           antarcticus 238]
          Length = 205

 Score = 45.1 bits (105), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 49/103 (47%), Gaps = 2/103 (1%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKY 78
           A+  F A+    +  S+ +   +  S  + +G F Q +A G +  G  F+ RP +  F+Y
Sbjct: 16  ALAGFAASPSFAQQLSLGQVSGYLNSFTSAEGAFTQINADGTISTGTIFIKRPGRVRFEY 75

Query: 79  SSPSSVSLISDGSNIAVYNAKLDTW-SVYPLRYMAFSVIFSNN 120
           + P    +++ G  +A+++ + +     YPL     S+I   N
Sbjct: 76  NPPEESLVVAGGGQVAIFDPRSNNGPDRYPLNQTPLSIILERN 118


>gi|120554469|ref|YP_958820.1| outer-membrane lipoprotein carrier protein [Marinobacter aquaeolei
           VT8]
 gi|120324318|gb|ABM18633.1| outer membrane lipoprotein carrier protein LolA [Marinobacter
           aquaeolei VT8]
          Length = 216

 Score = 45.1 bits (105), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 77/182 (42%), Gaps = 20/182 (10%)

Query: 34  QSVKKAIEHFLSI----QTMQGTFLQ----EDAGYVM--KGEFFMARPSKFYFKYSSPSS 83
           Q+ + A E   SI    +T Q  F+Q    E+   V   +G     RP  FY++  +P S
Sbjct: 26  QASRGAAEQLTSILKGYETYQADFIQIVVNENGSQVQETRGSLKAKRPGLFYWETGAPLS 85

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLR---YMAFSVIFSNNQHVIQESIQ-----RVESNN 135
             ++SDG  + VY+  L+  +V+ L        +++ S     + ES +       ES  
Sbjct: 86  QFIVSDGDKVEVYDPDLEQVTVHSLDERVQTTPALLLSGEVENLDESYEVSVRDLGESTR 145

Query: 136 SFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
            F  +    D +   + ++F      L   ++ DS  + SI+     + N  LD  VF +
Sbjct: 146 EFTLVPRSQDSLFTSLRLSF--YDGELQEMRMRDSLSQMSILSFDHIELNQALDSSVFRL 203

Query: 196 PY 197
            Y
Sbjct: 204 DY 205


>gi|58040407|ref|YP_192371.1| Outer-membrane lipoprotein carrier protein [Gluconobacter oxydans
           621H]
 gi|58002821|gb|AAW61715.1| Outer-membrane lipoprotein carrier protein [Gluconobacter oxydans
           621H]
          Length = 208

 Score = 44.3 bits (103), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 68/184 (36%), Gaps = 35/184 (19%)

Query: 33  DQSVKKAIEHFLS-IQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           DQ     IE  L  + T+Q  F Q  A G    G   + RP +  F Y  PS + L+++ 
Sbjct: 37  DQGWISRIEDTLGQVTTLQARFRQTAADGSTTVGTATLDRPGRMRFDYDKPSPLLLVAND 96

Query: 91  SNIAVYNAKLDTWSVYPLRYMAFSVIF-----------------SNNQHVIQESIQRVES 133
             +   +  +D  +  PL      ++                  SN Q  +Q  + R +S
Sbjct: 97  GRVVFQDRSVDQVTTIPLDRTPLGLLLRPELKLSGDVTVTGFEHSNGQIRVQ--VVRTQS 154

Query: 134 -NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
                +T+   D  +G             LL W ++D+  R + I +   +    +   +
Sbjct: 155 AGEGTLTLVLSDAPLG-------------LLGWTVVDAQGRTTTIALSDVRLGGTVPQSL 201

Query: 193 FEIP 196
           F +P
Sbjct: 202 FVLP 205


>gi|146278933|ref|YP_001169092.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145557174|gb|ABP71787.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 212

 Score = 44.3 bits (103), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

Query: 46  IQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD-TW 103
           + T +  F Q +A G +  G  F+ RP +  F+Y+ P    +++ G  +A+++AK +   
Sbjct: 49  LSTAEADFTQVNADGSMSTGRLFIKRPGRVRFEYAPPERSLVMAGGGQVAIFDAKSNQPP 108

Query: 104 SVYPLRYMAFSVIFSNN 120
             YPL     S+I + N
Sbjct: 109 EQYPLSRTPLSLILAQN 125


>gi|92114553|ref|YP_574481.1| outer-membrane lipoprotein carrier protein [Chromohalobacter
           salexigens DSM 3043]
 gi|122990444|sp|Q1QUS6|LOLA_CHRSD RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|91797643|gb|ABE59782.1| outer membrane lipoprotein carrier protein LolA [Chromohalobacter
           salexigens DSM 3043]
          Length = 210

 Score = 43.9 bits (102), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 71/155 (45%), Gaps = 16/155 (10%)

Query: 51  GTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY 110
           G  LQE      +G  +++RP KF+++  +P    ++SDG  + +Y+  L+  SV PL  
Sbjct: 53  GQRLQE-----AEGHMWLSRPGKFHWEVEAPYRQVVVSDGDKVYLYDPDLEQVSVRPLDT 107

Query: 111 MAF---SVIFSNNQHVIQE----SIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLL 163
                 +++ S +   + E      ++ +   +F       D +   + +TF+  + RL 
Sbjct: 108 RVTHTPALLLSGSADALTENYAVESRQGDDEETFTLTPKSPDTLFESLQLTFE--NERLE 165

Query: 164 NWKIMDSSRRYSIIKILKYKENTVLDPK--VFEIP 196
             ++ DS+ + + I     + N  +D     FEIP
Sbjct: 166 GLQMEDSTGQRTAIAFDDIEVNGDIDASRFTFEIP 200


>gi|296532204|ref|ZP_06894956.1| LolA family outer membrane lipoprotein carrier protein [Roseomonas
           cervicalis ATCC 49957]
 gi|296267475|gb|EFH13348.1| LolA family outer membrane lipoprotein carrier protein [Roseomonas
           cervicalis ATCC 49957]
          Length = 268

 Score = 43.5 bits (101), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 34/167 (20%), Positives = 68/167 (40%), Gaps = 14/167 (8%)

Query: 36  VKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           + +A  +   I T++  FLQ    G   +G  F+ARP +  F Y  P  + L++      
Sbjct: 94  LARAETYLNGITTLRARFLQIAQNGGSAEGTAFIARPGRMRFDYDPPEPLLLVASDGQFL 153

Query: 95  VYNAKLDTWSVYPLRYMAFS------VIFSNNQHVIQESIQRVESNNSF--ITIFFKDDF 146
            Y+ +L   S+ P+     +      + F  +  V+      V+    F  +T+  +D  
Sbjct: 154 YYDRELRQPSIVPVSSTPLAFLLRPRISFGGDIEVMG-----VQRQGGFLQVTVRRRDAP 208

Query: 147 MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
               +++ F      L  W ++DS  R + + +   +    L  ++F
Sbjct: 209 SEGSLTLVFAEEPMELRQWVVVDSQGRQTRVTLNAIETGMALPRRLF 255


>gi|85375219|ref|YP_459281.1| outer membrane lipoprotein-sorting protein [Erythrobacter litoralis
           HTCC2594]
 gi|84788302|gb|ABC64484.1| outer membrane lipoprotein-sorting protein [Erythrobacter litoralis
           HTCC2594]
          Length = 221

 Score = 43.5 bits (101), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 29/155 (18%), Positives = 71/155 (45%), Gaps = 12/155 (7%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           S+  A+     I TM+ +F Q D  G  + G   + RP +  F+Y     + ++S+GS++
Sbjct: 42  SLDDAVAALRGISTMRASFTQTDRKGQTVGGTMTLKRPGRIRFEYEKGVPLLIVSNGSSM 101

Query: 94  AVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKD----DFMGN 149
            + + +++    +P++      +   ++ V +        N   +++  +D    +F   
Sbjct: 102 TLVDYEVNQVQRWPIKNSPLGALLDPSRDVKRYGKLISTGNRDVLSVEVRDPKKPEF--G 159

Query: 150 MISVTFDR-----LSYRLLNWKIMDSSRRYSIIKI 179
           +I++ F R       ++L NW  +D+    + +++
Sbjct: 160 VITLIFLRNASAPGGWQLTNWVALDAQNNRTTVRL 194


>gi|148259434|ref|YP_001233561.1| outer membrane lipoprotein carrier protein LolA [Acidiphilium
           cryptum JF-5]
 gi|326402660|ref|YP_004282741.1| putative outer membrane lipoprotein carrier protein LolA
           [Acidiphilium multivorum AIU301]
 gi|146401115|gb|ABQ29642.1| outer membrane lipoprotein carrier protein LolA [Acidiphilium
           cryptum JF-5]
 gi|325049521|dbj|BAJ79859.1| putative outer membrane lipoprotein carrier protein LolA
           [Acidiphilium multivorum AIU301]
          Length = 206

 Score = 43.5 bits (101), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/167 (20%), Positives = 68/167 (40%), Gaps = 8/167 (4%)

Query: 34  QSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSN 92
           Q + K +++  S++T+   F+Q    G V  G   + RP K  F+Y  P    L++    
Sbjct: 34  QVLGKVLDYLNSLKTVTARFMQVGPDGSVRTGTAIVQRPGKMRFEYDKPDPQLLVAGFGL 93

Query: 93  IAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI---QESIQRVESNNSFI--TIFFKDDFM 147
           +  ++ +LD  +  PL      ++ +  +H+       + RV +    I  T+       
Sbjct: 94  LVYHDPQLDQTTNIPLSSTPLGILLA--KHITFGGDVKLLRVSTPPGEIQVTLTRAGREA 151

Query: 148 GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
              I++ F      L  W++ D+  R + + +   K       K FE
Sbjct: 152 QGHITLVFSTNPIELRQWRLTDAQDRVTQVSLYDLKPAAPFPDKTFE 198


>gi|89070981|ref|ZP_01158204.1| Putative outer membrane lipoprotein carrier protein [Oceanicola
           granulosus HTCC2516]
 gi|89043444|gb|EAR49659.1| Putative outer membrane lipoprotein carrier protein [Oceanicola
           granulosus HTCC2516]
          Length = 202

 Score = 43.1 bits (100), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 43/88 (48%), Gaps = 2/88 (2%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           S+ +  ++  S  T QG F Q ++ G +  G   + RP +  F+Y+ P    +++ G ++
Sbjct: 28  SLAQISQYMNSFSTAQGEFTQINSDGTISTGTLLIKRPGRIRFQYNPPDRSLVLAGGGSV 87

Query: 94  AVYNAKLD-TWSVYPLRYMAFSVIFSNN 120
           AV++ + D     YPL      +I   N
Sbjct: 88  AVFDPQSDNNPERYPLSETPLKIILEQN 115


>gi|254489676|ref|ZP_05102872.1| outer membrane lipoprotein carrier protein LolA [Methylophaga
           thiooxidans DMS010]
 gi|224465085|gb|EEF81338.1| outer membrane lipoprotein carrier protein LolA [Methylophaga
           thiooxydans DMS010]
          Length = 212

 Score = 43.1 bits (100), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 67/147 (45%), Gaps = 29/147 (19%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVM---KGEFFMARPSKFYFKYSSPSSV 84
           T +  + + ++H   ++T Q  F Q   +  G VM   +G F ++RP KF + Y +P   
Sbjct: 26  TGEDKLNQFVQH---VETFQAAFEQTVIDPEGQVMEQAQGLFVLSRPGKFRWDYETPYPQ 82

Query: 85  SLISDGSNIAVYNAKLDTWSV---------YPLRYMAFSVIFSNNQHV-----------I 124
            +++DG NI  Y+  L+  +V          P   ++  ++  +  ++           +
Sbjct: 83  KIVADGKNIWFYDVDLEQVTVKSQQEALAETPATLLSGELVPEDKYNINNLPSDDGLLWV 142

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMI 151
           + + ++ ESN   +T+ F  D +  MI
Sbjct: 143 ELTPKQTESNFQAVTLAFDGDVLQQMI 169


>gi|254449278|ref|ZP_05062725.1| outer membrane lipoprotein carrier protein LolA [gamma
           proteobacterium HTCC5015]
 gi|198261133|gb|EDY85431.1| outer membrane lipoprotein carrier protein LolA [gamma
           proteobacterium HTCC5015]
          Length = 211

 Score = 43.1 bits (100), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 42/76 (55%), Gaps = 7/76 (9%)

Query: 40  IEHFLS-IQTMQGTF---LQEDAGYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSN 92
           +EHFLS  + ++  F   L++ +G  ++   G   + RP++F + Y  P    L++DG N
Sbjct: 26  LEHFLSHTKNLKADFSQTLEDSSGRQLQQQTGTVVLQRPNRFVWHYQQPYEQQLVADGRN 85

Query: 93  IAVYNAKLDTWSVYPL 108
           +  Y+  L+  SV PL
Sbjct: 86  LWHYDVDLEQVSVRPL 101


>gi|254456048|ref|ZP_05069477.1| outer membrane lipoprotein carrier protein [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207083050|gb|EDZ60476.1| outer membrane lipoprotein carrier protein [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 181

 Score = 42.7 bits (99), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 87/188 (46%), Gaps = 16/188 (8%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKF 74
           +F Y  I  F      +K +  +K IE+  +++ ++  F Q   G +  G   +  P K 
Sbjct: 1   MFKYILILIFFVLISNSKAEIKEKIIENLQNVENLKFKFEQNINGKIENGICTIKYPKKI 60

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNN-----QHVIQESI 128
           Y KYS  + + L+S+G ++ +   K +T +  Y L+    ++I   N      + ++E+I
Sbjct: 61  YCKYSKNNKI-LVSNGKSLVI---KTETSFYRYSLKKTPLNLILDKNFLIKKINFLKENI 116

Query: 129 QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
             ++ N    TI   D    N I V FD  ++ L+ WK  D  +  +I  +   + N  +
Sbjct: 117 --IDKNLINYTIVEND----NEIDVFFDIKTFNLVGWKTRDIYQNTNITYLSSIETNKEI 170

Query: 189 DPKVFEIP 196
              +F+IP
Sbjct: 171 TKNLFKIP 178


>gi|294678843|ref|YP_003579458.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           capsulatus SB 1003]
 gi|294477663|gb|ADE87051.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           capsulatus SB 1003]
          Length = 203

 Score = 42.4 bits (98), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 67/156 (42%), Gaps = 6/156 (3%)

Query: 45  SIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW 103
            + T +  F Q +A G    G+ ++ RP +  F+YS   ++ L S G  +A+++ K +  
Sbjct: 40  GLTTAEAAFTQVNADGSKSTGKLYLKRPGRMRFEYSDDDTLVLAS-GGQVAIFDPKSNQI 98

Query: 104 S-VYPLRYMAFSVIFSNNQHVIQESI---QRVESNNSFITIFFKDDFMGNMISVTFDRLS 159
           +  YPL+    ++I ++   + Q  +      E  N+ +      +     I + F    
Sbjct: 99  AEQYPLKRTPLNLILADRIDLAQARMVVGHEAEGANTAVVAQDPQNPDYGTIRLVFSANP 158

Query: 160 YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
             L  W I D +   +++ + + K      P +F I
Sbjct: 159 VTLRRWVITDDTGAKTVVILDQLKPGVDPGPLMFSI 194


>gi|56698238|ref|YP_168611.1| outer membrane lipoprotein carrier protein LolA, putative [Ruegeria
           pomeroyi DSS-3]
 gi|56679975|gb|AAV96641.1| outer membrane lipoprotein carrier protein LolA, putative [Ruegeria
           pomeroyi DSS-3]
          Length = 198

 Score = 42.4 bits (98), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 29/154 (18%), Positives = 66/154 (42%), Gaps = 5/154 (3%)

Query: 45  SIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD-T 102
            ++T+Q TF Q  D G +  G+ ++ RP +  F+Y  P    +++ G  + +++ K +  
Sbjct: 34  GLKTVQTTFTQINDDGSLSTGKLWLHRPGRMRFEYDPPDRSVVLAKGGTVIIHDPKSNQP 93

Query: 103 WSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG---NMISVTFDRLS 159
              YPL     S++ +    + + ++    + +   T+    D        I ++F    
Sbjct: 94  PEQYPLNRTPLSIVLARTVDLDRANMVVGHAFDGTATVVTAQDPENPDYGRIELSFTGDP 153

Query: 160 YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
             L  W I D +   + + + +  +   L+  +F
Sbjct: 154 VELRKWVIHDGAGSRTTVILGQLTKGNSLNQNLF 187


>gi|94499676|ref|ZP_01306213.1| outer-membrane lipoprotein carrier protein precursor [Oceanobacter
           sp. RED65]
 gi|94428430|gb|EAT13403.1| outer-membrane lipoprotein carrier protein precursor [Oceanobacter
           sp. RED65]
          Length = 211

 Score = 42.0 bits (97), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 33  DQSVKKAIEHFLSIQTMQGTFLQ--EDA-GYVMK---GEFFMARPSKFYFKYSSPSSVSL 86
           +QS+ K       ++TM+  F Q  ED  G V++   G F +++P++FY+K   P +  L
Sbjct: 24  EQSLSKLQNVLAPLKTMKAEFKQISEDGRGVVLQTQAGSFVLSKPNRFYWKSEEPFAQLL 83

Query: 87  ISDGSNIAVYNAKLDTWSVYPL 108
           +S+G  + VY+  L+  ++  L
Sbjct: 84  VSNGETLWVYDEDLEQVTIQKL 105


>gi|88812896|ref|ZP_01128140.1| outer membrane lipoprotein carrier protein LolA [Nitrococcus
           mobilis Nb-231]
 gi|88789818|gb|EAR20941.1| outer membrane lipoprotein carrier protein LolA [Nitrococcus
           mobilis Nb-231]
          Length = 199

 Score = 41.6 bits (96), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 45/86 (52%), Gaps = 9/86 (10%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE----DAGYV--MKGEFFMARPSKF 74
           + P+     I   Q+++   +++ S+ T+ G F+QE    D   +    G F +ARP++F
Sbjct: 1   MLPWEPGAAIDAIQALQ---QYYDSVHTLTGRFVQETRAEDGSRIDASSGAFALARPNRF 57

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKL 100
            + Y  P    +++DG  + VY+ +L
Sbjct: 58  DWLYEKPYRQRIVADGKRLWVYDVEL 83


>gi|50085964|ref|YP_047474.1| outer-membrane lipoproteins carrier protein [Acinetobacter sp.
           ADP1]
 gi|49531940|emb|CAG69652.1| outer-membrane lipoproteins carrier protein [Acinetobacter sp.
           ADP1]
          Length = 230

 Score = 41.6 bits (96), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 42/92 (45%), Gaps = 17/92 (18%)

Query: 26  AAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-----------------EDAGYVMKGEFFM 68
           AA P ++ Q+    ++    IQ++  +F Q                 +      KGE  +
Sbjct: 28  AATPASEQQATSNLVKQLSGIQSLSASFEQTTKTTNAKAPQKKGLSAQHMNQTFKGEMKV 87

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL 100
           ARP KF+++ +SPS  ++ + G  + +Y+  L
Sbjct: 88  ARPGKFFWETTSPSKQTIATTGKTVWIYDPDL 119


>gi|298530194|ref|ZP_07017596.1| outer membrane lipoprotein carrier protein LolA
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509568|gb|EFI33472.1| outer membrane lipoprotein carrier protein LolA
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 206

 Score = 41.2 bits (95), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 88/209 (42%), Gaps = 27/209 (12%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSV-----KKAIEHFLSIQTMQGTFLQE------D 57
           +I   +  F   + PF       KDQS+     +K  E   SIQT+ G+F+Q+      D
Sbjct: 1   MIKSALALFVFILMPFTGW---GKDQSIPADVLEKLHEIHDSIQTVSGSFVQKKHLDVFD 57

Query: 58  AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL-RYMAFSVI 116
              V +G F + RP +  + Y  PS     SDG  +  ++ +       PL R    SVI
Sbjct: 58  QTLVSRGSFAIDRPGRIRWAYEEPSVFGFSSDGLQVRRWSEESGMSQSAPLSRDPVLSVI 117

Query: 117 FSN-------NQHVIQE--SIQRVESNNSFITIFFKDDFMGNMIS---VTFDRLSYRLLN 164
                     +   I++  S+   ES    + +  +   + ++IS   ++FD  S  +  
Sbjct: 118 VDQMLAWSTMDLQAIEDHFSLTLAESEPMVLELEPEAKELRDIISKVLISFDSTSTHIEK 177

Query: 165 WKIMDSSRRYSIIKILKYKENTVLDPKVF 193
            +I++     + I+  +   N  LD ++F
Sbjct: 178 IRILEHDSDRTNIRFEEVSLNQDLDHELF 206


>gi|78485110|ref|YP_391035.1| outer membrane lipoprotein carrier protein LolA [Thiomicrospira
           crunogena XCL-2]
 gi|78363396|gb|ABB41361.1| outer membrane lipoprotein carrier protein LolA [Thiomicrospira
           crunogena XCL-2]
          Length = 217

 Score = 41.2 bits (95), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 9/75 (12%)

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV---------YPLRYMAFS 114
           G F M RP +  + Y  P    +ISDG N+ VY+  LD  +V         +PL ++ + 
Sbjct: 68  GYFSMKRPGQLLWVYEKPEPQKIISDGRNVWVYDVDLDQATVRALANVEADFPLSWLLYK 127

Query: 115 VIFSNNQHVIQESIQ 129
              S   ++I  SI+
Sbjct: 128 EPLSERFNIIPGSIK 142


>gi|332187682|ref|ZP_08389417.1| outer membrane lipocarrier LolA family protein [Sphingomonas sp.
           S17]
 gi|332012248|gb|EGI54318.1| outer membrane lipocarrier LolA family protein [Sphingomonas sp.
           S17]
          Length = 206

 Score = 41.2 bits (95), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 71/175 (40%), Gaps = 29/175 (16%)

Query: 39  AIEHFL-SIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY 96
           A++  L ++ TM   F Q D AG V+ G   M +P K  F+Y     + +++DG  +   
Sbjct: 31  AVQRSLQALTTMTADFTQTDRAGKVLTGTLTMKKPGKIRFQYEKGVPLLIVADGGALTFI 90

Query: 97  NAKLDTWSVYPLRYMAFSVIFSNNQ------HVIQESIQR---VESNN------SFITIF 141
           +  +     +P++     V+   ++       V+  +  R   VE+N+        IT+ 
Sbjct: 91  DYSVRQVQRWPIKNSPLGVLIDPSRDIGRYAKVVPSADSRLLSVEANDPKHPEYGKITLV 150

Query: 142 FKDDFM--GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
           F  D    G ++          L  W  +DS    + I++   +    +D K F 
Sbjct: 151 FARDPAAPGGLM----------LQGWVALDSQNNRTTIRLSNQRYGVAVDDKAFR 195


>gi|85710027|ref|ZP_01041092.1| outer membrane lipoprotein-sorting protein [Erythrobacter sp. NAP1]
 gi|85688737|gb|EAQ28741.1| outer membrane lipoprotein-sorting protein [Erythrobacter sp. NAP1]
          Length = 221

 Score = 40.8 bits (94), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 34/174 (19%), Positives = 72/174 (41%), Gaps = 13/174 (7%)

Query: 22  FPFNAAYPITKDQS---VKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFK 77
            P     P    QS   + +A+    SI TM+  F Q D  G   +G   +  P K  F 
Sbjct: 26  LPHGEPAPHALAQSSADLDRAVSALRSISTMKADFSQTDRQGRTARGTMTLKSPGKIRFD 85

Query: 78  YSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSF 137
           Y   S + ++S+G ++ + + +++    +P+R      +    + +          N   
Sbjct: 86  YGRDSDLLIVSNGRSLYMVDYEVNQVERWPIRNSPLGALLDPERDMKDYGTLIPTGNPDV 145

Query: 138 ITIFFKD---DFMGNMISVTFDRLS-----YRLLNWKIMDSSRRYSIIKILKYK 183
           ++I  +D     +G M ++ F R S      +L +W  +D+    + +++  ++
Sbjct: 146 LSIDVRDPNKPELGRM-NLIFVRNSSAPGGLQLTHWVALDAQNHRTTVRLTNHR 198


>gi|74317515|ref|YP_315255.1| outer membrane lipoprotein carrier protein LolA [Thiobacillus
           denitrificans ATCC 25259]
 gi|123731796|sp|Q3SIS5|LOLA_THIDA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|74057010|gb|AAZ97450.1| outer membrane lipoprotein carrier protein LolA [Thiobacillus
           denitrificans ATCC 25259]
          Length = 202

 Score = 40.8 bits (94), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%)

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL 108
           G+   ARP KF + Y +P    ++ DG+ + +Y+A LD  +V PL
Sbjct: 55  GKMAFARPGKFRWDYRAPYEQVIVGDGAKLWLYDADLDQVTVKPL 99


>gi|126728546|ref|ZP_01744362.1| outer membrane lipoprotein carrier protein LolA, putative
           [Sagittula stellata E-37]
 gi|126711511|gb|EBA10561.1| outer membrane lipoprotein carrier protein LolA, putative
           [Sagittula stellata E-37]
          Length = 222

 Score = 40.0 bits (92), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 9/133 (6%)

Query: 45  SIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPS-SVSLISDGSNIAVYNAKLDT 102
           ++QT++  F Q ++ G +  G   + RP K  F Y+ P   + L+S GS + + + KL  
Sbjct: 62  TLQTVKSPFTQINSDGTISTGTISIKRPGKARFDYNPPERGLVLVSSGS-VYILDRKLGG 120

Query: 103 W-SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFM----GNMISVTFDR 157
               YPL     S+I + N ++ Q  +    S +   T+    D      GN I + F  
Sbjct: 121 MPETYPLEQTPLSIILARNVNLGQAGMVTGHSFDGTATVVTAQDPRRPEYGN-IQLKFTA 179

Query: 158 LSYRLLNWKIMDS 170
               L  W I D 
Sbjct: 180 NPTELRQWIITDG 192


>gi|260574467|ref|ZP_05842471.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter sp.
           SW2]
 gi|259023363|gb|EEW26655.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter sp.
           SW2]
          Length = 215

 Score = 39.7 bits (91), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 39/78 (50%), Gaps = 2/78 (2%)

Query: 45  SIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD-T 102
            + T +  F Q +  G +  G  ++ RP +  F+Y+ P    +++ G  +A+++AK +  
Sbjct: 51  GLTTAEAEFTQINGDGSITSGRLYIKRPGRVRFEYAPPDKSLVMAGGGQVAIFDAKSNQP 110

Query: 103 WSVYPLRYMAFSVIFSNN 120
              YPL     ++I + N
Sbjct: 111 PEQYPLARTPLNLILAAN 128


>gi|308049687|ref|YP_003913253.1| outer membrane lipoprotein carrier protein LolA [Ferrimonas
           balearica DSM 9799]
 gi|307631877|gb|ADN76179.1| outer membrane lipoprotein carrier protein LolA [Ferrimonas
           balearica DSM 9799]
          Length = 202

 Score = 39.7 bits (91), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 53/110 (48%), Gaps = 11/110 (10%)

Query: 51  GTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR- 109
           GT LQ+      +G   MA P++F +   +P    ++SDG ++ +Y+  L+  S+Y L+ 
Sbjct: 50  GTLLQQG-----QGSLAMAVPNRFAWHQQAPEESVILSDGEDVYLYDPLLEQVSIYDLQD 104

Query: 110 ---YMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFD 156
                  S++ SN++   + +  +V  N    T+   D      +++ FD
Sbjct: 105 ATGQTPLSLLSSNDE--AEWAAYQVSQNGDCFTLTPSDADGIQTMAICFD 152


>gi|148555456|ref|YP_001263038.1| outer membrane lipoprotein carrier protein LolA [Sphingomonas
           wittichii RW1]
 gi|148500646|gb|ABQ68900.1| outer membrane lipoprotein carrier protein LolA [Sphingomonas
           wittichii RW1]
          Length = 207

 Score = 39.7 bits (91), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 34/178 (19%), Positives = 74/178 (41%), Gaps = 11/178 (6%)

Query: 26  AAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSV 84
           AA  + +  S+ +   H   I TM   F+Q D  G  + G   + +P K  F+Y     +
Sbjct: 21  AAPAMAQTASLDEVAAHLRGITTMTADFVQTDRNGKSLSGMLTLRQPGKVRFEYQKGVPL 80

Query: 85  SLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKD 144
            ++ DG  + + +  +   S +P+     SV+    + + + +     +    IT+  +D
Sbjct: 81  LIVGDGKALTMIDYSVRQVSRWPVGNSPLSVLIDPRRDMSRFAKVVPSTIPGTITVEARD 140

Query: 145 ----DFMGNMISVTFDRLS----YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
               +F    I++ F + +      L  W ++D+    S +++   +    +  K F+
Sbjct: 141 GKHPEF--GTITIVFAKGAGPGGLALQGWTVLDAQNGRSTVRLTNQRFGVAISDKAFK 196


>gi|117924967|ref|YP_865584.1| outer membrane lipoprotein carrier protein LolA [Magnetococcus sp.
           MC-1]
 gi|117608723|gb|ABK44178.1| outer membrane lipoprotein carrier protein LolA [Magnetococcus sp.
           MC-1]
          Length = 223

 Score = 39.7 bits (91), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 6/62 (9%)

Query: 45  SIQTMQGTFLQE----DAGYVM--KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNA 98
            I TM+ TF+Q     D+  +   +G F   RP KF + Y SP    ++ DG  + ++  
Sbjct: 49  GITTMEATFIQRVRSNDSTEIEESRGRFLALRPGKFRWDYESPEVQHIVCDGKTVWLHEP 108

Query: 99  KL 100
           +L
Sbjct: 109 EL 110


>gi|91775478|ref|YP_545234.1| outer membrane lipoprotein carrier protein LolA [Methylobacillus
           flagellatus KT]
 gi|122400017|sp|Q1H294|LOLA_METFK RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|91709465|gb|ABE49393.1| outer membrane lipoprotein carrier protein LolA [Methylobacillus
           flagellatus KT]
          Length = 205

 Score = 39.7 bits (91), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 46/106 (43%), Gaps = 11/106 (10%)

Query: 42  HFLSIQT-MQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL 100
           HF  + T  QG  +QE     ++G   + RP KF + Y+ P    ++ DG  + +Y+  L
Sbjct: 40  HFRQVVTDAQGNKVQE-----VEGHMQLQRPGKFRWDYNKPYVQQIVGDGEKVWLYDPDL 94

Query: 101 DTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDF 146
           +  +V P+     S    ++   +    Q  E N +  T+   D  
Sbjct: 95  NQLTVRPM-----SKAIGSSPASLLAGAQDAERNFTLTTVIRSDGL 135


>gi|198282687|ref|YP_002219008.1| outer membrane lipoprotein carrier protein LolA [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218668025|ref|YP_002424879.1| outer membrane lipoprotein carrier protein LolA, putative
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198247208|gb|ACH82801.1| outer membrane lipoprotein carrier protein LolA [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218520238|gb|ACK80824.1| outer membrane lipoprotein carrier protein LolA, putative
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 230

 Score = 39.7 bits (91), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 6/72 (8%)

Query: 43  FLSIQTMQGTFLQEDA---GYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY 96
           F    T+   F QE A   G ++K   G+ +++RP KF + Y   +  +++S+G  + +Y
Sbjct: 54  FQKTHTITAQFRQEVANHDGRIVKRTSGKLWISRPGKFRWDYDGRNGQTIVSNGEKVWLY 113

Query: 97  NAKLDTWSVYPL 108
              L+  +V PL
Sbjct: 114 EPALEQATVQPL 125


>gi|110834152|ref|YP_693011.1| outer membrane lipoprotein carrier protein [Alcanivorax borkumensis
           SK2]
 gi|122959498|sp|Q0VQ09|LOLA_ALCBS RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|110647263|emb|CAL16739.1| outer membrane lipoprotein carrier protein [Alcanivorax borkumensis
           SK2]
          Length = 209

 Score = 39.3 bits (90), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 38/193 (19%), Positives = 83/193 (43%), Gaps = 16/193 (8%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVMK---GEFFM 68
           L    A+ P     P     +    +    ++++M+G F Q   + +G  M+   G+F +
Sbjct: 4   LLLTLAMVPAVLFSPTAWGDATDDLLGRLQTLESMKGGFEQVVLDQSGTHMQEALGKFQV 63

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY---MAFSVIFSNNQHVIQ 125
           AR ++FY+   +P      SDG+ + VY+  L+   V PL        +++F      + 
Sbjct: 64  ARGNRFYWLTETPYEQMAASDGTTVWVYDKDLEQVVVRPLSQDLGQTPALLFGGKPADVA 123

Query: 126 ESIQRVESNNSFITIFFK-----DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
           ++    E +N    + ++      D + + + VTF     +  + ++ D+  + ++I  +
Sbjct: 124 KAFTISERDNRGAEVTYRLTPKGQDPLFDQLDVTFK--GGQPASMRLQDALGQQTVIDFI 181

Query: 181 KYKENTVLDPKVF 193
               N  +D  +F
Sbjct: 182 GLTLNDGIDSSLF 194


>gi|119385396|ref|YP_916452.1| outer membrane lipoprotein carrier protein LolA [Paracoccus
           denitrificans PD1222]
 gi|119375163|gb|ABL70756.1| outer membrane lipoprotein carrier protein LolA [Paracoccus
           denitrificans PD1222]
          Length = 198

 Score = 39.3 bits (90), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 71/159 (44%), Gaps = 10/159 (6%)

Query: 27  AYPITKDQSVKKAIEHFL-SIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSV 84
           A+P   ++     I  +L S++T +  F Q +A G +  G  ++ RP +  F+Y    ++
Sbjct: 17  AFPALAEKISLNEISRYLNSLKTAKADFTQVNADGSISTGIVYIQRPQRVRFEYKGDRTL 76

Query: 85  SLISDGSNIAVYNAKL-DTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFK 143
            + S G N+AV++ K       YPL     S+I + N  + +  +    +     T+   
Sbjct: 77  VMASAG-NVAVFDGKTRGAPQQYPLSKTPLSLILAPNIDLSRARMVTGYTEKKNTTVVTA 135

Query: 144 DDFM----GNMISVTFDRLSYRLLNWKIM-DSSRRYSII 177
            D      GN I + F     +L  W +  D+ +R ++I
Sbjct: 136 QDPQHPEYGN-IQMVFTANPTQLRQWVVTDDTGKRTTVI 173


>gi|77163879|ref|YP_342404.1| Outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           oceani ATCC 19707]
 gi|254435438|ref|ZP_05048945.1| outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           oceani AFC27]
 gi|76882193|gb|ABA56874.1| Outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           oceani ATCC 19707]
 gi|207088549|gb|EDZ65821.1| outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           oceani AFC27]
          Length = 236

 Score = 39.3 bits (90), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 65/138 (47%), Gaps = 9/138 (6%)

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV--YPLRYMAFSVIFSNN 120
           KG FF+ RP KF + Y  P S ++++DG ++  Y+  L   +V    L       +  + 
Sbjct: 85  KGVFFLQRPGKFRWDYHEPFSQTIVADGEHVWFYDPDLAQVTVKNQGLALGDTPALLLSG 144

Query: 121 QHVIQE--SIQRVESNN--SFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYS 175
           + +  E  SI  + S+N  +++ +  +D       + + FD    R +  ++ DS  R +
Sbjct: 145 KRLPAENFSISNLPSDNHLAWVELRPRDKEAAFERLLLAFDDDGLRQM--ELHDSFGRTT 202

Query: 176 IIKILKYKENTVLDPKVF 193
            +   K + N  LDP +F
Sbjct: 203 RLVFSKLEINLSLDPSLF 220


>gi|251789958|ref|YP_003004679.1| outer-membrane lipoprotein carrier protein [Dickeya zeae Ech1591]
 gi|247538579|gb|ACT07200.1| outer membrane lipoprotein carrier protein LolA [Dickeya zeae
          Ech1591]
          Length = 204

 Score = 39.3 bits (90), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 46 IQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
          + T  G  +QE AG     E ++ RP+ F +K +SP   +L+SDG  +  YN
Sbjct: 46 VTTNDGAAVQEGAG-----ELWVKRPNLFNWKTTSPDESTLVSDGKTLWFYN 92


>gi|228471965|ref|ZP_04056733.1| outer membrane lipoprotein carrier protein LolA [Capnocytophaga
          gingivalis ATCC 33624]
 gi|228276577|gb|EEK15290.1| outer membrane lipoprotein carrier protein LolA [Capnocytophaga
          gingivalis ATCC 33624]
          Length = 205

 Score = 38.9 bits (89), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 9/79 (11%)

Query: 29 PITKDQS---VKKAIEHFLSIQTMQGTFLQEDAGYVM------KGEFFMARPSKFYFKYS 79
          P+T+ Q+    +K ++   +I+TMQ +F+Q+     M      KGE   ++P K  + Y+
Sbjct: 21 PLTQVQANAFKEKVVQKNKAIKTMQASFVQKKHLEFMSKDMETKGEMAFSKPDKLNWSYT 80

Query: 80 SPSSVSLISDGSNIAVYNA 98
          +P S  ++  G NI V +A
Sbjct: 81 TPYSYRIVFQGDNIKVDDA 99


>gi|331004979|ref|ZP_08328389.1| Outer membrane lipoprotein carrier protein LolA [gamma
           proteobacterium IMCC1989]
 gi|330421221|gb|EGG95477.1| Outer membrane lipoprotein carrier protein LolA [gamma
           proteobacterium IMCC1989]
          Length = 206

 Score = 38.5 bits (88), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 6/73 (8%)

Query: 41  EHFLSIQTMQGTFLQ---EDAGYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           E  + + T  G F Q   +D G V++   G FF+ RP  F+++  +P    L+SD ++I 
Sbjct: 32  EKLVQLSTFSGDFRQTLIDDQGEVLQESTGVFFLERPGYFHWETIAPFPQLLVSDLASIW 91

Query: 95  VYNAKLDTWSVYP 107
           +Y+  L+  +V P
Sbjct: 92  LYDPDLEQVTVRP 104


>gi|271500828|ref|YP_003333853.1| outer membrane lipoprotein carrier protein LolA [Dickeya dadantii
          Ech586]
 gi|270344383|gb|ACZ77148.1| outer membrane lipoprotein carrier protein LolA [Dickeya dadantii
          Ech586]
          Length = 204

 Score = 38.5 bits (88), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 46 IQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
          + T  G  +QE AG     E ++ RP+ F +K +SP   +L+SDG  +  YN
Sbjct: 46 VTTDDGEAVQEGAG-----ELWVKRPNLFNWKTTSPDESTLVSDGKTLWFYN 92


>gi|70731238|ref|YP_260979.1| outer-membrane lipoprotein carrier protein [Pseudomonas fluorescens
           Pf-5]
 gi|123654456|sp|Q4K9V4|LOLA_PSEF5 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|68345537|gb|AAY93143.1| outer membrane lipoprotein carrier protein LolA [Pseudomonas
           fluorescens Pf-5]
          Length = 207

 Score = 38.5 bits (88), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 5/58 (8%)

Query: 51  GTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL 108
           GT LQE AG     E  + RP  FY+   +P    ++SDG  +++++  L+  ++  L
Sbjct: 52  GTQLQETAG-----EMSLQRPGLFYWHTDAPQEQLMVSDGQKVSLWDPDLEQVTIKKL 104


>gi|253688107|ref|YP_003017297.1| outer membrane lipoprotein carrier protein LolA [Pectobacterium
          carotovorum subsp. carotovorum PC1]
 gi|259491788|sp|C6DF52|LOLA_PECCP RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
          Precursor
 gi|251754685|gb|ACT12761.1| outer membrane lipoprotein carrier protein LolA [Pectobacterium
          carotovorum subsp. carotovorum PC1]
          Length = 203

 Score = 38.5 bits (88), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 46 IQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
          + +  G  +QE      +GE ++ RP+ F +K +SP   +LISDG  +  YN
Sbjct: 45 VTSADGAAVQEG-----EGELWLKRPNLFNWKTTSPDESTLISDGKTLWFYN 91


>gi|227328171|ref|ZP_03832195.1| outer-membrane lipoprotein carrier protein [Pectobacterium
          carotovorum subsp. carotovorum WPP14]
          Length = 203

 Score = 38.5 bits (88), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 46 IQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
          + +  G  +QE      +GE ++ RP+ F +K +SP   +LISDG  +  YN
Sbjct: 45 VTSADGAAVQE-----GEGELWLKRPNLFNWKTTSPDESTLISDGKTLWFYN 91


>gi|134094253|ref|YP_001099328.1| outer-membrane lipoprotein carrier protein [Herminiimonas
           arsenicoxydans]
 gi|133738156|emb|CAL61201.1| Outer-membrane lipoprotein carrier protein precursor [Herminiimonas
           arsenicoxydans]
          Length = 225

 Score = 38.5 bits (88), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 73/181 (40%), Gaps = 30/181 (16%)

Query: 45  SIQTMQGTFLQE----DAGYVM-----KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAV 95
           S Q+ +G F Q+    D+G         G F  ARP KF + Y  P    L +DG  + +
Sbjct: 51  STQSARGEFTQQLVKVDSGTTKVSNKSTGTFTFARPGKFIWTYQKPYEQLLQADGEKLYI 110

Query: 96  YNAKLDTWSVYPLRYMAFS----VIFSNNQHVIQESIQRVESNNSF----ITIFFKDDFM 147
           Y+  L+  ++  L     S    ++F +N      +++   + N       T   KD   
Sbjct: 111 YDKDLNQVTIKKLGDALGSSPAAILFGSNDLEKNFTLKEAGTKNGLEWLEATPKAKD--- 167

Query: 148 GNMISVTFDRLSYRLLNW-----KIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
                 TFD +   L N      ++ DS  + S++   K+++N  L    F+    K  +
Sbjct: 168 -----TTFDHIGIGLRNGAPEAMELRDSFGQVSLLSFTKFEKNPPLPANQFKFAVPKGAD 222

Query: 203 I 203
           +
Sbjct: 223 V 223


>gi|50121570|ref|YP_050737.1| outer-membrane lipoprotein carrier protein [Pectobacterium
          atrosepticum SCRI1043]
 gi|81644761|sp|Q6D3U8|LOLA_ERWCT RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
          Precursor
 gi|49612096|emb|CAG75546.1| outer-membrane lipoproteins carrier protein [Pectobacterium
          atrosepticum SCRI1043]
          Length = 203

 Score = 38.5 bits (88), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 46 IQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
          + +  G  +QE      +GE ++ RP+ F +K +SP   +LISDG  +  YN
Sbjct: 45 VTSTDGAAVQE-----GEGELWLKRPNLFNWKTTSPDESALISDGKTLWFYN 91


>gi|227112003|ref|ZP_03825659.1| outer-membrane lipoprotein carrier protein [Pectobacterium
          carotovorum subsp. brasiliensis PBR1692]
          Length = 203

 Score = 38.5 bits (88), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 46 IQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
          + +  G  +QE      +GE ++ RP+ F +K +SP   +LISDG  +  YN
Sbjct: 45 VTSADGAAVQE-----GEGELWLKRPNLFNWKTTSPDESTLISDGKTLWFYN 91


>gi|163743406|ref|ZP_02150786.1| outer membrane lipoprotein carrier protein LolA, putative
           [Phaeobacter gallaeciensis 2.10]
 gi|161383400|gb|EDQ07789.1| outer membrane lipoprotein carrier protein LolA, putative
           [Phaeobacter gallaeciensis 2.10]
          Length = 195

 Score = 38.5 bits (88), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 66/164 (40%), Gaps = 5/164 (3%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           S+ +  ++   I T    F Q  D G +  G+ +M RP +  F+Y  P+   +++    +
Sbjct: 24  SLNEVSQYLNGISTATAPFSQINDDGSLSTGKLYMHRPGRMRFEYDPPNKGVVVAGAGAV 83

Query: 94  AVYNAKLD-TWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG---N 149
            + + K +     YPL+    S+I + N  + + ++    S +   TI    D       
Sbjct: 84  LIQDPKSNQPPETYPLKRTPLSLILARNVDLGRANMVVGHSFDGTSTIIRAQDPKNPEYG 143

Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
            I + F      L  W I D S   + + +   K    L  K+F
Sbjct: 144 SIEMMFTGDPVELRKWVIHDGSGGQTTVILGGLKTGVKLPSKLF 187


>gi|331001207|ref|ZP_08324834.1| outer membrane lipoprotein carrier protein LolA [Parasutterella
           excrementihominis YIT 11859]
 gi|329569139|gb|EGG50931.1| outer membrane lipoprotein carrier protein LolA [Parasutterella
           excrementihominis YIT 11859]
          Length = 221

 Score = 38.1 bits (87), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 50  QGTFLQED--AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV 105
           Q TF ++   A  + KG F  +RP KF + Y+SP    ++ DGS I +++  L+  +V
Sbjct: 57  QQTFQKDGKPAEELQKGTFSFSRPGKFVWTYTSPYPQKMVCDGSRIYIWDEDLNQVTV 114


>gi|257455926|ref|ZP_05621143.1| putative membrane protein [Enhydrobacter aerosaccus SK60]
 gi|257446672|gb|EEV21698.1| putative membrane protein [Enhydrobacter aerosaccus SK60]
          Length = 245

 Score = 38.1 bits (87), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 5/86 (5%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKG 64
           LYK ++G+V++F  SAI+ F  A  +T +Q +K+  + FL+I    G  L   +G    G
Sbjct: 95  LYKPIVGMVLIF--SAIYSFIFAKKLTSEQPLKQVSKWFLAI---VGAVLGLLSGLTGVG 149

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDG 90
                 P   + +++SP  V+ ++ G
Sbjct: 150 GGVFLSPILLFNRWASPKVVAGVASG 175


>gi|163739849|ref|ZP_02147256.1| outer membrane lipoprotein carrier protein LolA, putative
           [Phaeobacter gallaeciensis BS107]
 gi|161386883|gb|EDQ11245.1| outer membrane lipoprotein carrier protein LolA, putative
           [Phaeobacter gallaeciensis BS107]
          Length = 195

 Score = 38.1 bits (87), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 66/164 (40%), Gaps = 5/164 (3%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           S+ +  ++   I T    F Q  D G +  G+ +M RP +  F+Y  P+   +++    +
Sbjct: 24  SLNEVSQYLNGISTATAPFSQINDDGSLSTGKLYMHRPGRMRFEYDPPNKGVVVAGAGAV 83

Query: 94  AVYNAKLD-TWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG---N 149
            + + K +     YPL+    S+I + N  + + ++    S +   TI    D       
Sbjct: 84  LIQDPKSNQPPETYPLKRTPLSLILARNVDLGRANMVVGHSFDGTSTIIRAQDPKNPEYG 143

Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
            I + F      L  W I D S   + + +   K    L  K+F
Sbjct: 144 SIEMMFTGDPVELRKWVIHDGSGGRTTVILGGLKTGVKLPSKLF 187


>gi|262369372|ref|ZP_06062700.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           johnsonii SH046]
 gi|262315440|gb|EEY96479.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           johnsonii SH046]
          Length = 232

 Score = 38.1 bits (87), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 53/116 (45%), Gaps = 14/116 (12%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           S K   +  LS Q M  TF         KG   + RP KFY++ +SP+  ++++ G  + 
Sbjct: 65  SSKAPKKQGLSAQHMNQTF---------KGVMKVERPGKFYWETTSPAKQTIVTSGKTVW 115

Query: 95  VYNAKLDTWSVYPLRYMAF---SVIFSNNQHVIQESIQRVESNNS--FITIFFKDD 145
           +Y+  L       L        +++ S N   I++S +  + N S  + T++ K D
Sbjct: 116 IYDPDLQQAVRQTLDEQVANTPALLLSGNTEQIRKSYRITQPNQSKTYYTLYPKSD 171


>gi|259417374|ref|ZP_05741293.1| outer membrane lipoprotein carrier protein LolA [Silicibacter sp.
           TrichCH4B]
 gi|259346280|gb|EEW58094.1| outer membrane lipoprotein carrier protein LolA [Silicibacter sp.
           TrichCH4B]
          Length = 198

 Score = 38.1 bits (87), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 45  SIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD-T 102
           S  T Q  F Q  D G +  G+ ++ RP K  F+Y++   + L   G+ +A+ + K +  
Sbjct: 37  SFATAQADFTQVNDDGSLSTGQLYLRRPGKVRFEYANNGGLVLAEAGT-VAIMDPKSNQP 95

Query: 103 WSVYPLRYMAFSVIFSNN 120
              YPL     S+I + N
Sbjct: 96  PETYPLSRTPLSIILARN 113


>gi|260557289|ref|ZP_05829505.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii ATCC 19606]
 gi|260409395|gb|EEX02697.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii ATCC 19606]
          Length = 231

 Score = 38.1 bits (87), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 9/71 (12%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISD 89
           ITK  +   A +  LS Q M  TF         KG   + RP KFY++  SPS  ++++ 
Sbjct: 59  ITKANTKTVAQKKGLSAQHMNQTF---------KGSMKVERPGKFYWETVSPSKQTIVTS 109

Query: 90  GSNIAVYNAKL 100
           G  + +Y+  L
Sbjct: 110 GKTVWIYDPDL 120


>gi|303257769|ref|ZP_07343781.1| outer membrane lipoprotein carrier protein LolA [Burkholderiales
           bacterium 1_1_47]
 gi|302859739|gb|EFL82818.1| outer membrane lipoprotein carrier protein LolA [Burkholderiales
           bacterium 1_1_47]
          Length = 211

 Score = 38.1 bits (87), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 50  QGTFLQED--AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV 105
           Q TF ++   A  + KG F  +RP KF + Y+SP    ++ DGS I +++  L+  +V
Sbjct: 47  QQTFQKDGKPAEELQKGTFSFSRPGKFVWTYTSPYPQKMVCDGSRIYIWDEDLNQVTV 104


>gi|53804159|ref|YP_114221.1| outer membrane lipoprotein carrier protein LolA [Methylococcus
           capsulatus str. Bath]
 gi|81681833|sp|Q607H7|LOLA_METCA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|53757920|gb|AAU92211.1| outer membrane lipoprotein carrier protein LolA [Methylococcus
           capsulatus str. Bath]
          Length = 208

 Score = 37.7 bits (86), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 77/171 (45%), Gaps = 20/171 (11%)

Query: 40  IEHFL-SIQTMQGTFLQ---EDAGYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSN 92
           ++ FL S +T+Q  F Q   +++G   +   G F++ RP KF + Y+ P    ++S G  
Sbjct: 29  LKSFLDSARTLQADFTQVRLDESGRPRQESGGSFYLQRPGKFRWDYTKPYRQQIVSSGGK 88

Query: 93  IAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESI----QRVESNNSFITIFFKDDF 146
           +  Y+  L+  +   L     S   +  + +  ++++     Q  E    +I +  K + 
Sbjct: 89  VWFYDVDLEQVTAKRLGQAVGSTPALLLSGEMALEDNFTIEDQGTEEGMYWIKLVPKSEE 148

Query: 147 MG---NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
            G    +I +  D+L+      ++ D+  + + I     +    LDPK+F+
Sbjct: 149 GGFRYVLIGLEGDKLA----GMELSDNFGQLTRIYFANLRTGITLDPKLFQ 195


>gi|292493396|ref|YP_003528835.1| outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           halophilus Nc4]
 gi|291581991|gb|ADE16448.1| outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           halophilus Nc4]
          Length = 195

 Score = 37.7 bits (86), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%)

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV 105
           +G FF+ RP KF + Y  P + ++++DG  I  Y+  L+  +V
Sbjct: 44  RGIFFLQRPGKFRWDYHEPFTQAIVADGERIWFYDPDLEQVTV 86


>gi|319760517|ref|YP_004124455.1| outer membrane lipocarrier protein LolA [Candidatus Blochmannia
           vafer str. BVAF]
 gi|318039231|gb|ADV33781.1| outer membrane lipocarrier protein LolA [Candidatus Blochmannia
           vafer str. BVAF]
          Length = 216

 Score = 37.7 bits (86), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 56  EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA--- 112
           E+   + +GE ++ RP+ F + ++ P    L+SDG  +  Y  KL     Y L+      
Sbjct: 61  EENIEIARGELWVKRPNLFRWHFTDPEEFVLVSDGQTVWFYVPKLKQVVAYCLKNQIAGN 120

Query: 113 --FSVIFSNNQHVIQESI 128
               ++FS+N  V Q  I
Sbjct: 121 IFLELLFSSNLFVYQNYI 138


>gi|319778383|ref|YP_004129296.1| Outer membrane lipoprotein carrier protein LolA [Taylorella
           equigenitalis MCE9]
 gi|317108407|gb|ADU91153.1| Outer membrane lipoprotein carrier protein LolA [Taylorella
           equigenitalis MCE9]
          Length = 230

 Score = 37.7 bits (86), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 76/182 (41%), Gaps = 24/182 (13%)

Query: 35  SVKKAIEHFLS-IQTMQGTFLQEDA--GY------------VMKGEFFMARPSKFYFKYS 79
           S +  +++F++ +Q+  GTF Q     G+            + KGEF   RP KF +   
Sbjct: 40  SARSQLKNFINNVQSASGTFEQSQVVLGWGAAEGQTLNTSDLQKGEFVFERPGKFAWIVK 99

Query: 80  SPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSVIFSNNQHVIQESIQRVESNN 135
            P    ++SDGS +  Y+  L   +   ++        S++F N++      ++ +    
Sbjct: 100 EPLEQQIVSDGSVLLQYDPDLLQVTERDVKKAIGTSPASILFGNSKIETSFKLENLPEKE 159

Query: 136 SFITIFFKDDFMG-NMISVTF-DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
            +I    K    G   I + F D +   LL   IMDS  + + IK    KE   L    F
Sbjct: 160 GWIRARPKQSDSGMKYIDIHFIDGMPTELL---IMDSFDKTTSIKFTSIKEGNPLGASAF 216

Query: 194 EI 195
           ++
Sbjct: 217 KL 218


>gi|260425883|ref|ZP_05779862.1| outer membrane lipoprotein carrier protein LolA [Citreicella sp.
           SE45]
 gi|260420375|gb|EEX13626.1| outer membrane lipoprotein carrier protein LolA [Citreicella sp.
           SE45]
          Length = 193

 Score = 37.7 bits (86), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 59/148 (39%), Gaps = 5/148 (3%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           S+ +  ++  SIQ+ +  F Q +  G +  G   + RP K  F+Y+ P    +++    +
Sbjct: 25  SLNQISQYLNSIQSAKSPFTQINGDGTISTGTISIKRPGKVRFEYNPPEQALVLAWSGAV 84

Query: 94  AVYNAKLDTW-SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG---N 149
            V++ K+      YPL     S+I   N ++ Q  +    S +   T     D       
Sbjct: 85  YVFDKKVRGQPETYPLSQTPLSIILERNVNLAQRGMVTGHSYDGTATTVTAQDPRHPEYG 144

Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSII 177
            I + F      L  W I D +   + +
Sbjct: 145 SIQMKFTGNPVELRQWIIRDGNGNTTTV 172


>gi|152997261|ref|YP_001342096.1| outer membrane lipoprotein carrier protein LolA [Marinomonas sp.
           MWYL1]
 gi|150838185|gb|ABR72161.1| outer membrane lipoprotein carrier protein LolA [Marinomonas sp.
           MWYL1]
          Length = 215

 Score = 37.7 bits (86), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 9/104 (8%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSI-QTMQGTFLQ---EDAG---YVMKG 64
           +V +  ++ +  F  A     D +   +IE  L + + ++G F Q   ++ G    V +G
Sbjct: 12  LVTMAMFTIVTVFQTAMVQAADAT--SSIESLLELNRNIEGEFRQVTYDEKGKQLQVSEG 69

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL 108
            F +A+P++F +   +P +  +ISDG  I V++  L+  +  PL
Sbjct: 70  VFLLAKPNQFVWDSVTPFAQRIISDGKYITVWDVDLEQATKKPL 113


>gi|297538758|ref|YP_003674527.1| outer membrane lipoprotein carrier protein LolA [Methylotenera sp.
           301]
 gi|297258105|gb|ADI29950.1| outer membrane lipoprotein carrier protein LolA [Methylotenera sp.
           301]
          Length = 205

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query: 46  IQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV 105
           +   QG  +QE     + GE  + RP+KF + Y  P    +ISDG  + +Y+ +L   SV
Sbjct: 45  VTDKQGQKIQE-----VYGEMQLKRPNKFRWDYHKPFEQQIISDGKQVWLYDTELAQVSV 99

Query: 106 YPL 108
             L
Sbjct: 100 REL 102


>gi|187923040|ref|YP_001894682.1| outer-membrane lipoprotein carrier protein [Burkholderia
           phytofirmans PsJN]
 gi|187714234|gb|ACD15458.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           phytofirmans PsJN]
          Length = 244

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 2/75 (2%)

Query: 36  VKKAIEHFLSIQTMQGTFLQEDAGYVM--KGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           V++ +      Q   GT   + AG      G F  ARP KF ++Y  P +  L +DG  +
Sbjct: 67  VQQEVRAPSKAQGASGTLSTQGAGKTGTSSGTFTFARPGKFIWQYEKPYAQLLQADGDKL 126

Query: 94  AVYNAKLDTWSVYPL 108
            VY+  L+  +V  L
Sbjct: 127 YVYDKDLNQVTVRSL 141


>gi|325294971|ref|YP_004281485.1| outer membrane lipoprotein carrier protein LolA [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065419|gb|ADY73426.1| outer membrane lipoprotein carrier protein LolA [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 206

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 93/206 (45%), Gaps = 36/206 (17%)

Query: 11  GVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-------DAGYVMK 63
            +V+ FF+ A        P   D  +   +E   SI+T++  F QE       D   +  
Sbjct: 7   SLVLTFFFVA--------PAYGDGKLDSFLEKLKSIKTLKIVFSQETKLPVAGDTVDLYG 58

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDG--------SNIAVYNAKLDTWS-VYPLRYMAFS 114
           G  +  +PSKF ++Y+  S + L+S+G        S+      +LDT S ++PL    F 
Sbjct: 59  GVIYYEKPSKFRWEYTKGSDIYLVSNGEYLETVFPSDNQCQITELDTKSELFPL----FQ 114

Query: 115 VIFSNNQHVIQE--SIQRVESNNSFITIFFKDDFMGNM---ISVTFDRLSYRLLNWKIMD 169
           ++  NN    ++   I ++E + +F T+  K  +  ++   I +  D+    L  +K + 
Sbjct: 115 IL--NNPENFKKLFKIVKIEESRNFETVELKPTYENSIFEKIILLIDK-DCNLKAFKTVQ 171

Query: 170 SSRRYSIIKILKYKENTVLDPKVFEI 195
             + ++   I  +KEN  L   +F+I
Sbjct: 172 IDKTFATYVIKSWKENVKLSENLFKI 197


>gi|307130788|ref|YP_003882804.1| chaperone for lipoproteins [Dickeya dadantii 3937]
 gi|306528317|gb|ADM98247.1| chaperone for lipoproteins [Dickeya dadantii 3937]
          Length = 204

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 5/47 (10%)

Query: 51 GTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
          G  +QE AG     E ++ RP+ F +K +SP   +L+SDG  +  YN
Sbjct: 51 GAAVQEGAG-----ELWVKRPNLFNWKTTSPDESTLVSDGKTLWFYN 92


>gi|226951586|ref|ZP_03822050.1| outer-membrane lipoprotein carrier protein [Acinetobacter sp. ATCC
           27244]
 gi|294651245|ref|ZP_06728573.1| outer-membrane lipoprotein carrier [Acinetobacter haemolyticus ATCC
           19194]
 gi|226837667|gb|EEH70050.1| outer-membrane lipoprotein carrier protein [Acinetobacter sp. ATCC
           27244]
 gi|292822898|gb|EFF81773.1| outer-membrane lipoprotein carrier [Acinetobacter haemolyticus ATCC
           19194]
          Length = 231

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 9/70 (12%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           TK  + K A +  L+ Q M  TF         KG   + RP KFY++ +SP+  ++++ G
Sbjct: 60  TKVSNNKAAPKRGLTAQHMNQTF---------KGVMKVERPGKFYWEITSPAKQTIVTSG 110

Query: 91  SNIAVYNAKL 100
             + +Y+  L
Sbjct: 111 KTVWIYDPDL 120


>gi|289549309|ref|YP_003474297.1| outer membrane lipoprotein carrier protein LolA [Thermocrinis albus
           DSM 14484]
 gi|289182926|gb|ADC90170.1| outer membrane lipoprotein carrier protein LolA [Thermocrinis albus
           DSM 14484]
          Length = 201

 Score = 37.4 bits (85), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 6/64 (9%)

Query: 45  SIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNA 98
            I+T++ +F+Q+          V KG F+  +  KF  +Y  P  + ++SDG  I +Y+ 
Sbjct: 28  EIRTLRASFIQKVQYSWYPKPEVSKGFFYAQKGGKFRIEYEQPQRMLIVSDGKRILIYDP 87

Query: 99  KLDT 102
           + +T
Sbjct: 88  EENT 91


>gi|300115267|ref|YP_003761842.1| outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           watsonii C-113]
 gi|299541204|gb|ADJ29521.1| outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           watsonii C-113]
          Length = 219

 Score = 37.0 bits (84), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%)

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL 100
           +G FF+ RP KF + Y  P S ++++DG ++  Y+  L
Sbjct: 68  RGVFFLQRPGKFRWDYHKPFSQTIVADGEHVWFYDPDL 105


>gi|238763312|ref|ZP_04624276.1| Outer-membrane lipoprotein carrier protein [Yersinia kristensenii
           ATCC 33638]
 gi|238698411|gb|EEP91164.1| Outer-membrane lipoprotein carrier protein [Yersinia kristensenii
           ATCC 33638]
          Length = 213

 Score = 37.0 bits (84), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 9/79 (11%)

Query: 46  IQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD---- 101
           + + +GT +QE      +GE ++ RP+ F +  +SP    LISDG  +  YN  ++    
Sbjct: 55  VTSSEGTAIQEG-----EGELWVKRPNLFNWHMTSPDESVLISDGETLWFYNPFVEQATA 109

Query: 102 TWSVYPLRYMAFSVIFSNN 120
           TW         F +I  NN
Sbjct: 110 TWLKNATGNTPFMLITRNN 128


>gi|99079902|ref|YP_612056.1| outer membrane lipoprotein carrier protein LolA [Ruegeria sp.
           TM1040]
 gi|99036182|gb|ABF62794.1| outer membrane lipoprotein carrier protein LolA [Ruegeria sp.
           TM1040]
          Length = 198

 Score = 36.6 bits (83), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 45  SIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD-T 102
           S  T +  F Q  D G +  G  ++ RP K  F+Y+  + + L   G+ +A+ + K +  
Sbjct: 37  SFATAKADFTQVNDDGSLSTGTLYLRRPGKVRFEYADNAGLVLAEAGT-VAIMDPKSNQP 95

Query: 103 WSVYPLRYMAFSVIFSNNQHVIQESI 128
              YPL     S+I + N ++ Q ++
Sbjct: 96  PETYPLSRTPLSIILARNVNLAQANM 121


>gi|123441838|ref|YP_001005821.1| outer-membrane lipoprotein carrier protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|166230504|sp|A1JMF6|LOLA_YERE8 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|122088799|emb|CAL11605.1| putative outer-membrane lipoproteins carrier protein [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 203

 Score = 36.6 bits (83), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 9/79 (11%)

Query: 46  IQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD---- 101
           + + +GT +QE      +GE ++ RP+ F +  +SP    LISDG  +  YN  ++    
Sbjct: 45  VTSSEGTAVQEG-----EGELWVKRPNLFNWHMTSPDESVLISDGETLWFYNPFVEQATA 99

Query: 102 TWSVYPLRYMAFSVIFSNN 120
           TW         F +I  NN
Sbjct: 100 TWLKNATGNTPFMLITRNN 118


>gi|212635391|ref|YP_002311916.1| outer membrane lipoprotein carrier protein LolA [Shewanella
          piezotolerans WP3]
 gi|226737656|sp|B8CP85|LOLA_SHEPW RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
          Precursor
 gi|212556875|gb|ACJ29329.1| Outer membrane lipoprotein carrier protein LolA [Shewanella
          piezotolerans WP3]
          Length = 208

 Score = 36.6 bits (83), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 26/35 (74%)

Query: 63 KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
          +G F +A+P++FY+  ++P    +++DG+++ +YN
Sbjct: 58 EGVFALAQPNQFYWHLTAPDESLIVADGTDVWIYN 92


>gi|328675455|gb|AEB28130.1| Outer membrane lipoprotein carrier protein LolA [Francisella cf.
           novicida 3523]
          Length = 205

 Score = 36.6 bits (83), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 57/126 (45%), Gaps = 10/126 (7%)

Query: 40  IEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           IE   +I +M   F Q+            KG   + +P  F +  +SP++  ++S+G+N+
Sbjct: 26  IEKIKNIHSMTANFNQKLIDGQTSNNLNSKGNMSLKKPQYFKWITTSPNNQVIVSNGTNL 85

Query: 94  AVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGN 149
            +Y+  LD   +      +    + ++ S N + I +     E NN+   +  K+D M +
Sbjct: 86  WIYDGDLDQLIIKKVSNDIAQFPYLILLSRNTNNINKLFTVTEQNNNSYILKPKNDQMID 145

Query: 150 MISVTF 155
            I + F
Sbjct: 146 SIKIKF 151


>gi|258546041|ref|ZP_05706275.1| outer membrane lipoprotein carrier protein LolA [Cardiobacterium
           hominis ATCC 15826]
 gi|258518698|gb|EEV87557.1| outer membrane lipoprotein carrier protein LolA [Cardiobacterium
           hominis ATCC 15826]
          Length = 286

 Score = 36.6 bits (83), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 5/72 (6%)

Query: 39  AIEHFL-SIQTMQGTFLQ----EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           A++ F+   + +Q  F Q    +      +G+ ++A+P KFY+ Y  P+   +IS+G  +
Sbjct: 100 ALDAFMRGTKDLQANFTQTIYNKRGTETSEGKMWVAKPGKFYWDYQRPNPQKIISNGKKV 159

Query: 94  AVYNAKLDTWSV 105
             Y+  L+  SV
Sbjct: 160 YHYDIDLEQISV 171


>gi|188025791|ref|ZP_02959829.2| hypothetical protein PROSTU_01728 [Providencia stuartii ATCC 25827]
 gi|188020512|gb|EDU58552.1| hypothetical protein PROSTU_01728 [Providencia stuartii ATCC 25827]
          Length = 228

 Score = 36.6 bits (83), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 5/52 (9%)

Query: 46  IQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
           + + +G  +QE  G     E ++ RP+ F +  +SP    L+SDG N+  YN
Sbjct: 67  VTSPEGDLVQEGVG-----ELWLQRPNLFNWNMTSPDESVLVSDGKNLWFYN 113


>gi|169794924|ref|YP_001712717.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii AYE]
 gi|213157671|ref|YP_002320469.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii AB0057]
 gi|215482470|ref|YP_002324656.1| outer membrane lipocarrier protein LolA [Acinetobacter baumannii
           AB307-0294]
 gi|239502307|ref|ZP_04661617.1| outer membrane lipocarrier protein LolA [Acinetobacter baumannii
           AB900]
 gi|301344902|ref|ZP_07225643.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii AB056]
 gi|301511073|ref|ZP_07236310.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii AB058]
 gi|301595148|ref|ZP_07240156.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii AB059]
 gi|332854212|ref|ZP_08435232.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii 6013150]
 gi|332866346|ref|ZP_08436951.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii 6013113]
 gi|332872561|ref|ZP_08440530.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii 6014059]
 gi|169147851|emb|CAM85714.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii AYE]
 gi|193078191|gb|ABO13142.2| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii ATCC 17978]
 gi|213056831|gb|ACJ41733.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii AB0057]
 gi|213986802|gb|ACJ57101.1| outer membrane lipocarrier protein LolA [Acinetobacter baumannii
           AB307-0294]
 gi|322509212|gb|ADX04666.1| Outer membrane lipoproteins carrier protein [Acinetobacter
           baumannii 1656-2]
 gi|323519241|gb|ADX93622.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii TCDC-AB0715]
 gi|332728137|gb|EGJ59525.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii 6013150]
 gi|332734694|gb|EGJ65798.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii 6013113]
 gi|332739247|gb|EGJ70105.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii 6014059]
          Length = 231

 Score = 36.6 bits (83), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 9/70 (12%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           TK  +   A +  LS Q M  TF         KG   + RP KFY++  SPS  ++++ G
Sbjct: 60  TKANTKTVAQKKGLSAQHMNQTF---------KGSMKVERPGKFYWETVSPSKQTIVTSG 110

Query: 91  SNIAVYNAKL 100
             + +Y+  L
Sbjct: 111 KTVWIYDPDL 120


>gi|262281250|ref|ZP_06059032.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           calcoaceticus RUH2202]
 gi|262257481|gb|EEY76217.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           calcoaceticus RUH2202]
          Length = 231

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 9/70 (12%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           TK  +   A +  LS Q M  TF         KG   + RP KFY++  SPS  ++++ G
Sbjct: 60  TKANTKTVAQKKSLSAQHMNQTF---------KGSMKVERPGKFYWETVSPSKQTIVTSG 110

Query: 91  SNIAVYNAKL 100
             + +Y+  L
Sbjct: 111 KTVWIYDPDL 120


>gi|184159301|ref|YP_001847640.1| outer membrane lipoprotein-sorting protein [Acinetobacter baumannii
           ACICU]
 gi|183210895|gb|ACC58293.1| Outer membrane lipoprotein-sorting protein [Acinetobacter baumannii
           ACICU]
          Length = 229

 Score = 36.2 bits (82), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 9/70 (12%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           TK  +   A +  LS Q M  TF         KG   + RP KFY++  SPS  ++++ G
Sbjct: 58  TKANTKTVAQKKGLSAQHMNQTF---------KGSMKVERPGKFYWETVSPSKQTIVTSG 108

Query: 91  SNIAVYNAKL 100
             + +Y+  L
Sbjct: 109 KTVWIYDPDL 118


>gi|311694709|gb|ADP97582.1| outer-membrane lipoprotein carrier protein precursor [marine
           bacterium HP15]
          Length = 215

 Score = 36.2 bits (82), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%)

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL 108
           +G     RP  FY++ S+P S  ++SDG  + VY+  L+  +++ L
Sbjct: 64  RGSLKAKRPGLFYWETSAPLSQFIVSDGETVEVYDPDLEQVTIHNL 109


>gi|255019844|ref|ZP_05291920.1| Outer membrane lipoprotein carrier protein LolA [Acidithiobacillus
           caldus ATCC 51756]
 gi|254970773|gb|EET28259.1| Outer membrane lipoprotein carrier protein LolA [Acidithiobacillus
           caldus ATCC 51756]
          Length = 228

 Score = 36.2 bits (82), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 6/72 (8%)

Query: 43  FLSIQTMQGTFLQEDA---GYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY 96
           F    T+   F QE A   G ++K   G  +++RP KF + Y+  +   ++S+G  + +Y
Sbjct: 51  FQDTHTVTADFSQEIANAQGEIIKRASGRLWVSRPGKFRWDYAGANGQVIVSNGERVWLY 110

Query: 97  NAKLDTWSVYPL 108
              L   +V PL
Sbjct: 111 EPALQQVTVQPL 122


>gi|126642760|ref|YP_001085744.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii ATCC 17978]
          Length = 210

 Score = 36.2 bits (82), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 9/71 (12%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISD 89
            TK  +   A +  LS Q M  TF         KG   + RP KFY++  SPS  ++++ 
Sbjct: 38  TTKANTKTVAQKKGLSAQHMNQTF---------KGSMKVERPGKFYWETVSPSKQTIVTS 88

Query: 90  GSNIAVYNAKL 100
           G  + +Y+  L
Sbjct: 89  GKTVWIYDPDL 99


>gi|294085376|ref|YP_003552136.1| outer membrane lipoprotein carrier protein LolA [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664951|gb|ADE40052.1| outer membrane lipoprotein carrier protein LolA [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 195

 Score = 36.2 bits (82), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 53/132 (40%), Gaps = 4/132 (3%)

Query: 43  FLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD 101
           F  + TMQ  F Q    G   +G  ++ RP +   +Y    ++ LI+    + V   K  
Sbjct: 34  FADLTTMQADFTQISSDGSAAEGTLYLRRPHRMKIEYDGDDALVLITTPVWLHVDQPKQK 93

Query: 102 TWSVYPLRYMAFSVIFSNNQHVIQESIQ---RVESNNSFITIFFKDDFMGNMISVTFDRL 158
             + YP+   A S+I      +  +  Q   RV    + I +  +       +++ F   
Sbjct: 94  RVTSYPISETALSLILKEKVVLRADDFQTSARVADGIATIYLSKESGEAAGDLALEFSLQ 153

Query: 159 SYRLLNWKIMDS 170
            ++L  W + DS
Sbjct: 154 PFQLRKWTVRDS 165


>gi|318606282|emb|CBY27780.1| outer membrane lipoprotein carrier protein LolA [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 203

 Score = 36.2 bits (82), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 9/79 (11%)

Query: 46  IQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD---- 101
           + + +GT +QE      +GE ++ RP+ F +  +SP    LISDG  +  YN  ++    
Sbjct: 45  VTSSEGTAVQEG-----EGELWVKRPNLFNWHMTSPDESILISDGETLWFYNPFVEQATA 99

Query: 102 TWSVYPLRYMAFSVIFSNN 120
           TW         F +I  NN
Sbjct: 100 TWLKNATGNTPFMLITRNN 118


>gi|294341020|emb|CAZ89415.1| putative Outer-membrane lipoprotein carrier protein precursor lolA
           [Thiomonas sp. 3As]
          Length = 221

 Score = 36.2 bits (82), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%)

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL 108
           G+F   RP +F + Y+ P +  ++SDG  +  Y+  LD  ++ P+
Sbjct: 70  GQFAFERPDRFRWDYTKPYAQVIVSDGKQLWTYDHDLDQVTITPV 114


>gi|239814293|ref|YP_002943203.1| outer membrane lipoprotein carrier protein LolA [Variovorax
           paradoxus S110]
 gi|239800870|gb|ACS17937.1| outer membrane lipoprotein carrier protein LolA [Variovorax
           paradoxus S110]
          Length = 210

 Score = 36.2 bits (82), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD 101
           G F   RP KF F Y  P + S+++DG  + +Y+A L+
Sbjct: 60  GTFEFQRPGKFKFDYQKPFAQSIVADGKTLWLYDADLN 97


>gi|296162239|ref|ZP_06845034.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           Ch1-1]
 gi|295887506|gb|EFG67329.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           Ch1-1]
          Length = 244

 Score = 36.2 bits (82), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 2/75 (2%)

Query: 36  VKKAIEHFLSIQTMQGTFLQEDAGYVM--KGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           V++ +      Q   GT     AG      G F  ARP KF ++Y  P +  L +DG  +
Sbjct: 67  VQQEVRAPSKAQGASGTLSTTGAGKTGTSSGTFTFARPGKFIWQYEKPYAQLLQADGDKL 126

Query: 94  AVYNAKLDTWSVYPL 108
            VY+  L+  +V  L
Sbjct: 127 FVYDKDLNQVTVRSL 141


>gi|88798709|ref|ZP_01114292.1| outer-membrane lipoprotein carrier protein precursor [Reinekea sp.
           MED297]
 gi|88778472|gb|EAR09664.1| outer-membrane lipoprotein carrier protein precursor [Reinekea sp.
           MED297]
          Length = 209

 Score = 36.2 bits (82), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 45/99 (45%), Gaps = 8/99 (8%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED------AGYVM 62
           +IG  I  F  +     A+Y    DQ+    IE   +++T+   F Q           V 
Sbjct: 1   MIGKKISVFAISFMVMAASY--ADDQARAALIEQLEALETLSADFEQRTYQETSPRADVS 58

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD 101
            G F +++P++F++    P    +I+DG  + VY+  L+
Sbjct: 59  SGTFQLSKPNRFHWHVQEPFEQRVIADGELLWVYDPDLE 97


>gi|91782390|ref|YP_557596.1| outer-membrane lipoprotein carrier protein [Burkholderia xenovorans
           LB400]
 gi|91686344|gb|ABE29544.1| Putative outer membrane lipoprotein carrier protein [Burkholderia
           xenovorans LB400]
          Length = 244

 Score = 35.8 bits (81), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 50/121 (41%), Gaps = 13/121 (10%)

Query: 1   MAFLLYKSV----IGVVILFFYSA-------IFPFNAAYPITKDQSVKKAIEHFLSIQTM 49
           +A  L +SV    IG  +LF   A       +  F A     +   V++ +      Q  
Sbjct: 21  LARTLVRSVGSVAIGASVLFASQAFASGTEQLKAFVAQVHSARGTFVQQEVRAPSKAQGA 80

Query: 50  QGTFLQEDAGYVM--KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP 107
            GT     AG      G F  ARP KF ++Y  P +  L +DG  + VY+  L+  +V  
Sbjct: 81  SGTLSTTGAGKTGTSSGTFTFARPGKFIWQYEKPYAQLLQADGDKLFVYDKDLNQVTVRS 140

Query: 108 L 108
           L
Sbjct: 141 L 141


>gi|160900794|ref|YP_001566376.1| outer membrane lipoprotein carrier protein LolA [Delftia
           acidovorans SPH-1]
 gi|160366378|gb|ABX37991.1| outer membrane lipoprotein carrier protein LolA [Delftia
           acidovorans SPH-1]
          Length = 211

 Score = 35.8 bits (81), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%)

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP 107
           G+F   RP KF F Y+ P   ++++DG  + +Y+A L+  +  P
Sbjct: 60  GQFEFQRPGKFRFVYTKPFEQTIVADGKTLWLYDADLNQVTQRP 103


>gi|319792074|ref|YP_004153714.1| outer membrane lipoprotein carrier protein lola [Variovorax
           paradoxus EPS]
 gi|315594537|gb|ADU35603.1| outer membrane lipoprotein carrier protein LolA [Variovorax
           paradoxus EPS]
          Length = 210

 Score = 35.8 bits (81), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD 101
           G F   RP KF F Y  P + S+++DG  + +Y+A L+
Sbjct: 60  GTFEFQRPGKFKFDYRKPFAQSIVADGKTLWLYDADLN 97


>gi|295675836|ref|YP_003604360.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           CCGE1002]
 gi|295435679|gb|ADG14849.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           CCGE1002]
          Length = 243

 Score = 35.8 bits (81), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%)

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL 108
           G F  ARP KF ++Y  P S  L +DG  + VY+  L+  +V  L
Sbjct: 96  GTFMFARPGKFIWQYEKPYSQLLQADGDKLFVYDKDLNQVTVRAL 140


>gi|296136851|ref|YP_003644093.1| outer membrane lipoprotein carrier protein LolA [Thiomonas
           intermedia K12]
 gi|295796973|gb|ADG31763.1| outer membrane lipoprotein carrier protein LolA [Thiomonas
           intermedia K12]
          Length = 220

 Score = 35.8 bits (81), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%)

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL 108
           G+F   RP +F + Y+ P    ++SDG  +  Y+  LD  ++ P+
Sbjct: 69  GQFAFERPDRFRWDYTKPYGQVIVSDGKQLWTYDHDLDQVTITPV 113


>gi|238789331|ref|ZP_04633118.1| Outer-membrane lipoprotein carrier protein [Yersinia frederiksenii
           ATCC 33641]
 gi|238722663|gb|EEQ14316.1| Outer-membrane lipoprotein carrier protein [Yersinia frederiksenii
           ATCC 33641]
          Length = 203

 Score = 35.8 bits (81), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 9/79 (11%)

Query: 46  IQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD---- 101
           + T  G  +QE      +GE ++ RP+ F +  +SP    LISDG  +  YN  ++    
Sbjct: 45  VTTADGAAVQEG-----EGELWVKRPNLFNWHMTSPDESVLISDGETLWFYNPFVEQATA 99

Query: 102 TWSVYPLRYMAFSVIFSNN 120
           TW         F +I  NN
Sbjct: 100 TWLKNATGNTPFMLITRNN 118


>gi|183220783|ref|YP_001838779.1| outer membrane lipoprotein carrier protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
 gi|189910883|ref|YP_001962438.1| outer membrane lipoprotein-sorting protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167775559|gb|ABZ93860.1| Outer membrane lipoprotein-sorting protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167779205|gb|ABZ97503.1| Outer-membrane lipoprotein carrier protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
          Length = 233

 Score = 35.4 bits (80), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 41/92 (44%), Gaps = 7/92 (7%)

Query: 36  VKKAIEHFLSIQTMQGTFL--QED--AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGS 91
           VKK  ++F  I +    FL   ED      M+G+ F  RP K  + +S P    ++SDG 
Sbjct: 33  VKKIKKNFSEINSYSADFLIKTEDNKKEKQMRGKCFYKRPGKIRYNFSEPDGDEIVSDGK 92

Query: 92  NIAVYNAKLDTWSVYPL---RYMAFSVIFSNN 120
            + ++  +L       L   R  +   IF+ N
Sbjct: 93  TLHIFIKRLGAVGKQDLTLDRKNSSGPIFTTN 124


>gi|169632600|ref|YP_001706336.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii SDF]
 gi|169151392|emb|CAP00117.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii]
          Length = 231

 Score = 35.4 bits (80), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 9/57 (15%)

Query: 44  LSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL 100
           LS Q M  TF         KG   + RP KFY++  SPS  ++++ G  + +Y+  L
Sbjct: 73  LSAQHMNQTF---------KGSMKVERPGKFYWETVSPSKQTIVTSGKTVWIYDPDL 120


>gi|241762157|ref|ZP_04760240.1| outer membrane lipoprotein carrier protein LolA [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241373407|gb|EER63007.1| outer membrane lipoprotein carrier protein LolA [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 222

 Score = 35.4 bits (80), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 29/152 (19%), Positives = 61/152 (40%), Gaps = 7/152 (4%)

Query: 41  EHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +H   + TM   F+Q D  G  + G   + +P    F+Y     + ++ DG  + + +  
Sbjct: 51  KHLREVSTMTAHFVQVDRNGQALDGSLTLKKPGLIRFQYQKDVPLLVVGDGKALVMIDYS 110

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQ-ESIQRVESNNSFITIFFKDDFMGNMISVTFDR- 157
           +   S +P+     S++   ++ +    ++   +  N  IT           I++ F R 
Sbjct: 111 VRQVSRWPIGDSPLSILIDPSKDIASYATLTSDDGKNIVITGHDPKHPDFGTIAINFQRD 170

Query: 158 ----LSYRLLNWKIMDSSRRYSIIKILKYKEN 185
                   L+ W ++D+    S I + + K N
Sbjct: 171 KSAPAQLMLMGWTVIDAQNNRSQIILSEQKFN 202


>gi|260753747|ref|YP_003226640.1| outer membrane lipoprotein carrier protein LolA [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|258553110|gb|ACV76056.1| outer membrane lipoprotein carrier protein LolA [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 222

 Score = 35.4 bits (80), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 29/152 (19%), Positives = 61/152 (40%), Gaps = 7/152 (4%)

Query: 41  EHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +H   + TM   F+Q D  G  + G   + +P    F+Y     + ++ DG  + + +  
Sbjct: 51  KHLREVATMTAHFVQVDRNGQALDGSLTLKKPGLIRFQYQKDVPLLVVGDGKALVMIDYS 110

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQ-ESIQRVESNNSFITIFFKDDFMGNMISVTFDR- 157
           +   S +P+     S++   ++ +    ++   +  N  IT           I++ F R 
Sbjct: 111 VRQVSRWPIGDSPLSILIDPSKDIASYATLTSDDGKNIVITGHDPKHPDFGTIAINFQRD 170

Query: 158 ----LSYRLLNWKIMDSSRRYSIIKILKYKEN 185
                   L+ W ++D+    S I + + K N
Sbjct: 171 KSAPAQLMLMGWTVIDAQNNRSQIILSEQKFN 202


>gi|283856532|ref|YP_163436.2| outer membrane lipoprotein carrier protein LolA [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|283775537|gb|AAV90325.2| outer membrane lipoprotein carrier protein LolA [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 222

 Score = 35.4 bits (80), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 29/152 (19%), Positives = 61/152 (40%), Gaps = 7/152 (4%)

Query: 41  EHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +H   + TM   F+Q D  G  + G   + +P    F+Y     + ++ DG  + + +  
Sbjct: 51  KHLREVATMTAHFVQVDRNGQALDGSLTLKKPGLIRFQYQKDVPLLVVGDGKALVMIDYS 110

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQ-ESIQRVESNNSFITIFFKDDFMGNMISVTFDR- 157
           +   S +P+     S++   ++ +    ++   +  N  IT           I++ F R 
Sbjct: 111 VRQVSRWPIGDSPLSILIDPSKDIASYAALTSDDGKNIVITGHDPKHPDFGTIAINFQRD 170

Query: 158 ----LSYRLLNWKIMDSSRRYSIIKILKYKEN 185
                   L+ W ++D+    S I + + K N
Sbjct: 171 KSAPAQLMLMGWTVIDAQNNRSQIILSEQKFN 202


>gi|293610925|ref|ZP_06693224.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826577|gb|EFF84943.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 231

 Score = 35.4 bits (80), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 9/70 (12%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           TK  +   A +  LS Q M  TF         KG   + RP KFY++  SP+  ++++ G
Sbjct: 60  TKANTKTVAQKKSLSAQHMNQTF---------KGSMKVERPGKFYWETVSPAKQTIVTSG 110

Query: 91  SNIAVYNAKL 100
             + +Y+  L
Sbjct: 111 KTVWIYDPDL 120


>gi|91793100|ref|YP_562751.1| outer membrane lipoprotein carrier protein LolA [Shewanella
          denitrificans OS217]
 gi|91715102|gb|ABE55028.1| outer membrane lipoprotein carrier protein LolA [Shewanella
          denitrificans OS217]
          Length = 218

 Score = 35.4 bits (80), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 63 KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
          +G F +A PSKFY+    P    +++DG+++ VYN
Sbjct: 63 QGVFALAYPSKFYWHLVEPDESLIVADGTDLWVYN 97


>gi|330860579|emb|CBX70878.1| outer-membrane lipoprotein carrier protein [Yersinia enterocolitica
           W22703]
          Length = 195

 Score = 35.4 bits (80), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 9/79 (11%)

Query: 46  IQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD---- 101
           + + +GT +QE      +GE ++ RP+ F +  ++P    LISDG  +  YN  ++    
Sbjct: 45  VTSSEGTAVQEG-----EGELWVKRPNLFNWHMTTPDESILISDGETLWFYNPFVEQATA 99

Query: 102 TWSVYPLRYMAFSVIFSNN 120
           TW         F +I  NN
Sbjct: 100 TWLKNATGNTPFMLITRNN 118


>gi|325123241|gb|ADY82764.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 215

 Score = 35.4 bits (80), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 9/70 (12%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           TK  +   A +  LS Q M  TF         KG   + RP KFY++  SP+  ++++ G
Sbjct: 44  TKANTKTVAQKKSLSAQHMNQTF---------KGSMKVERPGKFYWETVSPAKQTIVTSG 94

Query: 91  SNIAVYNAKL 100
             + +Y+  L
Sbjct: 95  KTVWIYDPDL 104


>gi|299768959|ref|YP_003730985.1| outer-membrane lipoproteins carrier protein [Acinetobacter sp. DR1]
 gi|298699047|gb|ADI89612.1| outer-membrane lipoproteins carrier protein [Acinetobacter sp. DR1]
          Length = 231

 Score = 35.4 bits (80), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 9/70 (12%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           TK  +   A +  LS Q M  TF         KG   + RP KFY++  SP+  ++++ G
Sbjct: 60  TKANTKTVAQKKSLSAQHMNQTF---------KGSMKVERPGKFYWETVSPAKQTIVTSG 110

Query: 91  SNIAVYNAKL 100
             + +Y+  L
Sbjct: 111 KTVWIYDPDL 120


>gi|332162219|ref|YP_004298796.1| outer-membrane lipoprotein carrier protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|325666449|gb|ADZ43093.1| outer-membrane lipoprotein carrier protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
          Length = 203

 Score = 35.0 bits (79), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 9/79 (11%)

Query: 46  IQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD---- 101
           + + +GT +QE      +GE ++ RP+ F +  ++P    LISDG  +  YN  ++    
Sbjct: 45  VTSSEGTAVQEG-----EGELWVKRPNLFNWHMTTPDESILISDGETLWFYNPFVEQATA 99

Query: 102 TWSVYPLRYMAFSVIFSNN 120
           TW         F +I  NN
Sbjct: 100 TWLKNATGNTPFMLITRNN 118


>gi|221068785|ref|ZP_03544890.1| outer membrane lipoprotein carrier protein LolA [Comamonas
           testosteroni KF-1]
 gi|220713808|gb|EED69176.1| outer membrane lipoprotein carrier protein LolA [Comamonas
           testosteroni KF-1]
          Length = 211

 Score = 35.0 bits (79), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 55  QEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD 101
           QE    V  G F   RP KF F Y+ P    +++DG  + +Y+A L+
Sbjct: 51  QEARTKVSSGSFEFQRPGKFRFNYTKPFEQLIVADGKTLWLYDADLN 97


>gi|163752529|ref|ZP_02159715.1| outer membrane lipoprotein carrier protein LolA [Shewanella
          benthica KT99]
 gi|161327584|gb|EDP98782.1| outer membrane lipoprotein carrier protein LolA [Shewanella
          benthica KT99]
          Length = 208

 Score = 35.0 bits (79), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 23/34 (67%)

Query: 64 GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
          G F +A P+KFY+  + P    +++DG+++ +YN
Sbjct: 59 GVFALAYPNKFYWHLTEPDESLIVADGTDVWIYN 92


>gi|299532558|ref|ZP_07045948.1| outer membrane lipoprotein carrier protein LolA [Comamonas
           testosteroni S44]
 gi|298719505|gb|EFI60472.1| outer membrane lipoprotein carrier protein LolA [Comamonas
           testosteroni S44]
          Length = 194

 Score = 35.0 bits (79), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 55  QEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD 101
           QE    V  G F   RP KF F Y+ P    +++DG  + +Y+A L+
Sbjct: 34  QEARTKVSSGSFEFQRPGKFRFNYTKPFEQLIVADGKTLWLYDADLN 80


>gi|255318824|ref|ZP_05360050.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           radioresistens SK82]
 gi|262378916|ref|ZP_06072073.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           radioresistens SH164]
 gi|255304080|gb|EET83271.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           radioresistens SK82]
 gi|262300201|gb|EEY88113.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           radioresistens SH164]
          Length = 231

 Score = 35.0 bits (79), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 9/61 (14%)

Query: 41  EHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL 100
           +  L+ Q M  TF         KG   + RP KF+++ SSPS  ++++ G  + +Y+  L
Sbjct: 70  QKGLTAQHMNQTF---------KGTMKVERPGKFFWETSSPSKQTIVTTGKTVWIYDPDL 120

Query: 101 D 101
            
Sbjct: 121 Q 121


>gi|329298238|ref|ZP_08255574.1| lipoprotein chaperone [Plautia stali symbiont]
          Length = 203

 Score = 35.0 bits (79), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 61/137 (44%), Gaps = 11/137 (8%)

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA----FSVIFS 118
           +GE ++ RPS F +  ++P    +ISDG N+  YN  ++  SV  L+       F +I  
Sbjct: 57  EGELWVKRPSLFNWHMTAPDESVIISDGKNLWFYNPFVEQASVSLLQNATSNTPFMLIAR 116

Query: 119 NNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNW--KIMDSSRRYSI 176
           N     Q+   + + +N  +T    D   GN+   T +  S   +N    I    +R S 
Sbjct: 117 NQPSDWQQYNIKQQGDNFELTPKSSD---GNLKQFTINVTSAGTINQFSAIEQDGQRSSY 173

Query: 177 IKILKYKENTVLDPKVF 193
              LK ++N  + P  F
Sbjct: 174 --QLKSQKNGAISPDKF 188


>gi|209520406|ref|ZP_03269168.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           H160]
 gi|209499143|gb|EDZ99236.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           H160]
          Length = 240

 Score = 35.0 bits (79), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%)

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL 108
           G F  ARP KF ++Y  P +  L +DG  + VY+  L+  +V  L
Sbjct: 93  GTFMFARPGKFIWQYEKPYAQLLQADGDKLYVYDKDLNQVTVRAL 137


>gi|264677022|ref|YP_003276928.1| outer membrane lipoprotein carrier protein LolA [Comamonas
           testosteroni CNB-2]
 gi|262207534|gb|ACY31632.1| outer membrane lipoprotein carrier protein LolA [Comamonas
           testosteroni CNB-2]
          Length = 211

 Score = 35.0 bits (79), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 55  QEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD 101
           QE    V  G F   RP KF F Y+ P    +++DG  + +Y+A L+
Sbjct: 51  QEARTKVSSGSFEFQRPGKFRFNYTKPFEQLIVADGKTLWLYDADLN 97


>gi|260548982|ref|ZP_05823204.1| outer-membrane lipoproteins carrier protein [Acinetobacter sp.
           RUH2624]
 gi|260408150|gb|EEX01621.1| outer-membrane lipoproteins carrier protein [Acinetobacter sp.
           RUH2624]
          Length = 231

 Score = 35.0 bits (79), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 9/70 (12%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           TK  +   A +  L  Q M  TF         KG   + RP KFY++  SPS  ++++ G
Sbjct: 60  TKANTKAVAQKKGLGAQHMNQTF---------KGSMKVERPGKFYWETVSPSKQTIVTSG 110

Query: 91  SNIAVYNAKL 100
             + +Y+  L
Sbjct: 111 KTVWIYDPDL 120


>gi|145299387|ref|YP_001142228.1| outer membrane lipoprotein carrier protein LolA [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|189028547|sp|A4SNK8|LOLA_AERS4 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|142852159|gb|ABO90480.1| outer membrane lipoprotein carrier protein LolA [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 202

 Score = 34.7 bits (78), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 65/139 (46%), Gaps = 8/139 (5%)

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSN 119
           G+  + RP++F +  +SP    +++DG ++ VY+  ++  +   L+       F +I  N
Sbjct: 57  GDLLVQRPNRFNWHTTSPDESLIVADGKDVWVYDPFVEQVTALKLKDAVLNTPFILIAGN 116

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
           +    +      E N   +T   KD+ + +   VTFDR +  +  + + ++  ++S   +
Sbjct: 117 DDKFWKHYDVTQEGNVYTVTSRNKDELIASF-RVTFDRQN-NISRFDVKEAQGQWSEFTL 174

Query: 180 LKYKENTVLDPK--VFEIP 196
             +    VL     VF+IP
Sbjct: 175 SSFNRKPVLKGNEFVFKIP 193


>gi|308272707|emb|CBX29311.1| hypothetical protein N47_J02920 [uncultured Desulfobacterium sp.]
          Length = 220

 Score = 34.7 bits (78), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 46/104 (44%), Gaps = 14/104 (13%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKK-----AIEHFLSIQTMQGTFLQEDA--- 58
           K++I  + + F    F F+A     K++S+K       +E   S+      F+Q      
Sbjct: 4   KTIILSLAIIFCLTCFAFDAQ---AKEESLKANQIMMKVEKKYSVPGFVAKFIQSSTLKA 60

Query: 59  ---GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
                V +G+ F+ RP    ++Y  P    +++DG N+ +Y  +
Sbjct: 61  MGIADVAEGKMFVKRPGMMRWEYEKPEKQIVVTDGENLWIYRPQ 104


>gi|152981724|ref|YP_001352845.1| outer-membrane lipoprotein carrier protein [Janthinobacterium sp.
           Marseille]
 gi|151281801|gb|ABR90211.1| outer membrane lipoproteins carrier protein [Janthinobacterium sp.
           Marseille]
          Length = 222

 Score = 34.7 bits (78), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 70/169 (41%), Gaps = 26/169 (15%)

Query: 39  AIEHF----LSIQTMQGTFLQE----DAGYVM-----KGEFFMARPSKFYFKYSSPSSVS 85
           A+E F     S Q+ +G F Q+    ++G         G F  ARP KF + Y  P    
Sbjct: 38  ALEQFKSFVASTQSARGEFTQQLVKIESGTSKVSNKSTGTFTFARPGKFIWVYQKPYEQL 97

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMAFS----VIFSNNQHVIQESIQRVESNNSFITIF 141
           L +DG  + +Y+  L+  ++  L     S    ++F +N      +++   + N    + 
Sbjct: 98  LQADGDKLYIYDKDLNQVTIKKLGDALGSSPAAILFGSNDLEKNFTLKEAGTKNGLEWL- 156

Query: 142 FKDDFMGNMISVTFDRLSYRLLNW-----KIMDSSRRYSIIKILKYKEN 185
              +        TFD +   L N      ++ DS  + S++   K+++N
Sbjct: 157 ---EATPKAKDTTFDHIGIGLRNGVPEAMELRDSFGQVSLLTFTKFEKN 202


>gi|298373209|ref|ZP_06983199.1| outer-membrane lipoprotein carrier protein [Bacteroidetes oral
          taxon 274 str. F0058]
 gi|298276113|gb|EFI17664.1| outer-membrane lipoprotein carrier protein [Bacteroidetes oral
          taxon 274 str. F0058]
          Length = 211

 Score = 34.7 bits (78), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 46 IQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
          +QT   T + + A  V KG  +   PS   ++Y+SPS  SLI DG
Sbjct: 53 VQTKTSTMVSQSA--VSKGNMYYRNPSMLIWEYTSPSKSSLIVDG 95


>gi|114562971|ref|YP_750484.1| outer membrane lipoprotein carrier protein LolA [Shewanella
          frigidimarina NCIMB 400]
 gi|123026351|sp|Q083B9|LOLA_SHEFN RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
          Precursor
 gi|114334264|gb|ABI71646.1| outer membrane lipoprotein carrier protein LolA [Shewanella
          frigidimarina NCIMB 400]
          Length = 214

 Score = 34.7 bits (78), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 6/59 (10%)

Query: 45 SIQTMQGTFLQEDAGYVMK------GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
          +I ++  TF Q+      K      G F +A P++FY+  + P    +++DG+N+ +YN
Sbjct: 35 NIDSLHATFSQQVTDINSKPIQTGSGVFALAYPNQFYWHLTQPDESLIVADGANLWIYN 93


>gi|326318087|ref|YP_004235759.1| outer membrane lipoprotein carrier protein LolA [Acidovorax avenae
           subsp. avenae ATCC 19860]
 gi|323374923|gb|ADX47192.1| outer membrane lipoprotein carrier protein LolA [Acidovorax avenae
           subsp. avenae ATCC 19860]
          Length = 211

 Score = 34.7 bits (78), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 25/38 (65%)

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD 101
           G F   RP +F F Y+ P + ++++DG ++ +Y+A L+
Sbjct: 61  GTFEFQRPGRFKFTYTKPFAQTIVADGKSLWLYDADLN 98


>gi|120612078|ref|YP_971756.1| outer membrane lipoprotein carrier protein LolA [Acidovorax
           citrulli AAC00-1]
 gi|120590542|gb|ABM33982.1| outer membrane lipoprotein carrier protein LolA [Acidovorax
           citrulli AAC00-1]
          Length = 211

 Score = 34.7 bits (78), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 25/38 (65%)

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD 101
           G F   RP +F F Y+ P + ++++DG ++ +Y+A L+
Sbjct: 61  GTFEFQRPGRFKFTYTKPFAQTIVADGKSLWLYDADLN 98


>gi|94309631|ref|YP_582841.1| outer-membrane lipoprotein carrier protein [Cupriavidus
           metallidurans CH34]
 gi|123260347|sp|Q1LQK4|LOLA_RALME RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|93353483|gb|ABF07572.1| Outer membrane lipoprotein carrier protein LolA precursor;
           chaperone for lipoproteins [Cupriavidus metallidurans
           CH34]
          Length = 214

 Score = 34.7 bits (78), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           SVK A   F + Q M+G            G F  +RP KF ++Y+ P    L +DG  + 
Sbjct: 39  SVKTARGEF-TQQQMKGKGADLKVASTSSGTFVFSRPGKFAWRYTKPYEQLLQADGQVLY 97

Query: 95  VYNAKLD 101
           +Y+  L+
Sbjct: 98  IYDKDLN 104


>gi|172038561|ref|YP_001805062.1| hypothetical protein cce_3648 [Cyanothece sp. ATCC 51142]
 gi|171700015|gb|ACB52996.1| hypothetical protein cce_3648 [Cyanothece sp. ATCC 51142]
          Length = 269

 Score = 34.7 bits (78), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 12/69 (17%)

Query: 114 SVIFSNNQHVIQESIQRVESNNS---FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
           +V+++N Q V+ E    VE+++S    + I   DD +           +YRL+    +DS
Sbjct: 159 NVLYTNGQPVLNEQKDSVETSDSKKVVVQILMNDDILNK---------NYRLVRLMTVDS 209

Query: 171 SRRYSIIKI 179
           S RY ++++
Sbjct: 210 STRYDVLQV 218


>gi|186475402|ref|YP_001856872.1| outer-membrane lipoprotein carrier protein [Burkholderia phymatum
           STM815]
 gi|184191861|gb|ACC69826.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           phymatum STM815]
          Length = 231

 Score = 34.7 bits (78), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL 108
           V  G F  ARP KF + Y  P +  L +DG  + VY+  L+  +V  L
Sbjct: 81  VSSGSFTFARPGKFIWAYEKPYAQLLQADGDKLYVYDKDLNQVTVRKL 128


>gi|124266313|ref|YP_001020317.1| outer membrane lipoprotein carrier protein LolA [Methylibium
           petroleiphilum PM1]
 gi|189028554|sp|A2SEU3|LOLA_METPP RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|124259088|gb|ABM94082.1| outer membrane lipoprotein carrier protein LolA [Methylibium
           petroleiphilum PM1]
          Length = 203

 Score = 34.3 bits (77), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%)

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL 108
           G F  +RP++F F Y+ P    ++SDG  + +++  L+  +V P+
Sbjct: 57  GSFEFSRPNRFRFAYTKPYEQLIVSDGQKVWLHDPDLNQVTVRPV 101


Searching..................................................done


Results from round 2




>gi|254780798|ref|YP_003065211.1| possible lolA type protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040475|gb|ACT57271.1| possible lolA type protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 204

 Score =  248 bits (634), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 204/204 (100%), Positives = 204/204 (100%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY 60
           MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY
Sbjct: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY 60

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
           VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN
Sbjct: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
           QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL
Sbjct: 121 QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180

Query: 181 KYKENTVLDPKVFEIPYDKIHNIN 204
           KYKENTVLDPKVFEIPYDKIHNIN
Sbjct: 181 KYKENTVLDPKVFEIPYDKIHNIN 204


>gi|237816359|ref|ZP_04595352.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|237788426|gb|EEP62641.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
          Length = 258

 Score =  244 bits (623), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 50  VAAVLGMGILGVGVAGAALAPVPVKAQGEDGGIAAAQQIADHFSSARTMTGEFVQFGPRG 109

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 110 EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 168

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 169 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 228

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 229 MIFNVRTGVRFTNDMFKIDYQRI 251


>gi|148559543|ref|YP_001259817.1| hypothetical protein BOV_1926 [Brucella ovis ATCC 25840]
 gi|148370800|gb|ABQ60779.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 258

 Score =  244 bits (622), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 50  VAAVLGMGILGVGVAGAALAPVPVKAQGADGCIAAAQQIADHFSSARTMTGEFVQFGPRG 109

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 110 EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 168

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 169 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITLMFDPKSYDLKQWTITDAQKLDTTV 228

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 229 MIFNVRTGVRFTNDMFKIDYQRI 251


>gi|161619920|ref|YP_001593807.1| outer membrane lipoprotein carrier protein LolA [Brucella canis
           ATCC 23365]
 gi|163844024|ref|YP_001628428.1| outer membrane lipoprotein carrier protein LolA [Brucella suis ATCC
           23445]
 gi|225853438|ref|YP_002733671.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis ATCC 23457]
 gi|254700640|ref|ZP_05162468.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           5 str. 513]
 gi|254705009|ref|ZP_05166837.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           3 str. 686]
 gi|254707473|ref|ZP_05169301.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis M163/99/10]
 gi|254708985|ref|ZP_05170796.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis B2/94]
 gi|254713586|ref|ZP_05175397.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M644/93/1]
 gi|254716060|ref|ZP_05177871.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M13/05/1]
 gi|256030512|ref|ZP_05444126.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis M292/94/1]
 gi|256045603|ref|ZP_05448483.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256059973|ref|ZP_05450157.1| outer membrane lipoprotein carrier protein LolA [Brucella neotomae
           5K33]
 gi|256112330|ref|ZP_05453251.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 3 str. Ether]
 gi|256158497|ref|ZP_05456395.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M490/95/1]
 gi|256253916|ref|ZP_05459452.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           B1/94]
 gi|256263082|ref|ZP_05465614.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 2 str. 63/9]
 gi|260562911|ref|ZP_05833397.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 1 str. 16M]
 gi|260567519|ref|ZP_05837989.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           4 str. 40]
 gi|294851236|ref|ZP_06791909.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. NVSL
           07-0026]
 gi|161336731|gb|ABX63036.1| outer membrane lipoprotein carrier protein LolA [Brucella canis
           ATCC 23365]
 gi|163674747|gb|ABY38858.1| outer membrane lipoprotein carrier protein LolA [Brucella suis ATCC
           23445]
 gi|225641803|gb|ACO01717.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis ATCC 23457]
 gi|260152927|gb|EEW88019.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 1 str. 16M]
 gi|260157037|gb|EEW92117.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           4 str. 40]
 gi|263092974|gb|EEZ17135.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 2 str. 63/9]
 gi|294819825|gb|EFG36824.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. NVSL
           07-0026]
          Length = 231

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 23  VAAVLGMGILGVGVAGAALAPVPVKAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRG 82

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 83  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 141

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 142 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 201

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 202 MIFNVRTGVRFTNDMFKIDYQRI 224


>gi|189025066|ref|YP_001935834.1| hypothetical protein BAbS19_I18780 [Brucella abortus S19]
 gi|254690140|ref|ZP_05153394.1| hypothetical protein Babob68_08221 [Brucella abortus bv. 6 str.
           870]
 gi|254696255|ref|ZP_05158083.1| hypothetical protein Babob28_00711 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731173|ref|ZP_05189751.1| hypothetical protein Babob42_08251 [Brucella abortus bv. 4 str.
           292]
 gi|256258394|ref|ZP_05463930.1| hypothetical protein Babob9C_13833 [Brucella abortus bv. 9 str.
           C68]
 gi|297247234|ref|ZP_06930952.1| hypothetical protein BAYG_00131 [Brucella abortus bv. 5 str. B3196]
 gi|189020638|gb|ACD73360.1| hypothetical protein BAbS19_I18780 [Brucella abortus S19]
 gi|297174403|gb|EFH33750.1| hypothetical protein BAYG_00131 [Brucella abortus bv. 5 str. B3196]
          Length = 231

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 23  VAAVLGMGILGVGVAGAALAPVPVKAQGEDGGIAAAQQIADHFSSARTMTGEFVQFGPRG 82

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 83  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 141

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 142 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 201

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 202 MIFNVRTGVRFTNDMFKIDYQRI 224


>gi|23502851|ref|NP_698978.1| hypothetical protein BR2003 [Brucella suis 1330]
 gi|256370403|ref|YP_003107914.1| outer membrane lipoprotein carrier protein LolA [Brucella microti
           CCM 4915]
 gi|23348877|gb|AAN30893.1| conserved hypothetical protein [Brucella suis 1330]
 gi|256000566|gb|ACU48965.1| outer membrane lipoprotein carrier protein LolA [Brucella microti
           CCM 4915]
          Length = 230

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 22  VAAVLGMGILGVGVAGAALAPVPVKAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRG 81

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 82  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 140

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 141 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 200

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 201 MIFNVRTGVRFTNDMFKIDYQRI 223


>gi|62290850|ref|YP_222643.1| hypothetical protein BruAb1_1978 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700762|ref|YP_415336.1| hypothetical protein BAB1_2003 [Brucella melitensis biovar Abortus
           2308]
 gi|260546114|ref|ZP_05821854.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           NCTC 8038]
 gi|62196982|gb|AAX75282.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616863|emb|CAJ11959.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
           2308]
 gi|260096221|gb|EEW80097.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           NCTC 8038]
          Length = 230

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 22  VAAVLGMGILGVGVAGAALAPVPVKAQGEDGGIAAAQQIADHFSSARTMTGEFVQFGPRG 81

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 82  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 140

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 141 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 200

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 201 MIFNVRTGVRFTNDMFKIDYQRI 223


>gi|254718051|ref|ZP_05179862.1| outer membrane lipoprotein carrier protein LolA [Brucella sp.
           83/13]
          Length = 231

 Score =  241 bits (616), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 23  VAAVLGMGILGVGVAGAALAPVPVMAQGADGGVAAAQQIADHFSSERTMTGEFVQFGPRG 82

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 83  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 141

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 142 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 201

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 202 MIFNVRTGVRFTNDMFKIDYQRI 224


>gi|261217825|ref|ZP_05932106.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M13/05/1]
 gi|261221053|ref|ZP_05935334.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           B1/94]
 gi|261314961|ref|ZP_05954158.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis M163/99/10]
 gi|261316481|ref|ZP_05955678.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis B2/94]
 gi|261321327|ref|ZP_05960524.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M644/93/1]
 gi|261323945|ref|ZP_05963142.1| outer membrane lipoprotein carrier protein LolA [Brucella neotomae
           5K33]
 gi|261751146|ref|ZP_05994855.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           5 str. 513]
 gi|261755708|ref|ZP_05999417.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           3 str. 686]
 gi|265987554|ref|ZP_06100111.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis M292/94/1]
 gi|265992026|ref|ZP_06104583.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265993763|ref|ZP_06106320.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 3 str. Ether]
 gi|265997014|ref|ZP_06109571.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M490/95/1]
 gi|260919637|gb|EEX86290.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           B1/94]
 gi|260922914|gb|EEX89482.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M13/05/1]
 gi|261294017|gb|EEX97513.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M644/93/1]
 gi|261295704|gb|EEX99200.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis B2/94]
 gi|261299925|gb|EEY03422.1| outer membrane lipoprotein carrier protein LolA [Brucella neotomae
           5K33]
 gi|261303987|gb|EEY07484.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis M163/99/10]
 gi|261740899|gb|EEY28825.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           5 str. 513]
 gi|261745461|gb|EEY33387.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           3 str. 686]
 gi|262551482|gb|EEZ07472.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M490/95/1]
 gi|262764744|gb|EEZ10665.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 3 str. Ether]
 gi|263003092|gb|EEZ15385.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|264659751|gb|EEZ30012.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis M292/94/1]
 gi|326410000|gb|ADZ67065.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis M28]
 gi|326539717|gb|ADZ87932.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis M5-90]
          Length = 225

 Score =  241 bits (616), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 17  VAAVLGMGILGVGVAGAALAPVPVKAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRG 76

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 77  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 135

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 136 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 195

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 196 MIFNVRTGVRFTNDMFKIDYQRI 218


>gi|260755676|ref|ZP_05868024.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 6 str. 870]
 gi|260758901|ref|ZP_05871249.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 4 str. 292]
 gi|260760625|ref|ZP_05872968.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260884703|ref|ZP_05896317.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 9 str. C68]
 gi|260669219|gb|EEX56159.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 4 str. 292]
 gi|260671057|gb|EEX57878.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260675784|gb|EEX62605.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 6 str. 870]
 gi|260874231|gb|EEX81300.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 9 str. C68]
          Length = 225

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 17  VAAVLGMGILGVGVAGAALAPVPVKAQGEDGGIAAAQQIADHFSSARTMTGEFVQFGPRG 76

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 77  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 135

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 136 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 195

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 196 MIFNVRTGVRFTNDMFKIDYQRI 218


>gi|225628197|ref|ZP_03786232.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225617022|gb|EEH14069.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
          Length = 258

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 50  VAAVLGMGILGVGVAGAALAPVPVKAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRG 109

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 110 EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 168

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 169 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDARKLDTTV 228

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 229 MIFNVRTGVRFTNDMFKIDYQRI 251


>gi|306842864|ref|ZP_07475502.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. BO2]
 gi|306286986|gb|EFM58501.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. BO2]
          Length = 223

 Score =  240 bits (614), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 15  VAAVLGMGILGVGVAGAALAPVPVMAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRG 74

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 75  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 133

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 134 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 193

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 194 MIFNVRTGVRFTNDMFKIDYQRI 216


>gi|265982998|ref|ZP_06095733.1| outer membrane lipoprotein carrier protein LolA [Brucella sp.
           83/13]
 gi|264661590|gb|EEZ31851.1| outer membrane lipoprotein carrier protein LolA [Brucella sp.
           83/13]
          Length = 225

 Score =  240 bits (614), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 17  VAAVLGMGILGVGVAGAALAPVPVMAQGADGGVAAAQQIADHFSSERTMTGEFVQFGPRG 76

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 77  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 135

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 136 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 195

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 196 MIFNVRTGVRFTNDMFKIDYQRI 218


>gi|306837612|ref|ZP_07470483.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. NF
           2653]
 gi|306407319|gb|EFM63527.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. NF
           2653]
          Length = 223

 Score =  240 bits (614), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 15  VAAVLGMGILGVGVAGAALAPVPVMAQGADGGVAAAQQIADHFSSERTMTGEFVQFGPRG 74

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 75  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 133

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 134 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 193

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 194 MIFNVRTGVRFTNDMFKIDYQRI 216


>gi|254694630|ref|ZP_05156458.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 3 str. Tulya]
          Length = 231

 Score =  240 bits (613), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 55/203 (27%), Positives = 95/203 (46%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P           + ++  +HF S +TM G F+Q    G
Sbjct: 23  VAAVLGMGILGVGVAGAALAPVPVKVQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRG 82

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 83  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 141

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 142 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 201

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 202 MIFNVRTGVRFTNDMFKIDYQRI 224


>gi|260169417|ref|ZP_05756228.1| outer membrane lipoprotein carrier protein LolA [Brucella sp.
           F5/99]
 gi|261758939|ref|ZP_06002648.1| outer membrane lipoprotein carrier protein LolA [Brucella sp.
           F5/99]
 gi|261738923|gb|EEY26919.1| outer membrane lipoprotein carrier protein LolA [Brucella sp.
           F5/99]
          Length = 231

 Score =  239 bits (611), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 23  VAAVLGMGILGVGVAGAALAPVPVKAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRG 82

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 83  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 141

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 142 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDARKLDTTV 201

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 202 MIFNVRTGVRFTNDMFKIDYQRI 224


>gi|261214951|ref|ZP_05929232.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 3 str. Tulya]
 gi|260916558|gb|EEX83419.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 3 str. Tulya]
          Length = 223

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 55/203 (27%), Positives = 95/203 (46%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++GV +     A  P           + ++  +HF S +TM G F+Q    G
Sbjct: 15  VAAVLGMGILGVGVAGAALAPVPVKVQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRG 74

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 75  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 133

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 134 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 193

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 194 MIFNVRTGVRFTNDMFKIDYQRI 216


>gi|325294130|ref|YP_004279994.1| outer-membrane lipoprotein carrier protein [Agrobacterium sp.
           H13-3]
 gi|325061983|gb|ADY65674.1| outer-membrane lipoprotein carrier protein [Agrobacterium sp.
           H13-3]
          Length = 224

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 60/202 (29%), Positives = 99/202 (49%), Gaps = 8/202 (3%)

Query: 11  GVVILFFYSAIF----PFNA-AYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKG 64
           GV+  F  +A+     P NA A       + +K   HF S++TM G F+Q    G    G
Sbjct: 23  GVLTAFSMAAVMAGLSPLNAFAQAAGNSATAQKIANHFSSVKTMMGEFVQFGPRGEQTGG 82

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
           +F++ RP K  F Y  PS + +ISDG N+ + N KL TW +YPL     S++ S+   + 
Sbjct: 83  KFYIERPGKLRFNYEDPSPMRVISDGKNVVIGNMKLKTWDLYPLSKTPLSLLLSDKIDLS 142

Query: 125 QESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
            + ++ V+  +   TI   D   F  + I++ FD  ++ L  W   D+  + + + I   
Sbjct: 143 NQKVRNVKEESDLTTIVLGDKSVFGDSTITLMFDPKTFDLRQWTTTDAQNKDTTVMIFNV 202

Query: 183 KENTVLDPKVFEIPYDKIHNIN 204
           +    LD +VF I Y+++    
Sbjct: 203 QTGVNLDERVFNINYEEVRKRG 224


>gi|306843438|ref|ZP_07476039.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. BO1]
 gi|306276129|gb|EFM57829.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. BO1]
          Length = 223

 Score =  237 bits (606), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 55/203 (27%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L   ++G+ +     A  P  A        + ++  +HF S +TM G F+Q    G
Sbjct: 15  VAAVLGVGILGIGVAGAALAPVPVMAQGADGGIATAQQIADHFSSARTMTGEFVQFGPRG 74

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 75  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLAD 133

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 134 RIDLGGGRLQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTV 193

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 194 MIFNVRTGVRFTNDMFKIDYQRI 216


>gi|255597485|ref|XP_002536785.1| conserved hypothetical protein [Ricinus communis]
 gi|223518556|gb|EEF25598.1| conserved hypothetical protein [Ricinus communis]
          Length = 222

 Score =  237 bits (606), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 64/203 (31%), Positives = 104/203 (51%), Gaps = 5/203 (2%)

Query: 4   LLYKSVIGVVILFFYSAIFPFN--AAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGY 60
           L  + ++G + L   SA  P N  A        + +   +HF S+ TMQG F+Q    G 
Sbjct: 13  LTRRHMLGAMALVAASAALPVNVFAQAAAGGSATAQAIADHFSSVGTMQGEFVQFGPRGE 72

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
              G+FF+ RP K  F Y  PS + +I+DG N+AV N KL TW++YPL     S++ +  
Sbjct: 73  QTGGKFFIQRPGKLRFNYDDPSPIRVIADGKNVAVGNLKLKTWNLYPLSKTPLSLLLAQK 132

Query: 121 QHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
            ++   S++ V+  +   TI   ++  F  + I++ FD  +Y L  W I D+  + + + 
Sbjct: 133 INLSDGSVKSVKEESDLTTIALGNNTVFGNSTITMMFDPKTYDLRQWTITDNQGKDTSVM 192

Query: 179 ILKYKENTVLDPKVFEIPYDKIH 201
           +   K     D KVF++PY+ I 
Sbjct: 193 VFNVKTGVQFDDKVFKVPYESIP 215


>gi|227823662|ref|YP_002827635.1| putative outer membrane lipoproteins carrier protein [Sinorhizobium
           fredii NGR234]
 gi|227342664|gb|ACP26882.1| putative outer membrane lipoproteins carrier protein [Sinorhizobium
           fredii NGR234]
          Length = 220

 Score =  237 bits (605), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 58/207 (28%), Positives = 96/207 (46%), Gaps = 4/207 (1%)

Query: 2   AFLLYKSVIGVVILFFYSAIFPFNA-AYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
             +  +  +  +      A     A           +K  +HF S++TM G F+Q    G
Sbjct: 12  RAISRRLFVCGLAALAGIAGTTLEATPASAQASAVAQKIADHFSSVKTMAGEFVQFGPRG 71

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G+F++ RP +  F Y +PS + +I+DG ++ + N KL TW +YPL     +++ S 
Sbjct: 72  EQTGGKFYIRRPGRIRFNYEAPSPMRVIADGRSVVIGNMKLKTWDIYPLSKTPLNLLLSE 131

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    ++ V      ITI   D   F  + I++ FD  SY L  W I D+ ++ + +
Sbjct: 132 RIDLSSRMVRDVRVEPDLITIVLGDRSIFGDSTITMMFDPKSYNLRQWTITDAQKKDTSV 191

Query: 178 KILKYKENTVLDPKVFEIPYDKIHNIN 204
            I   +    LD KVF IPYD++ N  
Sbjct: 192 MIFNVQTGIALDDKVFRIPYDEVRNKG 218


>gi|159185367|ref|NP_355690.2| hypothetical protein Atu2760 [Agrobacterium tumefaciens str. C58]
 gi|159140618|gb|AAK88475.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 224

 Score =  235 bits (601), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 60/202 (29%), Positives = 99/202 (49%), Gaps = 8/202 (3%)

Query: 11  GVVILFFYSAIF----PFNA-AYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKG 64
           GV+  F  +A+     P NA A       + +K   HF S++TM G F+Q    G    G
Sbjct: 23  GVLTAFSMAAVIAGLSPLNAFAQAAGNGATAQKIANHFSSVKTMMGEFVQFGPRGEQTGG 82

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
           +F++ RP K  F Y  PS + +ISDG N+ + N KL TW +YPL     S++ S+   + 
Sbjct: 83  KFYIERPGKLRFNYEDPSPMRVISDGKNVVIGNMKLKTWDLYPLSKTPLSLLLSDKIDLG 142

Query: 125 QESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
            + ++ V+  +   TI   D   F  + I++ FD  ++ L  W   D+  + + + I   
Sbjct: 143 NQKVRDVKEESDLTTIVLGDKSVFGDSTITLMFDPKTFDLRQWTTTDAQNKDTTVMIFNV 202

Query: 183 KENTVLDPKVFEIPYDKIHNIN 204
           +    LD +VF I Y+++    
Sbjct: 203 QTGVNLDERVFNINYEEVRKRG 224


>gi|86359551|ref|YP_471443.1| putative outer membrane lipoproteins carrier protein [Rhizobium
           etli CFN 42]
 gi|86283653|gb|ABC92716.1| putative outer membrane lipoproteins carrier protein [Rhizobium
           etli CFN 42]
          Length = 222

 Score =  235 bits (601), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 99/203 (48%), Gaps = 5/203 (2%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITK--DQSVKKAIEHFLSIQTMQGTFLQ-EDAGY 60
           +  + ++ V  +   ++  P +A          + +   +HF  + TMQG F+Q    G 
Sbjct: 13  MTRRDLLSVFTVAAMASAVPLSAIAQAAAPASGTAQAIADHFSGVTTMQGEFVQFGPRGE 72

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
              G+FF+ RP K  F Y  PS + +I+DG N+A+ N KL TW +YPL     S++ + +
Sbjct: 73  QTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNVAIGNTKLKTWDLYPLSKTPLSLLLAQH 132

Query: 121 QHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
             +    ++ V+  +   TI   ++  F  + I++ FD  +Y L  W I D+  + + + 
Sbjct: 133 IDLSAGMVKGVKEESDLTTIALGNNTVFGNSTITMMFDPKTYDLRQWTITDNQGKDTSVM 192

Query: 179 ILKYKENTVLDPKVFEIPYDKIH 201
           I   K     D +VF +PY+ I 
Sbjct: 193 IFNVKTGVQFDDRVFRVPYESIP 215


>gi|150398247|ref|YP_001328714.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium
           medicae WSM419]
 gi|150029762|gb|ABR61879.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium
           medicae WSM419]
          Length = 220

 Score =  235 bits (599), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 60/203 (29%), Positives = 102/203 (50%), Gaps = 4/203 (1%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVK-KAIEHFLSIQTMQGTFLQ-EDAGYV 61
           +  +  IG +          F + +   +  +V  +  +HF S++TM G F+Q    G  
Sbjct: 13  ISRRVFIGGLAALAGFGPTMFGSKHASAQASAVAQRIADHFSSVKTMAGEFVQFGPRGEQ 72

Query: 62  MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQ 121
             G+F++ RP +  F Y +PS + +I+DG ++ + N KL TW +YPL     +++ S   
Sbjct: 73  TGGKFYIRRPGRIRFNYEAPSPMRVIADGKSVVIGNMKLKTWDIYPLSKTPLNLLLSERI 132

Query: 122 HVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
            +  + ++ V+     ITI   D   F  + I++ FD  SY L  W I D+ R+ + + I
Sbjct: 133 DLSSKMVRDVKVEADLITIVLGDRSIFGDSTITMMFDPKSYNLRQWTITDAQRKDTSVMI 192

Query: 180 LKYKENTVLDPKVFEIPYDKIHN 202
              +    LD KVF IPYD++ N
Sbjct: 193 FNVRTGIALDDKVFRIPYDEVRN 215


>gi|17986353|ref|NP_538987.1| outer membrane lipoproteins carrier protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|17981941|gb|AAL51251.1| outer membrane lipoproteins carrier protein precursor [Brucella
           melitensis bv. 1 str. 16M]
          Length = 200

 Score =  234 bits (597), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 54/194 (27%), Positives = 91/194 (46%), Gaps = 4/194 (2%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFM 68
           +GV +     A  P  A        + ++  +HF S +TM G F+Q    G    G F++
Sbjct: 1   MGVGVAGAALAPVPVKAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRGEQTGGTFYI 60

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI 128
            RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++   +    +
Sbjct: 61  ERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGRL 119

Query: 129 QRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
           Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + + I   +   
Sbjct: 120 QSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTGV 179

Query: 187 VLDPKVFEIPYDKI 200
                +F+I Y +I
Sbjct: 180 RFTNDMFKIDYQRI 193


>gi|15966945|ref|NP_387298.1| hypothetical protein SMc03809 [Sinorhizobium meliloti 1021]
 gi|307301718|ref|ZP_07581477.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium
           meliloti BL225C]
 gi|307316258|ref|ZP_07595702.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium
           meliloti AK83]
 gi|15076218|emb|CAC47771.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306898098|gb|EFN28840.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium
           meliloti AK83]
 gi|306903416|gb|EFN34005.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium
           meliloti BL225C]
          Length = 220

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 58/195 (29%), Positives = 95/195 (48%), Gaps = 3/195 (1%)

Query: 11  GVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMA 69
           G+  L  + A                ++  +HF S++TM G F+Q    G    G+F++ 
Sbjct: 21  GLAALAGFGATTFGAGDASAQASAVAQRIADHFSSVKTMAGEFVQFGPRGEQTGGKFYIR 80

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQ 129
           RP +  F Y +PS + +I+DG ++ + N KL TW +YPL     +++ S    +    ++
Sbjct: 81  RPGRIRFNYEAPSPMRVIADGKSVVIGNMKLKTWDIYPLSKTPLNLLLSERIDLRSRMVR 140

Query: 130 RVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
            V      ITI   D   F  + I++ FD  SY L  W I D+ ++ + + I   +    
Sbjct: 141 DVRVEADLITIVLGDRSIFGDSTITMMFDPKSYNLRQWTITDAQKKDTSVMIFNVRTGIA 200

Query: 188 LDPKVFEIPYDKIHN 202
           LD KVF IPYD++ N
Sbjct: 201 LDDKVFRIPYDEVRN 215


>gi|209551338|ref|YP_002283255.1| outer membrane lipoprotein carrier protein LolA [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209537094|gb|ACI57029.1| outer membrane lipoprotein carrier protein LolA [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 222

 Score =  230 bits (587), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 58/204 (28%), Positives = 100/204 (49%), Gaps = 5/204 (2%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITK--DQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
            +  + ++G   +   ++  PF A          + +   +HF  + TMQG F+Q    G
Sbjct: 12  TVTRRDLLGAFAVAAMASAIPFGAHAQAAAPASGTAQAIADHFSGVTTMQGEFVQFGPRG 71

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G+FF+ RP K  F Y  PS + +I+DG N+A+ N KL TW +YPL     S++ + 
Sbjct: 72  EQTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNVAIGNTKLKTWDLYPLSKTPLSLLLAQ 131

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
           +  +    ++RV+  +   TI   ++  F  + I++ FD  +Y L  W I D+  + + +
Sbjct: 132 HIDLSAGMVKRVKEESDLTTIALGNNTVFGNSTITMMFDPKTYDLRQWTITDNQGKDTSV 191

Query: 178 KILKYKENTVLDPKVFEIPYDKIH 201
            I   K     D +VF +PY+ I 
Sbjct: 192 MIFNVKTGMQFDDRVFRVPYESIP 215


>gi|163757410|ref|ZP_02164499.1| hypothetical protein HPDFL43_18407 [Hoeflea phototrophica DFL-43]
 gi|162284912|gb|EDQ35194.1| hypothetical protein HPDFL43_18407 [Hoeflea phototrophica DFL-43]
          Length = 233

 Score =  229 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 56/189 (29%), Positives = 93/189 (49%), Gaps = 7/189 (3%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKF 74
                 FP  A        + ++  +HF S++TM G F+Q    G    G+FF+ RP K 
Sbjct: 42  AAGLLAFPGGAR----GADAAQRVADHFASVKTMTGEFIQFGPNGEQTGGKFFIDRPGKL 97

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESN 134
            F Y +PSSV +I+DG  + + N KL TW +YPL      ++ ++   +  + ++ V  +
Sbjct: 98  RFNYEAPSSVRVIADGKAVVIGNRKLRTWDLYPLNKTPLKLLLADRIDLSADMVRSVTED 157

Query: 135 NSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
              ITI   +   F  + IS+ FD  S+ L  W I D+  + + + I   +        V
Sbjct: 158 PDLITIVLGNKTIFGDSTISLMFDPKSFELRQWTIRDAQGKDTSVMIFNVRTGVTFASNV 217

Query: 193 FEIPYDKIH 201
           F++PYD++H
Sbjct: 218 FKVPYDQVH 226


>gi|327190168|gb|EGE57273.1| putative outer membrane lipoproteins carrier protein [Rhizobium
           etli CNPAF512]
          Length = 222

 Score =  229 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 57/204 (27%), Positives = 99/204 (48%), Gaps = 5/204 (2%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITK--DQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
            +  + ++G   +   ++  PF A          + +   +HF  + TMQG F+Q    G
Sbjct: 12  TMTRRDLLGAFAVAAMASAIPFGALAQAAAPASGTAQAIADHFSGVTTMQGEFVQFGPRG 71

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G+FF+ RP K  F Y  PS + +I+DG N+A+ N KL TW +YPL     S++ + 
Sbjct: 72  EQTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNVAIGNTKLKTWDLYPLSKTPLSLLLAQ 131

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
           +  +    ++ V+  +   TI   ++  F  + I++ FD  +Y L  W I D+  + + +
Sbjct: 132 HIDLSAGMVKGVKEESDLTTIALGNNTVFGNSTITMMFDPKTYDLRQWTITDNQGKDTSV 191

Query: 178 KILKYKENTVLDPKVFEIPYDKIH 201
            I   K     D +VF +PY+ I 
Sbjct: 192 MIFNVKTGMQFDDRVFRVPYESIP 215


>gi|116254289|ref|YP_770127.1| hypothetical protein RL4562 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258937|emb|CAK10046.1| conserved hypothetical exported protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 222

 Score =  228 bits (581), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 56/204 (27%), Positives = 98/204 (48%), Gaps = 5/204 (2%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITK--DQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
            +  + ++G   +   ++  P  A          + +   +HF  + TMQG F+Q    G
Sbjct: 12  TVTRRDLLGAFAVAAMASAIPLGAYAQAAAPASGTAQAIADHFSGVTTMQGEFVQFGPRG 71

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G+FF+ RP K  F Y +PS + +I+DG N+A+ N KL TW +YPL     S++ + 
Sbjct: 72  EQTGGKFFIQRPGKLRFNYDAPSPMRVIADGRNVAIGNTKLKTWDLYPLSKTPLSLLLAR 131

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    ++ V+  +   TI   ++  F  + I++ FD  +Y L  W I D+  + + +
Sbjct: 132 RIDLSAGMVKGVKEESDLTTIALGNNTVFGNSTITMMFDPKTYDLRQWTITDNQGKDTSV 191

Query: 178 KILKYKENTVLDPKVFEIPYDKIH 201
            I   K     D +VF +PY+ I 
Sbjct: 192 MIFNVKTGMQFDDRVFRVPYETIP 215


>gi|241206775|ref|YP_002977871.1| outer membrane lipoprotein carrier protein LolA [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240860665|gb|ACS58332.1| outer membrane lipoprotein carrier protein LolA [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 222

 Score =  227 bits (580), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 55/204 (26%), Positives = 98/204 (48%), Gaps = 5/204 (2%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITK--DQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
            +  + ++G   +   ++  P  A          + +   +HF  + TMQG F+Q    G
Sbjct: 12  TVTRRDLLGAFAVAAIASAIPLGAYAQAAAPASGTAQAIADHFSGVTTMQGEFVQFGPRG 71

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G+FF+ RP K  F Y  PS + +I+DG N+A+ N KL TW +YPL     S++ + 
Sbjct: 72  EQTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNVAIGNMKLKTWDLYPLSKTPLSLLLAQ 131

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
           +  +    ++ V+  +   TI   ++  F  + I++ FD  +Y L  W I D+  + + +
Sbjct: 132 HIDLSAGMVKGVKEESDLTTIALGNNTVFGNSTITMMFDPKTYDLRQWTITDNQGKDTSV 191

Query: 178 KILKYKENTVLDPKVFEIPYDKIH 201
            I   K     + +VF +PY+ I 
Sbjct: 192 MIFNVKTGMQFEDRVFRVPYETIP 215


>gi|190893819|ref|YP_001980361.1| outer membrane lipoproteins carrier protein [Rhizobium etli CIAT
           652]
 gi|190699098|gb|ACE93183.1| putative outer membrane lipoproteins carrier protein [Rhizobium
           etli CIAT 652]
          Length = 222

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 86/166 (51%), Gaps = 3/166 (1%)

Query: 39  AIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
             +HF  + TMQG F+Q    G    G+FF+ RP K  F Y  PS + +I+DG N+A+ N
Sbjct: 50  IADHFSGVTTMQGEFVQFGPRGEQTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNVAIGN 109

Query: 98  AKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTF 155
            KL TW +YPL     S++ + +  +    ++ V+  +   TI   ++  F  + I++ F
Sbjct: 110 TKLKTWDLYPLSKTPLSLLLAQHIDLSAGMVKGVKEESDLTTIALGNNTVFGNSTITMMF 169

Query: 156 DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIH 201
           D  +Y L  W I D+  + + + I   K     D +VF +PY+ I 
Sbjct: 170 DPKTYDLRQWTITDNQGKDTSVMIFNVKTGMQFDDRVFRVPYESIP 215


>gi|92115723|ref|YP_575452.1| outer membrane lipoprotein carrier protein LolA [Nitrobacter
           hamburgensis X14]
 gi|91798617|gb|ABE60992.1| outer membrane lipoprotein carrier protein LolA [Nitrobacter
           hamburgensis X14]
          Length = 339

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 43/184 (23%), Positives = 88/184 (47%), Gaps = 5/184 (2%)

Query: 26  AAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSV 84
           A +   +  +  +   +  S++T+ G F+Q    G    GEF++ +P K  F+Y  PS +
Sbjct: 155 ATFSADQKAAAARVSAYLSSLRTLAGNFVQVGPDGSRSTGEFYIQKPGKVRFEYDPPSPI 214

Query: 85  SLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSFITIFFK 143
           ++ISDGS++ V + KL T  +YPL       + S+   +++++ +  V S++ +I++  +
Sbjct: 215 AMISDGSSLVVRDTKLATQDIYPLSQTPLRYLLSDRIDLMKDTNVVSVTSDDLYISVTIE 274

Query: 144 DD---FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
           +       + + +       +L  W + D     + + I        LDP +F+I Y + 
Sbjct: 275 EKQALIGTSRLMLMVGAKDGKLKQWTVTDPQGYDTTVAIYNLNTTAKLDPALFKIDYTRY 334

Query: 201 HNIN 204
              N
Sbjct: 335 PTSN 338


>gi|222150121|ref|YP_002551078.1| possible lolA type protein [Agrobacterium vitis S4]
 gi|221737103|gb|ACM38066.1| possible lolA type protein [Agrobacterium vitis S4]
          Length = 220

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 56/167 (33%), Positives = 89/167 (53%), Gaps = 3/167 (1%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF S++TM G F+Q    G    G+F++ RP K  F Y  PS + +ISDG N+A+ N K
Sbjct: 54  DHFASVKTMMGEFVQFGPRGEQTAGKFYIERPGKLRFNYEQPSPMRVISDGRNVAIGNLK 113

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDR 157
           + TW VYPL     S++ S+   +  + +++V+      TI   D   F    I++ FD 
Sbjct: 114 MKTWDVYPLSKTPLSLLLSDRIDLGHQMVRQVKEEQDLTTIVLGDKSIFGDQTITLMFDP 173

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
            ++ L  W + D+  + + + I   ++    D KVFE+PYD I N  
Sbjct: 174 KTFELRQWTVTDAQGKDTSVMIFNVQQGVNFDEKVFEVPYDDIRNRG 220


>gi|13473591|ref|NP_105159.1| hypothetical protein mll4242 [Mesorhizobium loti MAFF303099]
 gi|14024341|dbj|BAB50945.1| mll4242 [Mesorhizobium loti MAFF303099]
          Length = 229

 Score =  225 bits (575), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 49/171 (28%), Positives = 82/171 (47%), Gaps = 3/171 (1%)

Query: 37  KKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAV 95
           +K  +HF S+++M G F+Q    G    G+FF+ RP K  F Y   S+  +ISDG ++ +
Sbjct: 55  QKIADHFSSVKSMSGEFVQFGPKGEQTGGKFFLERPGKIRFNYDGASNFKVISDGKSVVI 114

Query: 96  YNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISV 153
            N K++T  +YPL      ++  +   +  + ++ V+  +   TI   D   F    I++
Sbjct: 115 LNKKMNTSDLYPLSKTPLKLLLDDRIDLSGDRVKSVKEEDDLTTIQLSDKAVFGNARITM 174

Query: 154 TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
            FD  +Y L  W I D+  + + + I   KE     P  F I Y     +N
Sbjct: 175 MFDPKTYDLRQWTITDAQGKDTTVMIFNTKEGVSFAPDTFAIDYTANRELN 225


>gi|328541765|ref|YP_004301874.1| Outer membrane lipoprotein carrier protein LolA [polymorphum gilvum
           SL003B-26A1]
 gi|326411517|gb|ADZ68580.1| Outer membrane lipoprotein carrier protein LolA [Polymorphum gilvum
           SL003B-26A1]
          Length = 220

 Score =  225 bits (575), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 48/200 (24%), Positives = 98/200 (49%), Gaps = 4/200 (2%)

Query: 2   AFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGY 60
           A LL  +   V+     +      A     + +++     +F S++TM G F+Q    G 
Sbjct: 11  ARLLAVATALVLGGLTGAPSVAGAATLSGEQQKTLADVNAYFNSVKTMHGDFVQFGPEGD 70

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
            ++G+F++ARP K  F YS P+ + +I+DG +++V + K+ T  ++PL       + ++N
Sbjct: 71  QVEGKFYLARPGKIRFYYSPPAQLDIIADGKSVSVKDRKMATQDIWPLSETPLRFLLADN 130

Query: 121 QHVIQES-IQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             + +++ +  V +    +T+  +D   F    +++ FD  +Y L  W + D+    + +
Sbjct: 131 IDLTKDTKVVGVMAEPDLVTVVIEDKTTFNSGKLTLIFDARTYELKQWTVTDAQGYDTSV 190

Query: 178 KILKYKENTVLDPKVFEIPY 197
            +     N   +PK+F I Y
Sbjct: 191 AVYNVVANGPTNPKLFVIDY 210


>gi|319780772|ref|YP_004140248.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317166660|gb|ADV10198.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 227

 Score =  225 bits (574), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 49/171 (28%), Positives = 83/171 (48%), Gaps = 3/171 (1%)

Query: 37  KKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAV 95
           +K  +HF S+++M G F+Q    G    G+FF+ RP K  F Y   S+  +ISDG ++ +
Sbjct: 52  QKIADHFSSVKSMSGEFVQFGPKGEQTGGKFFLERPGKIRFNYDGSSNFRVISDGQSVVI 111

Query: 96  YNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISV 153
            N +L+T  +YPL      ++  N   +  + ++ V+  +   TI   D   F  + I++
Sbjct: 112 LNKRLNTSDLYPLSKTPLKLLLDNRIDLSGDRVKSVKQEDDLTTIQLADKSVFGNSKITM 171

Query: 154 TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
            FD  ++ L  W I D+  + + + I   KE     P  F I Y     +N
Sbjct: 172 MFDPKTFDLRQWTITDAQGKDTTVMIFNTKEGVSFAPDTFAIDYTANRELN 222


>gi|153008296|ref|YP_001369511.1| outer membrane lipoprotein carrier protein LolA [Ochrobactrum
           anthropi ATCC 49188]
 gi|151560184|gb|ABS13682.1| outer membrane lipoprotein carrier protein LolA [Ochrobactrum
           anthropi ATCC 49188]
          Length = 230

 Score =  225 bits (573), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 54/203 (26%), Positives = 95/203 (46%), Gaps = 5/203 (2%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L    +G+ +     A      A       + ++  +HF S++TM G F+Q    G
Sbjct: 23  LAAVLGMGALGLGMTSLVLAPV-AAMAQGAGGGAAAQQIADHFSSVRTMTGEFVQFGPKG 81

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 82  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGESVVINNRKLDTWDLYPLSKTPLKLLLAD 140

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 141 RIDLGGGRLQNVKQEPDMTTLVLGDKSIFGDSKITMMFDPKSYELKQWTITDAQKLDTTV 200

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 201 MIFNVRSGVRFTDDMFKIDYQRI 223


>gi|239833025|ref|ZP_04681354.1| outer membrane lipoprotein carrier protein LolA [Ochrobactrum
           intermedium LMG 3301]
 gi|239825292|gb|EEQ96860.1| outer membrane lipoprotein carrier protein LolA [Ochrobactrum
           intermedium LMG 3301]
          Length = 230

 Score =  225 bits (573), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 54/203 (26%), Positives = 95/203 (46%), Gaps = 5/203 (2%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +A +L    +G+ +     A      A       + ++  +HF S++TM G F+Q    G
Sbjct: 23  VAAVLGMGALGLGMTSLVLAPV-AAMAQGAGGGAAAQQIADHFSSVRTMTGEFVQFGPKG 81

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F++ RP K  F Y++ S + +ISDG ++ + N KLDTW +YPL      ++ ++
Sbjct: 82  EQTGGTFYIERPGKIRFNYNN-SPIRVISDGESVVINNRKLDTWDLYPLSKTPLKLLLAD 140

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +    +Q V+      T+   D   F  + I++ FD  SY L  W I D+ +  + +
Sbjct: 141 RIDLGGGRLQNVKQEPDMTTLVLGDKSIFGDSKITMMFDPKSYELKQWTITDAQKLDTTV 200

Query: 178 KILKYKENTVLDPKVFEIPYDKI 200
            I   +        +F+I Y +I
Sbjct: 201 MIFNVRSGVRFTDDMFKIDYQRI 223


>gi|260464218|ref|ZP_05812411.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium
           opportunistum WSM2075]
 gi|259030021|gb|EEW31304.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium
           opportunistum WSM2075]
          Length = 226

 Score =  223 bits (568), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 48/171 (28%), Positives = 82/171 (47%), Gaps = 3/171 (1%)

Query: 37  KKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAV 95
           +K  +HF ++++M G F+Q    G    G+FF+ RP K  F Y   S+  +ISDG ++ +
Sbjct: 52  QKIADHFSAVKSMSGEFVQFGPKGEQTGGKFFLERPGKIRFNYDGSSNFKVISDGKSVVI 111

Query: 96  YNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISV 153
            N K++T  +YPL      ++  +   +  + ++ V+  +   TI   D   F    I++
Sbjct: 112 LNKKMNTSDLYPLSKTPLKLLLDDRIDLSGDRVKSVKQEDDLTTIQLSDKSVFGNARITM 171

Query: 154 TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
            FD  +Y L  W I D+  + + + I   KE     P  F I Y     +N
Sbjct: 172 MFDPKTYDLRQWTITDAQGKDTTVMIFNTKEGVSFAPDTFAIDYTANRELN 222


>gi|114707342|ref|ZP_01440239.1| hypothetical protein FP2506_03950 [Fulvimarina pelagi HTCC2506]
 gi|114537223|gb|EAU40350.1| hypothetical protein FP2506_03950 [Fulvimarina pelagi HTCC2506]
          Length = 234

 Score =  222 bits (567), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 56/200 (28%), Positives = 95/200 (47%), Gaps = 5/200 (2%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPI-TKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMK 63
            +S++ V++    +A        P+  +  + ++  +HF SI +M G F+Q D  G   +
Sbjct: 30  GRSILSVMLALGIAAPAVTAFNGPVLAQSGAAQRIADHFSSIPSMHGDFVQFDPNGRQSE 89

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHV 123
           G+F++ +P K  F Y+S   + +I+DG+ +A+ N KL+TW  YPL      ++     ++
Sbjct: 90  GKFYIEKPGKVRFDYAS-QPLRVIADGTTVAINNKKLNTWDTYPLSQTPLKLLLDRRINL 148

Query: 124 IQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
              +I+ V       TI   D   F  + I++ FD  S  L  W I D   R + + I  
Sbjct: 149 SSANIRSVREEPDLTTIVMGDRSVFGNSTITMMFDPQSSDLKQWTIRDKQGRDTTVMIYN 208

Query: 182 YKENTVLDPKVFEIPYDKIH 201
            KE   +    F IPY  I 
Sbjct: 209 VKEGGDIQNSAFNIPYTAIQ 228


>gi|163869208|ref|YP_001610460.1| lipoprotein carrier protein [Bartonella tribocorum CIP 105476]
 gi|161018907|emb|CAK02465.1| lipoprotein carrier protein [Bartonella tribocorum CIP 105476]
          Length = 202

 Score =  222 bits (566), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 51/201 (25%), Positives = 88/201 (43%), Gaps = 5/201 (2%)

Query: 2   AFLLYKSVIGVV-ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +FL  + V G+V IL F    FP  +     K    +    HF +I+TM G F+Q    G
Sbjct: 4   SFLPQRRVFGLVGILVFCCLTFPAFS-QSSNKVAKAQNIANHFAAIKTMTGDFIQFSPKG 62

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
            + +G F++ RP K  F Y     + +I+DG  + + N  L+TW+   L       +  +
Sbjct: 63  KMSQGTFYLERPGKIRFIYKK-MPLQIIADGQFVGINNRALNTWNFSQLSQTPMKFLLDD 121

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
              +    +     +   +TI  +D  +G   I + FD  S+ L  W I+D     + ++
Sbjct: 122 KIDLSSGRLLAFREDPGAVTIVLRDKTIGAGQIRMVFDSKSFALRQWTIVDQQNLETTVQ 181

Query: 179 ILKYKENTVLDPKVFEIPYDK 199
           I+  +        +F +P  K
Sbjct: 182 IMNVRTGVRFVQGMFTLPSKK 202


>gi|85714110|ref|ZP_01045099.1| Outer membrane lipoprotein carrier protein LolA [Nitrobacter sp.
           Nb-311A]
 gi|85699236|gb|EAQ37104.1| Outer membrane lipoprotein carrier protein LolA [Nitrobacter sp.
           Nb-311A]
          Length = 413

 Score =  221 bits (563), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 44/188 (23%), Positives = 88/188 (46%), Gaps = 7/188 (3%)

Query: 22  FPFN--AAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKY 78
            P N  A +   +  +  +   +  S++T+ G F+Q    G    GEF++ +P K  F+Y
Sbjct: 222 VPANFFATFSADQKAAAARVSAYLSSLRTLAGNFVQVGPDGSRSTGEFYIQKPGKVRFEY 281

Query: 79  SSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSF 137
             PS +++ISDGS++ V + +L T  VYPL       + S+   ++++ ++  V S++ +
Sbjct: 282 DPPSPIAMISDGSSLVVRDTRLATQDVYPLSQTPLRYLLSDRLDLMKDTNVVAVTSDDLY 341

Query: 138 ITIFFKDD---FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
           I++  ++       + + +       +L  W + D     + + I        LDP +F+
Sbjct: 342 ISVIIEEKQALVGTSRLMLMVGVKDGKLKQWTVTDPQGYDTTVAIYNLNSTAKLDPALFK 401

Query: 195 IPYDKIHN 202
           I Y     
Sbjct: 402 IDYTNYPT 409


>gi|299133178|ref|ZP_07026373.1| outer membrane lipoprotein carrier protein LolA [Afipia sp. 1NLS2]
 gi|298593315|gb|EFI53515.1| outer membrane lipoprotein carrier protein LolA [Afipia sp. 1NLS2]
          Length = 285

 Score =  220 bits (560), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 40/192 (20%), Positives = 88/192 (45%), Gaps = 5/192 (2%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSK 73
           LF   +  P   A+   +     K   +  S+Q + G F+Q    G    G F++ +P K
Sbjct: 90  LFGGDSPAPKLQAFDANQRALADKVSAYLSSLQNLSGNFVQVGPDGSRTTGNFYLQKPGK 149

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVE 132
             F+Y  PS ++L++DG+++ V + +L T  VYPL       + ++   +++++ +  + 
Sbjct: 150 IRFEYDDPSPIALVADGTSVIVRDRRLATQDVYPLSQTPLRYLLASKLDLLRDTNVTSIS 209

Query: 133 SNNSFITIFFKDD---FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLD 189
           +++ +I+I  ++       + +++       +L  W + D     + + +        LD
Sbjct: 210 ADDLYISITIEEKQAVTGTSRLTLMVGAKDGKLKQWTVTDPQGYDTTVAVYNLDTTKKLD 269

Query: 190 PKVFEIPYDKIH 201
           P +F+I Y    
Sbjct: 270 PALFKIDYTNYQ 281


>gi|110635563|ref|YP_675771.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium sp.
           BNC1]
 gi|110286547|gb|ABG64606.1| outer membrane lipoprotein carrier protein LolA [Chelativorans sp.
           BNC1]
          Length = 216

 Score =  219 bits (559), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 50/204 (24%), Positives = 97/204 (47%), Gaps = 8/204 (3%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +  L  +S++   IL                  Q+ ++  +HF +++TM G F+Q    G
Sbjct: 11  VLRLARRSLLATAILAVGLTAG-----SANAASQAAQRIAQHFSNVRTMTGEFVQFGPRG 65

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G+F++ RP K  F Y  P+   ++SDGS + + N K++T  +Y L      ++   
Sbjct: 66  EQTGGKFYIERPGKIRFDYEPPAQFRVMSDGSTVVLENKKMNTVDIYRLSDTPLRLLLGE 125

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMGN--MISVTFDRLSYRLLNWKIMDSSRRYSII 177
              +  +++++V+ +    T+   D  +GN   I++ FD  +Y L  W + D+  R + +
Sbjct: 126 RIDLSADNVRQVKEDPDLTTVTIADRKLGNNATITMMFDSKTYDLRQWTVTDAQGRDTTV 185

Query: 178 KILKYKENTVLDPKVFEIPYDKIH 201
            I   K+    DP VF I + +++
Sbjct: 186 MIFNVKQGVTFDPSVFYIDHRRVN 209


>gi|304394438|ref|ZP_07376361.1| outer membrane lipoprotein carrier protein LolA [Ahrensia sp.
           R2A130]
 gi|303293878|gb|EFL88255.1| outer membrane lipoprotein carrier protein LolA [Ahrensia sp.
           R2A130]
          Length = 220

 Score =  219 bits (558), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 55/206 (26%), Positives = 103/206 (50%), Gaps = 7/206 (3%)

Query: 2   AFLLYKSVIG--VVILFFYSAIFPFNAAYPIT--KDQSVKKAIEHFLSIQTMQGTFLQ-E 56
           A +L  S I   VV++   +++    A+  +T    ++V +  +HF S+ +M G F+Q  
Sbjct: 5   ATVLRNSAIAALVVMIAGIASLMANPASAKVTNADKKAVAQISQHFSSVPSMAGEFIQFG 64

Query: 57  DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVI 116
             G    G+F++ RP K  F Y++PS +++ +DG  + + N KL TW  +PLR     ++
Sbjct: 65  PNGEQTGGKFYLQRPGKIRFDYANPSPITVKADGKTVGINNKKLKTWDFFPLRKTPLRLL 124

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
            S+   V  +SI+ V+      T+   +   F  + I++ FD  +  L  W I D   + 
Sbjct: 125 LSDKIDVNDKSIKSVKREKDLTTVMLANKSVFGNSKITMMFDPETSDLRQWTITDDQGKD 184

Query: 175 SIIKILKYKENTVLDPKVFEIPYDKI 200
           + + I   ++N  L  ++F +   +I
Sbjct: 185 TSVMIFNVQKNVKLSKRLFYMNQREI 210


>gi|307943516|ref|ZP_07658860.1| outer membrane lipoprotein carrier protein LolA [Roseibium sp.
           TrichSKD4]
 gi|307773146|gb|EFO32363.1| outer membrane lipoprotein carrier protein LolA [Roseibium sp.
           TrichSKD4]
          Length = 214

 Score =  218 bits (555), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 49/200 (24%), Positives = 96/200 (48%), Gaps = 5/200 (2%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNA-AYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGY 60
             L K+   +  +          A A    + +++     +F S++TM G F+Q    G 
Sbjct: 5   RTLAKAATKISAVAGLCLALSAQAFALTDAQKKTLNDVNTYFNSVKTMHGDFVQFGPDGS 64

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
             +G+F++ARP K  F YS P+ + +I+DG +++V + KL T  ++PL       + + N
Sbjct: 65  QSEGKFYLARPGKVRFYYSPPAKLDIIADGKSVSVKDRKLATQDIWPLGQTPLRFLLAEN 124

Query: 121 QHVIQE-SIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
            ++  E +IQ V   +  +T+  +D   F   ++++ F+  +Y L  W + D+    + +
Sbjct: 125 INLQSEATIQNVIVESDLVTVVLEDKTTFNSGILTLIFEADTYELKQWTVTDAQGFDTSV 184

Query: 178 KILKYKENTVLDPKVFEIPY 197
            +     N   +P +F I Y
Sbjct: 185 AVYNVVSNGPTNPDLFRIDY 204


>gi|49474727|ref|YP_032769.1| Outer membrane lipoprotein carrier protein [Bartonella quintana
           str. Toulouse]
 gi|49240231|emb|CAF26701.1| Outer membrane lipoprotein carrier protein [Bartonella quintana
           str. Toulouse]
          Length = 202

 Score =  218 bits (555), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 51/201 (25%), Positives = 89/201 (44%), Gaps = 5/201 (2%)

Query: 2   AFLLYKSVIGVV-ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +FL  K +   + I+ F    FP  +     K    +K   HF +I+TM G F+Q    G
Sbjct: 4   SFLPRKRIFWFIGIIVFCCLTFPAFS-QSSKKVVKAQKIANHFAAIKTMTGDFIQFSPKG 62

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
            + +G F++ RP K  F Y     + +I+DG  I + N  L+TW+  PL       +  +
Sbjct: 63  KMSQGTFYLERPGKIRFIYKK-IPLQIIADGQFIGINNRALNTWNFSPLFQTPMKFLLDD 121

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
             ++    +     +   +T+  +D   G   I + FD  +Y L  W I+D     + ++
Sbjct: 122 EINLSSGRLLAFREDPGAVTVILRDKSTGSGQIKMVFDPKTYTLRQWTIIDQQSLETTVQ 181

Query: 179 ILKYKENTVLDPKVFEIPYDK 199
           I+  +       K+F +P  K
Sbjct: 182 IMNVRTGVKFADKMFTLPSKK 202


>gi|319409387|emb|CBI83031.1| lipoprotein carrier protein [Bartonella schoenbuchensis R1]
          Length = 212

 Score =  217 bits (553), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 48/200 (24%), Positives = 86/200 (43%), Gaps = 3/200 (1%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYV 61
           +L  + V  V        +   + A    +    +    HF  I+TM G F+Q    G +
Sbjct: 5   YLSSRRVFIVFGFIICVLLAVPSFAQSSRQVARAQAIANHFSEIKTMTGDFIQFSPKGKM 64

Query: 62  MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQ 121
            +G F++ RP +  F Y     + +I+DG  + V N  L+TW++Y L       +  +  
Sbjct: 65  SEGTFYLERPGRIRFGYKG-VPLQIIADGKMVGVNNRALNTWNLYQLSQTPMKFLLDDKI 123

Query: 122 HVIQESIQRVESNNSFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
           ++  +++  +  +   ITI   D  +G   I + FD   Y L  W I+D     + ++I+
Sbjct: 124 NISSKNLLALREDPGVITIVLHDKSIGKGQIRMIFDSKDYSLRQWTIVDQQNLETTVQIM 183

Query: 181 KYKENTVLDPKVFEIPYDKI 200
             +        +F IPY  I
Sbjct: 184 NVRTGIRFVDGMFTIPYKNI 203


>gi|319899429|ref|YP_004159526.1| lipoprotein carrier protein [Bartonella clarridgeiae 73]
 gi|319403397|emb|CBI76965.1| lipoprotein carrier protein [Bartonella clarridgeiae 73]
          Length = 210

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 52/203 (25%), Positives = 92/203 (45%), Gaps = 9/203 (4%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSV--KKAIEHFLSIQTMQGTFLQ-ED 57
           + FL  +    V+ LF         +A+  +  Q V  +    HF +I+TM G F+Q   
Sbjct: 3   VYFLSLRRAFNVIFLFLLL----IGSAFSQSAKQLVRAQNIANHFAAIKTMTGDFIQFSP 58

Query: 58  AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIF 117
            G + KG F++ RP K  F Y     + +++DG ++ V N  L+TWS Y L      ++ 
Sbjct: 59  KGKITKGTFYLERPGKIRFSYKG-VPLQIVADGKSVGVNNRALNTWSFYQLSQTPMKLLL 117

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSI 176
            +   +   ++     +   + I  +D  +G   I + FD  SY L  W I+D     + 
Sbjct: 118 GDTISLSSANLLAFREDPGAVMIVLRDKTIGKGQIKMIFDSQSYALRQWTILDQQNLETT 177

Query: 177 IKILKYKENTVLDPKVFEIPYDK 199
           ++++  + N      +F+IPY  
Sbjct: 178 VQVMNVRTNVRFADGMFKIPYKN 200


>gi|49476205|ref|YP_034246.1| Outer membrane lipoprotein carrier protein [Bartonella henselae
           str. Houston-1]
 gi|49239013|emb|CAF28313.1| Outer membrane lipoprotein carrier protein [Bartonella henselae
           str. Houston-1]
          Length = 202

 Score =  216 bits (551), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 52/200 (26%), Positives = 88/200 (44%), Gaps = 5/200 (2%)

Query: 3   FLLYKSVIGVV-ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGY 60
           FLL + +   V IL F    FP  +     K    +K   HF +I+TM G F+Q    G 
Sbjct: 5   FLLRRRIFAFVGILIFSCLTFPAFS-QSSNKVARAQKIANHFAAIKTMTGDFIQFSPKGK 63

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
           + +G F++ RP K  F Y     + +I+DG  I + N  L+TW+   L       +  + 
Sbjct: 64  MSQGTFYLERPGKIRFIYKK-IPLQIIADGQFIGINNRALNTWNFSKLFQTPMKFLLDDK 122

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
            ++    +     +   +TI  +D  +G   I + FD  +Y L  W I+D     + ++I
Sbjct: 123 INISSGRLLAFREDPGAVTIVLRDKSVGAGQIRMVFDSKTYSLRQWTIVDQQNLETTVQI 182

Query: 180 LKYKENTVLDPKVFEIPYDK 199
           +  +        +F +P  K
Sbjct: 183 MNVRTGVRFADGMFTLPSKK 202


>gi|118591354|ref|ZP_01548752.1| hypothetical protein SIAM614_26943 [Stappia aggregata IAM 12614]
 gi|118436026|gb|EAV42669.1| hypothetical protein SIAM614_26943 [Stappia aggregata IAM 12614]
          Length = 215

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 47/178 (26%), Positives = 88/178 (49%), Gaps = 4/178 (2%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISD 89
            + +++     +F S++TM G F+Q    G    G+F+MARP K  F Y+ PS + +++D
Sbjct: 36  QEQKTLTDLNSYFNSVKTMHGDFIQFGPDGNQSDGKFYMARPGKVRFYYNKPSVLDIVAD 95

Query: 90  GSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQR---VESNNSFITIFFKDDF 146
           G +++V + KL+T  ++PL       + S++  + +++      VE +   +TIF K  F
Sbjct: 96  GKSVSVRDRKLNTQDIWPLGQTPLRFLLSDDIDLQKDTNVTNVLVEEDLITVTIFDKTKF 155

Query: 147 MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
               +++ FD   Y L  W + D     + + +     N   +P +F+I Y      N
Sbjct: 156 NSGTLTLIFDAKDYALKQWTVTDQQGYDTSVAVYNVVSNGPTNPDLFKIDYLANARQN 213


>gi|209883510|ref|YP_002287367.1| outer membrane lipoprotein carrier protein LolA [Oligotropha
           carboxidovorans OM5]
 gi|209871706|gb|ACI91502.1| outer membrane lipoprotein carrier protein LolA [Oligotropha
           carboxidovorans OM5]
          Length = 276

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 40/189 (21%), Positives = 89/189 (47%), Gaps = 5/189 (2%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSK 73
           LF   +  P   A+   +     K   +  S+Q + G F+Q    G    G F+M +P K
Sbjct: 81  LFGNDSAAPRVQAFDANQRALAAKVSAYLSSVQNLSGNFVQVGPDGSRTTGTFYMLKPGK 140

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVE 132
             F+Y  PS ++L++DG+++ V + +L T  VYPL       + +++  ++++ ++  + 
Sbjct: 141 IRFEYDDPSPIALVADGTSVIVRDRRLATQDVYPLSQTPLRYLLASHIDLLKDTNVTGIS 200

Query: 133 SNNSFITIFFKDD---FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLD 189
           +++ +I+I  ++       + +++       +L  W + D     + + +     +   D
Sbjct: 201 ADDLYISITIEEKQAVTGTSRLTLMVGAKDDKLKQWTVTDPQGYDTTVAVYNLDASKKPD 260

Query: 190 PKVFEIPYD 198
           P +F+I Y 
Sbjct: 261 PSLFKIDYT 269


>gi|240851284|ref|YP_002972687.1| outer membrane lipoprotein carrier protein, LolA family [Bartonella
           grahamii as4aup]
 gi|240268407|gb|ACS51995.1| outer membrane lipoprotein carrier protein, LolA family [Bartonella
           grahamii as4aup]
          Length = 202

 Score =  215 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 50/201 (24%), Positives = 89/201 (44%), Gaps = 5/201 (2%)

Query: 2   AFLLYKSVIGVV-ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
           +FL  + V G+V I+ F+   FP  +     K    +  + HF +I+TM G F+Q    G
Sbjct: 4   SFLPQRRVFGLVGIIIFWCLTFPVFS-QASNKVIKAQNVVNHFAAIKTMTGDFIQFSPKG 62

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
            + +G F++ RP K  F Y     + +I+DG  + + N  L+TW+   L       +  +
Sbjct: 63  KMSQGTFYLERPGKIRFIYKK-MPLQIIADGQFVGINNRALNTWNFSQLSQTPMKFLLGD 121

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
              V    +     +   +TI  +D  +G   I + FD     L  W I+D     + ++
Sbjct: 122 KIDVSSGRLLAFREDPGAVTIVLRDKTIGAGQIRMVFDSKGSALRQWTIVDQQNLETTVQ 181

Query: 179 ILKYKENTVLDPKVFEIPYDK 199
           I+  + +      +F +P  K
Sbjct: 182 IMNVRTDVRFANGMFALPSKK 202


>gi|90421062|ref|ZP_01228965.1| outer membrane lipoprotein carrier protein [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90334697|gb|EAS48474.1| outer membrane lipoprotein carrier protein [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 214

 Score =  215 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 52/163 (31%), Positives = 80/163 (49%), Gaps = 4/163 (2%)

Query: 41  EHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF  I +M G F+Q D  G   +G+F++ +P K  F Y+    + +I+DGS +A+ N K
Sbjct: 46  DHFAGIPSMHGDFVQFDPNGRQTEGKFYIEKPGKVRFDYTQ-QPLRVIADGSTVAINNKK 104

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDR 157
           L+TW  YPL      ++      + Q +IQ V+      TI   D   F  + I++ FD 
Sbjct: 105 LNTWDTYPLSKTPLKLLLDRRIDLSQANIQSVKEEPDLTTIVMGDSSIFGNSRITLMFDP 164

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
            SY L  W I D   + + + I   K    +    F+IPY  I
Sbjct: 165 KSYELKQWTIRDQQGKDTTVMIYNVKHGGDIAESTFKIPYTAI 207


>gi|254500974|ref|ZP_05113125.1| Outer membrane lipoprotein carrier protein LolA [Labrenzia
           alexandrii DFL-11]
 gi|222437045|gb|EEE43724.1| Outer membrane lipoprotein carrier protein LolA [Labrenzia
           alexandrii DFL-11]
          Length = 212

 Score =  214 bits (546), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 48/175 (27%), Positives = 89/175 (50%), Gaps = 4/175 (2%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVS 85
           A    + Q+++    +F S++TM G F+Q    G    G+F+MARP K  F Y+ PS + 
Sbjct: 32  ALSDQEQQTLQDLNTYFNSVKTMHGDFIQFGPDGSQSDGKFYMARPGKVRFYYNKPSVLD 91

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQR---VESNNSFITIFF 142
           +++DG +++V + KL+T  ++PL       + S++  + Q++      VE +   +TIF 
Sbjct: 92  IVADGKSVSVRDRKLNTQDIWPLGQTPLRFLLSDSIDLQQDTNVTNVLVEEDLVTVTIFD 151

Query: 143 KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
           +  F    +++ FD   Y L  W + D     + + +     N   +P +F+I Y
Sbjct: 152 QTKFNSGTLTLIFDAKDYALKQWTVTDQQGYDTSVAVYNVVSNGPSNPDLFKIDY 206


>gi|319406309|emb|CBI79946.1| LolA family protein [Bartonella sp. AR 15-3]
          Length = 206

 Score =  214 bits (546), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 54/199 (27%), Positives = 94/199 (47%), Gaps = 5/199 (2%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYV 61
           F   + ++ V++LFF  +   F+ +    +    +  I  F +I+TM G F+Q    G +
Sbjct: 5   FFSLRRIVSVILLFFLLSSPAFSQS--AKQLARAQNIINRFAAIKTMTGDFIQFSPKGKI 62

Query: 62  MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQ 121
            KG F++ RP K  F Y     + +I+DG ++ + N  L+TWS Y L       +  N  
Sbjct: 63  TKGTFYLERPGKIRFSYKG-VPLQIIADGKSVGINNRALNTWSFYRLSQTPMKFLLGNTI 121

Query: 122 HVIQESIQRVESNNSFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
           ++  E++     +   + I  +D  +G   I + FD  SY L  W I+D     + I+I+
Sbjct: 122 NLSSENLLAFREDPKTVVIILRDKTIGKGQIKIIFDSQSYALRQWAILDQQNLETTIQIM 181

Query: 181 KYKENTVLDPKVFEIPYDK 199
             + N     ++F IPY  
Sbjct: 182 NVRTNVRFSNEMFVIPYKN 200


>gi|170750146|ref|YP_001756406.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656668|gb|ACB25723.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           radiotolerans JCM 2831]
          Length = 302

 Score =  214 bits (544), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 44/196 (22%), Positives = 90/196 (45%), Gaps = 8/196 (4%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMAR 70
           V  +   +AI   ++A P T    + +A  +F  I T+ G F+Q    G  + G+  +A+
Sbjct: 98  VAAVGAPAAIVTGDSADPAT---LLAQANAYFNGINTLSGNFVQIGADGRRIGGKLTLAK 154

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQ 129
           P +  F Y  PS + +++DG+++AV + KL+T  +Y +       +      + ++ ++ 
Sbjct: 155 PGRLRFDYDQPSPLEVVADGTSVAVRDRKLNTQDLYFIAQTPLKFLLREKIDLARDLTVT 214

Query: 130 RVESNNSFITIFFKDDF---MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
            V S+   + I  +D       + I + FD     L  W+I D     + + +   ++  
Sbjct: 215 DVASDPGSVRISLEDRATLGGTSKIQLFFDAEMKTLSQWRITDPQGYVTTVTLSNLQKGK 274

Query: 187 VLDPKVFEIPYDKIHN 202
            +D  +F I Y +  +
Sbjct: 275 SVDGSLFFINYGRSED 290


>gi|316931740|ref|YP_004106722.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris DX-1]
 gi|315599454|gb|ADU41989.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris DX-1]
          Length = 313

 Score =  213 bits (543), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 41/180 (22%), Positives = 83/180 (46%), Gaps = 5/180 (2%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSL 86
           +   +     K   +  S+QT+ G F+Q    G  + G+F++ +P K  F+Y  PS VS+
Sbjct: 131 FDSAQKAEAAKVSAYLSSLQTLVGQFVQVGPDGSKLTGDFYIVKPGKIRFEYDEPSPVSM 190

Query: 87  ISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKDD 145
           I+DG ++ V + KL T  VYPL       + S+   ++++ ++  + S++ +  I  ++ 
Sbjct: 191 IADGQSVVVRDRKLATQDVYPLSQTPLRYLLSDRIDLLRDTNVVSITSDDLYSNIIIEEK 250

Query: 146 ---FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
                 + + + F     +L  W + D     + + +     +   DP +F+I Y     
Sbjct: 251 NAIIGTSRLLLMFGTKDGQLKQWTVTDPQGYDTTVAVYNLDTSRRPDPSMFKIDYTNYQT 310


>gi|146337390|ref|YP_001202438.1| putative signal peptide [Bradyrhizobium sp. ORS278]
 gi|146190196|emb|CAL74188.1| conserved hypothetical protein; putative signal peptide
           [Bradyrhizobium sp. ORS278]
          Length = 255

 Score =  213 bits (542), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 41/181 (22%), Positives = 84/181 (46%), Gaps = 5/181 (2%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVS 85
           ++   +     K   +  S+QT+ G F+Q    G   KG+F++ +P K  F+Y  P+ + 
Sbjct: 72  SFDANQKAVAAKVSAYLSSLQTLVGNFVQVGPDGSKTKGDFYIQKPGKVRFEYEPPTPID 131

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSFITIFFKD 144
           +I+DGS++ V + KL T  VYPL       + S+   +++++ +  V ++  ++TI  ++
Sbjct: 132 IIADGSSLVVRDRKLATQDVYPLSQTPLRYLLSDRIDLLKDTNVIAVTADELYVTITIEE 191

Query: 145 D---FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIH 201
                  + + +       +L  W + D     + I +        LDP +F+I +    
Sbjct: 192 KQALIGTSRLMLMLGAKDGQLKQWTVTDPQGYDTTIAVYNLDTTKKLDPAMFKIDFTNYA 251

Query: 202 N 202
            
Sbjct: 252 T 252


>gi|148251753|ref|YP_001236338.1| hypothetical protein BBta_0134 [Bradyrhizobium sp. BTAi1]
 gi|146403926|gb|ABQ32432.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 257

 Score =  213 bits (542), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 42/182 (23%), Positives = 86/182 (47%), Gaps = 5/182 (2%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVS 85
           ++   +     K   +  S+QT+ G F+Q    G   KG+F++ +P K  F+Y  P+ + 
Sbjct: 73  SFDANQKAIAGKVSAYLSSLQTLVGNFVQVGPDGSKTKGDFYIQKPGKVRFEYDPPTPID 132

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKD 144
           +I+DGS++ V + KL T  VYPL       + S+   ++++ ++  V S++ ++TI  ++
Sbjct: 133 IIADGSSLVVRDRKLATQDVYPLSQTPLRYLLSDRIDLLKDTNVIAVASDDLYVTITIEE 192

Query: 145 D---FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIH 201
                  + + +       +L  W + D     + I +        LDP +F+I +    
Sbjct: 193 KQALIGTSRLMLMLGAKDGQLKQWTVTDPQGYDTTIAVYNLDTTKKLDPAMFKIDFTTYP 252

Query: 202 NI 203
           + 
Sbjct: 253 ST 254


>gi|27375728|ref|NP_767257.1| hypothetical protein blr0617 [Bradyrhizobium japonicum USDA 110]
 gi|27348866|dbj|BAC45882.1| blr0617 [Bradyrhizobium japonicum USDA 110]
          Length = 251

 Score =  212 bits (541), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 39/181 (21%), Positives = 85/181 (46%), Gaps = 5/181 (2%)

Query: 26  AAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSV 84
             +   +     K   +  S+ T+ G F+Q    G   +G+F++ +P K  F+Y +PS +
Sbjct: 67  QTFDANQKAQAAKVSAYLSSLSTLVGNFVQVGPDGSKTQGDFYIQKPGKVRFEYDAPSPI 126

Query: 85  SLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFK 143
            +++DGS++ V + KL T  VYPL       + S+   ++++ ++  V +++ F+++  +
Sbjct: 127 DIVADGSSLVVRDRKLATQDVYPLSQTPLRFLLSDRIDLMKDTNVVNVSADDVFVSVTIE 186

Query: 144 DD---FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
           +       + + + F     +L  W + D     + I +        LDP +F+I +   
Sbjct: 187 EKQALVGTSRLLLMFGAKDGQLKQWTVTDPQGYDTTIAVYNLDATKKLDPGMFKIDFTNY 246

Query: 201 H 201
            
Sbjct: 247 G 247


>gi|121602483|ref|YP_988432.1| LolA family protein [Bartonella bacilliformis KC583]
 gi|120614660|gb|ABM45261.1| LolA family protein [Bartonella bacilliformis KC583]
          Length = 210

 Score =  212 bits (541), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 50/198 (25%), Positives = 92/198 (46%), Gaps = 4/198 (2%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMK 63
           L + ++   IL+F   +FP  +     +    +    HF +I+TM G F+Q    G   K
Sbjct: 8   LNRILVVSGILYFVLLLFPAFS-QSAHQVARAQVIANHFAAIKTMTGDFVQFSPKGKKTK 66

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHV 123
           G F++ RP K  F Y     + +++DG ++ + N  L+TW +Y L      ++  +   +
Sbjct: 67  GTFYLERPGKVRFTYQG-VPLQIMADGQSVGIQNRALNTWDLYQLSQTPMKLLLGDTIDI 125

Query: 124 IQESIQRVESNNSFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
             E++     ++  I I  +D  +G   I + FD  +Y LL W I+D     + ++++  
Sbjct: 126 SSENLLAFRQDSRAIEIILRDKSLGKGQIKMIFDANTYALLQWTIVDQQNLETTVQVMNV 185

Query: 183 KENTVLDPKVFEIPYDKI 200
           +        +F IPY  I
Sbjct: 186 RTGVRFAEDMFTIPYQNI 203


>gi|75674283|ref|YP_316704.1| Outer membrane lipoprotein carrier protein LolA [Nitrobacter
           winogradskyi Nb-255]
 gi|74419153|gb|ABA03352.1| Outer membrane lipoprotein carrier protein LolA [Nitrobacter
           winogradskyi Nb-255]
          Length = 258

 Score =  211 bits (538), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 41/178 (23%), Positives = 83/178 (46%), Gaps = 5/178 (2%)

Query: 26  AAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSV 84
           A +   +  +  +   +  S++T+ G F+Q    G    GEF++ +P K  F+Y  PS +
Sbjct: 73  ATFDANQKAAAARVSSYLSSLRTLAGKFVQVGPDGSRSTGEFYIQKPGKVRFEYDPPSPI 132

Query: 85  SLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFK 143
           ++ISDGS++ + + +L T  VYPL       + S+   ++++ ++  V S++ +I++  +
Sbjct: 133 AMISDGSSLVIRDTRLATQDVYPLSQTPLRYLLSDRIDLMRDTNVVAVTSDDLYISVIIE 192

Query: 144 DD---FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           +       + +         +L  W I D     + + I        LDP +F I   
Sbjct: 193 EKQALVGTSRLMFMVGVKDGKLKQWTITDPQGYDTTVAIYNLNPTAKLDPALFRINGT 250


>gi|86747504|ref|YP_484000.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris HaA2]
 gi|86570532|gb|ABD05089.1| Outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris HaA2]
          Length = 317

 Score =  211 bits (537), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 41/180 (22%), Positives = 83/180 (46%), Gaps = 5/180 (2%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSL 86
           +   +     K   +  S+ T+ G F+Q    G  ++G+F++ +P K  F+Y  PS VS+
Sbjct: 135 FDAKQKADAAKVSAYLSSLSTLVGNFVQVGPDGSRLQGDFYIMKPGKVRFEYDEPSPVSM 194

Query: 87  ISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKDD 145
           +SDG ++AV + KL T  VYPL       + S+   ++++ ++  + S+  +I+I  ++ 
Sbjct: 195 VSDGQSLAVRDRKLATQDVYPLSQTPLRYLLSDRIDLLRDTNVVAISSDELYISIIIEER 254

Query: 146 ---FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
                 + + +       +L  W + D     + + I         DP +F+I +     
Sbjct: 255 NAVIGTSRLMLMLGVKDGQLKQWTVTDPQGYDTTVAIYNLDTTRRPDPSMFKIDFTDYGT 314


>gi|254472223|ref|ZP_05085623.1| outer membrane lipoprotein carrier protein LolA [Pseudovibrio sp.
           JE062]
 gi|211958506|gb|EEA93706.1| outer membrane lipoprotein carrier protein LolA [Pseudovibrio sp.
           JE062]
          Length = 229

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 56/195 (28%), Positives = 98/195 (50%), Gaps = 7/195 (3%)

Query: 10  IGVVILFF-YSAIFPFNAAYPI--TKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGE 65
           IG V L   +SA      A P+  T  Q++    ++F S++ M G F+Q    G  ++G+
Sbjct: 24  IGSVPLTAEHSAAQTTQQAQPVALTNVQAIDAVSKYFNSVRNMHGKFVQFGPTGGRVEGQ 83

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQ 125
           FF++RP K  F Y+ PS++ +I+DGS ++V + KL T  ++PL       + ++   +  
Sbjct: 84  FFISRPGKVRFYYNKPSTLDIIADGSMVSVKDRKLQTQDIWPLSQTPLRFLLADKIDLKT 143

Query: 126 E-SIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
           + ++  V      ITI   D   F    +++ FD   Y+L  W + D+    + + I   
Sbjct: 144 DANVTNVVVEPDLITITIDDKTRFTSGRLTLIFDARDYKLKQWTVRDAQGYDTSVAIYDV 203

Query: 183 KENTVLDPKVFEIPY 197
            EN   +P +F+I Y
Sbjct: 204 VENGATNPDLFKIDY 218


>gi|115522425|ref|YP_779336.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris BisA53]
 gi|115516372|gb|ABJ04356.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris BisA53]
          Length = 282

 Score =  208 bits (531), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 39/177 (22%), Positives = 85/177 (48%), Gaps = 5/177 (2%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSL 86
           +   +     +   +  S+QT+ G F+Q    G   +G+F++ +P K  F+Y  PS +++
Sbjct: 100 FDANQKAQAARVSSYLSSLQTLVGNFVQVGPDGSRTQGDFYVQKPGKMRFEYDDPSPIAI 159

Query: 87  ISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKDD 145
           I+DGS++AV + KL T  +YPL       + S+   ++++ ++  V S+  +I++  ++ 
Sbjct: 160 IADGSSVAVRDRKLATQDIYPLSQTPLRYLLSDRIDLLRDTNVVSVSSDELYISVIIEEK 219

Query: 146 ---FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                 + + +       +L  W + D     + + +        LDP +F+I +  
Sbjct: 220 QVVVGTSRLLLMIGVKDGQLKQWTVTDPQGYDTTVAVYNLDATKKLDPGMFKIDFTN 276


>gi|91974923|ref|YP_567582.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris BisB5]
 gi|91681379|gb|ABE37681.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris BisB5]
          Length = 315

 Score =  207 bits (528), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 36/176 (20%), Positives = 82/176 (46%), Gaps = 5/176 (2%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSL 86
           +   +     +   +  S+ T+ G F+Q    G  +KG+F++ +P K  F+Y  PS +S+
Sbjct: 133 FDAKQKADAARVSAYLSSLSTLVGNFVQVGPDGSKLKGDFYIMKPGKVRFEYDEPSPISM 192

Query: 87  ISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSFITIFFKDD 145
           +++G ++ V + KL T  +YPL       + S+   +++++ +  + S+  +I+I  ++ 
Sbjct: 193 VANGQSLVVRDRKLATQDIYPLSQTPLRYLLSDRIDLLRDTSVVAITSDELYISIIIEEK 252

Query: 146 ---FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                 + + +       +L  W + D     + + I         DP +F+I + 
Sbjct: 253 NAVIGTSRLMLMLGVKDGQLKQWTVTDPQGYDTTVAIYNLDTARRPDPAMFKIDFT 308


>gi|319404824|emb|CBI78425.1| lipoprotein carrier protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 190

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 51/175 (29%), Positives = 80/175 (45%), Gaps = 3/175 (1%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVS 85
           +    +    +  I HF +I+ M G F+Q    G + KG F++ RP K  F Y     + 
Sbjct: 7   SQSAKQFARAQNIINHFAAIKVMTGDFIQFNPKGKMTKGTFYLERPGKIRFSYKG-VPLQ 65

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD 145
           +ISDG ++ V N  L+TWS Y L       +  N  H+  E++     +   I I  +D 
Sbjct: 66  VISDGKSVGVNNRALNTWSFYQLSQTPMKFLLGNVIHLSSENLLAFREDPKTIMIVLRDK 125

Query: 146 FMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            +G   I + FD  SY L  W I+D     + +KI+  + N      +F IP+  
Sbjct: 126 TIGKGQIKMIFDSQSYALRQWAILDQQNLETTVKIMNVRTNVRFSDDMFVIPHKN 180


>gi|319407784|emb|CBI81435.1| lipoprotein carrier protein [Bartonella sp. 1-1C]
          Length = 190

 Score =  204 bits (520), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 49/175 (28%), Positives = 81/175 (46%), Gaps = 3/175 (1%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVS 85
           +    +    +  I HF +I+ M G F+Q    G + KG F++ RP K  F Y     + 
Sbjct: 7   SQSAKQFARAQNIINHFAAIKVMTGDFIQFNPKGKMTKGTFYLERPGKIRFSYKG-VPLQ 65

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD 145
           +ISDG ++ + N  L+TWS Y L       +  N  H+  E++     + + I I  +D 
Sbjct: 66  IISDGKSVGINNRALNTWSFYQLSQTPMKFLLGNVIHLSSENLLAFREDPTTIMIVLRDK 125

Query: 146 FMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            +G   I + FD  +Y L  W I+D     + +KI+  + N      +F IP+  
Sbjct: 126 TIGKGQIKMIFDSQNYALRQWAILDQQNLETTVKIMNVRTNVRFSDDMFVIPHKN 180


>gi|217976523|ref|YP_002360670.1| outer membrane lipoprotein carrier protein LolA [Methylocella
           silvestris BL2]
 gi|217501899|gb|ACK49308.1| outer membrane lipoprotein carrier protein LolA [Methylocella
           silvestris BL2]
          Length = 227

 Score =  203 bits (518), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 44/175 (25%), Positives = 89/175 (50%), Gaps = 5/175 (2%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           +++KA ++F +  TM G F+Q    G   +G+ F+ RP K  F+Y+ P+++ +++DG ++
Sbjct: 52  AIQKANDYFNTATTMIGDFVQIGPDGRRAEGKIFVQRPGKLRFEYAPPATLEIVADGLSV 111

Query: 94  AVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKDDF---MGN 149
           AV++ K  T  VY +       +  ++  + ++  I  V S+ S + I  +D       +
Sbjct: 112 AVHDRKTATKDVYFISQTPLKFLLKDHVDLNRDVKIVNVASDPSSVVIQVEDTATFGGTS 171

Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
            I + FD   + L  W++ D     ++I +         DP +F++  ++I N N
Sbjct: 172 EIKLIFDPAKFTLKQWQVTDPQGYETVISLFNIDLTKKPDPNIFQLTQERIPNTN 226


>gi|163734297|ref|ZP_02141737.1| outer membrane lipoprotein carrier protein, putative [Roseobacter
           litoralis Och 149]
 gi|161392305|gb|EDQ16634.1| outer membrane lipoprotein carrier protein, putative [Roseobacter
           litoralis Och 149]
          Length = 200

 Score =  203 bits (518), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 41/201 (20%), Positives = 88/201 (43%), Gaps = 7/201 (3%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGE 65
            S+I  ++L    ++ P  AA    +   + +   +  S++T++G F Q  D G V  G+
Sbjct: 1   MSLISRILLVACLSLVP--AASGAAEQLKLAEISAYLNSLETLKGDFRQINDDGSVSTGQ 58

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW-SVYPLRYMAFSVIFSNNQHVI 124
            +M RP +  F+Y  P    +I+  S + + + K +     YPL     S++   +  + 
Sbjct: 59  LYMRRPGRMRFEYDPPEQALVIAAASAVVIIDRKSNQPSETYPLSRTPLSLLLGRDIDLT 118

Query: 125 QESIQ---RVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           + ++    R +   + +T    D+     + + F     RL  W I D+S   + + + +
Sbjct: 119 RAAMVRNARFDGTWTIVTAEDPDNLENGYLEMYFTDQPTRLEQWVIHDASGGRTRVVLGE 178

Query: 182 YKENTVLDPKVFEIPYDKIHN 202
           ++    L   +F+   +K  +
Sbjct: 179 FETGINLPNSLFDPDREKSRD 199


>gi|240140851|ref|YP_002965331.1| hypothetical protein MexAM1_META1p4423 [Methylobacterium extorquens
           AM1]
 gi|240010828|gb|ACS42054.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens AM1]
          Length = 315

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 86/196 (43%), Gaps = 8/196 (4%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMAR 70
           V  +   S       A P T    V  A  +F   QT+ G F+Q    G  + G+  +A+
Sbjct: 111 VAAVGAPSLGVSLQDADPAT---VVAAANSYFNGFQTLTGGFIQIGADGRRIGGKLTLAK 167

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQ 129
           P +  F+Y  PS + +++DG+++AV + KL T  +Y +       +      + ++ ++ 
Sbjct: 168 PGRLRFEYDQPSPLEVVADGTSVAVRDRKLGTQDLYFISQTPLKFLLREKIDLARDLTVS 227

Query: 130 RVESNNSFITIFFKDDF---MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
            V ++   + I  +D       + I + FD     L  W+I D     + +++   ++  
Sbjct: 228 EVTNDPGGVRIGLEDRSTLGGTSKIQLFFDAEMKTLSQWRITDPQGYLTTVQLSNLQKGK 287

Query: 187 VLDPKVFEIPYDKIHN 202
            +D  +F I Y +  +
Sbjct: 288 AVDGSLFFINYGRSED 303


>gi|154245784|ref|YP_001416742.1| outer membrane lipoprotein carrier protein LolA [Xanthobacter
           autotrophicus Py2]
 gi|154159869|gb|ABS67085.1| outer membrane lipoprotein carrier protein LolA [Xanthobacter
           autotrophicus Py2]
          Length = 312

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 47/193 (24%), Positives = 90/193 (46%), Gaps = 10/193 (5%)

Query: 18  YSAIFPFNAAYPITKD-----QSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARP 71
             A  P   A     D      +V +   ++ S+Q++ G F Q D  G    G+ +M +P
Sbjct: 118 AQAAGPQVQAAAANPDGRAPRATVDRVTNYYNSVQSLTGNFTQIDPDGTRRTGDVYMQKP 177

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQR 130
            +  F+Y +PS V LI++G ++AV + KL+T  + PL       + +    +  +  +  
Sbjct: 178 GRVRFEYDAPSPVELIANGQSVAVRDRKLNTQDITPLSQTPLRFLLAERIDLATDQHVAG 237

Query: 131 VESNNSFITIFFKD--DFMGN-MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
           V  ++ FI++  ++    MG   + + FD  +  L  W I D     + + +   + N  
Sbjct: 238 VFQDDKFISVIIQEQVPMMGTYRLLILFDAKTSALKQWIITDPQGYDTQVTLSNVQVNKK 297

Query: 188 LDPKVFEIPYDKI 200
            DPK+F I ++++
Sbjct: 298 PDPKLFVINFERM 310


>gi|218532291|ref|YP_002423107.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           chloromethanicum CM4]
 gi|254563360|ref|YP_003070455.1| hypothetical protein METDI5027 [Methylobacterium extorquens DM4]
 gi|218524594|gb|ACK85179.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           chloromethanicum CM4]
 gi|254270638|emb|CAX26642.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens DM4]
          Length = 315

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 86/196 (43%), Gaps = 8/196 (4%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMAR 70
           V  +   S       A P T    V  A  +F   QT+ G F+Q    G  + G+  +A+
Sbjct: 111 VAAVGAPSLGASLQDADPAT---VVAAANSYFNGFQTLTGGFIQIGADGRRIGGKLTLAK 167

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQ 129
           P +  F+Y  PS + +++DG+++AV + KL T  +Y +       +      + ++ ++ 
Sbjct: 168 PGRLRFEYDQPSPLEVVADGTSVAVRDRKLGTQDLYFISQTPLKFLLREKIDLARDLTVS 227

Query: 130 RVESNNSFITIFFKDDF---MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
            V ++   + I  +D       + I + FD     L  W+I D     + +++   ++  
Sbjct: 228 EVTNDPGGVRIGLEDRSTLGGTSKIQLFFDAEMKTLSQWRITDPQGYLTTVQLSNLQKGK 287

Query: 187 VLDPKVFEIPYDKIHN 202
            +D  +F I Y +  +
Sbjct: 288 AVDGSLFFINYGRSED 303


>gi|218514561|ref|ZP_03511401.1| putative outer membrane lipoproteins carrier protein [Rhizobium
           etli 8C-3]
          Length = 179

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 46/148 (31%), Positives = 78/148 (52%), Gaps = 3/148 (2%)

Query: 39  AIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
             +HF  + TMQG F+Q    G    G+FF+ RP K  F Y  PS + +I+DG N+A+ N
Sbjct: 26  IADHFSGVTTMQGEFVQFGPRGEQTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNVAIGN 85

Query: 98  AKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTF 155
            KL TW +YPL     S++ + +  +    ++ V+  +   TI   ++  F  + I++ F
Sbjct: 86  TKLKTWDLYPLSKTPLSLLLAQHIDLSAGMVKGVKEESDLTTIALGNNTVFGNSTITMMF 145

Query: 156 DRLSYRLLNWKIMDSSRRYSIIKILKYK 183
           D  +Y L  W I D+  + + + I + +
Sbjct: 146 DPKTYDLRQWTITDNQGKDTSVMIFQRQ 173


>gi|163853431|ref|YP_001641474.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           extorquens PA1]
 gi|163665036|gb|ABY32403.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           extorquens PA1]
          Length = 315

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 86/196 (43%), Gaps = 8/196 (4%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMAR 70
           V  +   S       A P T    V  A  +F   QT+ G F+Q    G  + G+  +A+
Sbjct: 111 VAAVGAPSLGASLQDADPAT---VVAAANSYFNGFQTLTGGFIQIGADGRRIGGKLTLAK 167

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQ 129
           P +  F+Y  PS + +++DG+++AV + KL T  +Y +       +      + ++ ++ 
Sbjct: 168 PGRLRFEYDQPSPLEVVADGTSVAVRDRKLGTQDLYFISQTPLKFLLREKIDLARDLTVS 227

Query: 130 RVESNNSFITIFFKDDF---MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
            V ++   + I  +D       + I + FD     L  W+I D     + +++   ++  
Sbjct: 228 EVTNDPGGVRIGLEDRSTLGGTSKIQLFFDAEMKTLSQWRITDPQGYLTTVQLSNLQKGK 287

Query: 187 VLDPKVFEIPYDKIHN 202
            +D  +F I Y +  +
Sbjct: 288 AVDGSLFFINYGRSED 303


>gi|13476677|ref|NP_108246.1| outer membrane lipoprotein carrier protein [Mesorhizobium loti
           MAFF303099]
 gi|14027438|dbj|BAB53707.1| outer membrane lipoprotein carrier protein [Mesorhizobium loti
           MAFF303099]
          Length = 210

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 53/206 (25%), Positives = 92/206 (44%), Gaps = 12/206 (5%)

Query: 7   KSVIGVVILFFYSAI-----FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GY 60
           + ++    + F ++       P  +A P+          +HF S+++M G F+Q D  G 
Sbjct: 5   RRLLAFCFVVFSASAINFELTPAVSAAPVD----AVAIADHFSSVKSMSGNFVQSDPRGE 60

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
              G FF+ RP K  F Y+  S +SLI+DG ++ +YN KL T  +Y L      ++  + 
Sbjct: 61  KTSGRFFLQRPGKIRFNYTGQSGISLIADGQSVVIYNKKLKTSRLYALSKTPLKLLLDDK 120

Query: 121 QHVIQESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
                  ++ ++ + + +TI   D   F  + I++ FDR S  L  W I D   + + + 
Sbjct: 121 VEFSGNRLKGIKDDGAQVTIKLADKSAFGNSNITMVFDRKSLDLRRWSITDERGQSTTVT 180

Query: 179 ILKYKENTVLDPKVFEIPYDKIHNIN 204
           +   +E     P  F I Y      N
Sbjct: 181 LSNVREGVRAPPGTFMIDYAANRAFN 206


>gi|188583703|ref|YP_001927148.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           populi BJ001]
 gi|179347201|gb|ACB82613.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           populi BJ001]
          Length = 314

 Score =  201 bits (512), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 39/193 (20%), Positives = 84/193 (43%), Gaps = 5/193 (2%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSK 73
           +    A     +         V  A  +F   QT+ G F+Q    G  + G+  +A+P +
Sbjct: 110 VAAVGAPNLGASLQDADPATVVAAANAYFNGFQTLTGGFIQIGADGRRIGGKLTLAKPGR 169

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVE 132
             F+Y  PS + +++DG+++AV + KL T  +Y +       +  +   + ++ ++  V 
Sbjct: 170 LRFEYDQPSPLEVVADGTSVAVRDRKLGTQDLYFISQTPLKFLLRDKIDLARDLTVTEVT 229

Query: 133 SNNSFITIFFKDDF---MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLD 189
           ++   + I  +D       + I + FD     L  W+I D     + +++   ++   +D
Sbjct: 230 NDPGGVRIALEDRSTLGGTSKIQLFFDGELKTLSQWRITDPQGYLTTVQLSNLQKGKAVD 289

Query: 190 PKVFEIPYDKIHN 202
             +F I Y +  +
Sbjct: 290 GSLFFINYGRSED 302


>gi|222087553|ref|YP_002546090.1| outer membrane lipoproteins carrier protein [Agrobacterium
           radiobacter K84]
 gi|221725001|gb|ACM28157.1| outer membrane lipoproteins carrier protein [Agrobacterium
           radiobacter K84]
          Length = 216

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 51/168 (30%), Positives = 86/168 (51%), Gaps = 3/168 (1%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
             ++  +HF SI+TM+G FLQ    G  + G FF+ RP K  F Y  PS + +I DG+N+
Sbjct: 49  VAQQIADHFSSIKTMKGGFLQIGPRGDQVSGSFFIQRPGKMRFNYDPPSRMRVICDGNNV 108

Query: 94  AVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSF--ITIFFKDDFMGNMI 151
            V N +  T ++Y L     S++ +N   +  + ++ V++      IT+  +  F  + I
Sbjct: 109 QVINDQTRTKNMYQLSKTPLSLLLANKIDLSADMVRGVDAQPDLTKITLGNRTVFGDSTI 168

Query: 152 SVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           ++ FD  +Y L  W ++D   + + + I   K N   D  VF I Y +
Sbjct: 169 AMIFDSKTYDLRQWTVIDPQGKTTDVIINNVKTNVSFDDSVFRIDYTR 216


>gi|220922844|ref|YP_002498146.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           nodulans ORS 2060]
 gi|219947451|gb|ACL57843.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           nodulans ORS 2060]
          Length = 332

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 84/187 (44%), Gaps = 8/187 (4%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYS 79
               +A  P      +++A  +F  + T+ G F+Q    G  + G+ ++A+P +  F Y 
Sbjct: 136 PVAVDAGNPTA---VIERANAYFNGVSTLTGNFVQIGADGRKIGGKLYLAKPGRLRFDYD 192

Query: 80  SPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFI 138
            PS + +++DG+++AV + KL T  +Y +       +  +   + ++ ++  V ++   +
Sbjct: 193 QPSPLEVVADGTSVAVRDRKLATQDLYFISQTPLKFLLRDRIDLARDLTVTDVSADPGGV 252

Query: 139 TIFFKDDF---MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
            I  +D       + I + FD     L  W+I D     + + +   +    +D  +F I
Sbjct: 253 RISLEDRSTLGGTSRIVLLFDEAMKSLSQWRITDPQGYQTTVLLSNLQRGRPIDGMMFVI 312

Query: 196 PYDKIHN 202
            Y +  +
Sbjct: 313 NYGRAED 319


>gi|182677441|ref|YP_001831587.1| outer membrane lipoprotein carrier protein LolA [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182633324|gb|ACB94098.1| outer membrane lipoprotein carrier protein LolA [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 268

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 42/177 (23%), Positives = 92/177 (51%), Gaps = 5/177 (2%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLI 87
           P+ +  +++KA  +F S  TM G F+Q    G   +G+ ++ RP +  F+Y++P+++ ++
Sbjct: 92  PLDQATAIQKANAYFSSAITMVGDFVQVGSDGRRTEGKLYVQRPGRLRFEYAAPATLEIV 151

Query: 88  SDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKDDF 146
           +DG ++AV++ +  T  VY +       +  +   + Q+  +  V+S+ S +TI  +D  
Sbjct: 152 ADGLSLAVHDRRTATKDVYFISQTPLKFLLKDQVDLAQDVKVVEVQSDPSAVTIIIEDKA 211

Query: 147 ---MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
                + I++ FD + + L  WK+ D     +++ +         DP +F++  D +
Sbjct: 212 TFGGTSRINLVFDPVKFTLKQWKVTDPQGYETLVSLFNLDLTKKPDPALFQLTQDHL 268


>gi|154251752|ref|YP_001412576.1| outer membrane lipoprotein carrier protein LolA [Parvibaculum
           lavamentivorans DS-1]
 gi|154155702|gb|ABS62919.1| outer membrane lipoprotein carrier protein LolA [Parvibaculum
           lavamentivorans DS-1]
          Length = 243

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 87/186 (46%), Gaps = 5/186 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSP 81
              A      ++++++A  +  +++ +QG FLQ    G V +G+F++ RP +  F+Y  P
Sbjct: 56  ASEAQRSAEDEKALEQASAYLGALENLQGNFLQVGPDGSVAEGKFYLRRPGRLRFEYEPP 115

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI-QESIQRVESNNS--FI 138
            ++ +++DG+ +AV ++       YP+     +++   N  +     +  VE+      I
Sbjct: 116 ENLLVVADGTWVAVKDS-SAPAQRYPMASTPLNLLLGKNVDLTESARVLNVETQPGALLI 174

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           T+  +       I++ FD+ + +L  W + D+    + + +   ++    D  +F +  D
Sbjct: 175 TLADRSGEAPGKITLIFDQPALQLRQWVVTDAQGLQTTVALRNVQQGIRADNALFVLRDD 234

Query: 199 KIHNIN 204
           +   I 
Sbjct: 235 QRPEIG 240


>gi|149915476|ref|ZP_01904003.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseobacter sp. AzwK-3b]
 gi|149810765|gb|EDM70606.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseobacter sp. AzwK-3b]
          Length = 202

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 42/194 (21%), Positives = 72/194 (37%), Gaps = 6/194 (3%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIE-HFLSIQTMQGTFLQ-EDAGYVMKGEFFMARP 71
           +    S       A P   ++    AI  +   +QT QG F Q  D G +  G  ++ RP
Sbjct: 4   LAILTSIALSVAMALPAAAEKLSLGAISGYLNGLQTAQGAFTQINDDGTISTGRIYIKRP 63

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQR 130
            +  F+Y  P    +++DG  + + + K +T    YPL      +I + N  + +E +  
Sbjct: 64  GRVRFEYDPPDQTLVVADGDTVGIVDPKSNTGPEAYPLHRTPLKIILARNVDLTRERMVT 123

Query: 131 VESNNSFITIFFKDDFMG---NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
             +++   T     D        I + F      L  W I DS    + + +   +    
Sbjct: 124 GHASDGTSTTIRAQDPDNPEYGSIDLVFTADPIELRQWVINDSGGGRTTVVLGDLRTGMQ 183

Query: 188 LDPKVFEIPYDKIH 201
           L    F IP     
Sbjct: 184 LANDRFVIPGKGPE 197


>gi|170743017|ref|YP_001771672.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           sp. 4-46]
 gi|168197291|gb|ACA19238.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           sp. 4-46]
          Length = 313

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 41/186 (22%), Positives = 86/186 (46%), Gaps = 6/186 (3%)

Query: 23  PFNAAYPITKDQSV-KKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSS 80
              AA  ++   +V ++A  +F S+ T+ G F+Q    G  + G+ ++A+P +  F Y  
Sbjct: 115 TTPAAVDLSNPAAVVERANGYFNSVSTLTGNFVQIAADGRKIGGKLYLAKPGRLRFDYDQ 174

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFIT 139
           PS + +++DG+++AV + KL T  +Y +       +  +   + ++ S+  V +    + 
Sbjct: 175 PSPLEVVADGTSVAVRDRKLATQDLYFISQTPLKFLLRDRIDLARDLSVTDVSTEPGGVR 234

Query: 140 IFFKDDF---MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
           I  +D       + I + FD     L  W+I D     + + +   +    +D  +F I 
Sbjct: 235 ISLEDRSTLGGTSRIVLVFDEAMKSLSQWRITDPQGYQTTVLLSNLQRGRPIDGMMFVIN 294

Query: 197 YDKIHN 202
           Y +  +
Sbjct: 295 YGRPED 300


>gi|298293366|ref|YP_003695305.1| outer membrane lipoprotein carrier protein LolA [Starkeya novella
           DSM 506]
 gi|296929877|gb|ADH90686.1| outer membrane lipoprotein carrier protein LolA [Starkeya novella
           DSM 506]
          Length = 252

 Score =  197 bits (502), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 80/169 (47%), Gaps = 5/169 (2%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           +V++   +F S + M G F+Q D  G   +G+FF+ +P +  F+Y  PS + L++DG ++
Sbjct: 84  TVQRINTYFNSFKNMTGNFVQVDPDGTRRQGQFFILKPGRVLFEYDPPSRIELVADGRSV 143

Query: 94  AVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFF--KDDFMGN- 149
           AV + +L T  + PL       + S N  + +  ++  V  ++ F T+    +    G  
Sbjct: 144 AVRDKRLKTQDISPLSATPLRFLLSENFDLARNANVTGVYQDDLFATVVIEERQAMTGTY 203

Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
            + + FD  + +L  W + D     + + +         DP +F I  D
Sbjct: 204 KLMIMFDAKTMQLKQWTVTDPQGYDTTVAVSNLDTGERPDPMLFVINRD 252


>gi|114327250|ref|YP_744407.1| outer-membrane lipoproteins carrier protein [Granulibacter
           bethesdensis CGDNIH1]
 gi|114315424|gb|ABI61484.1| outer-membrane lipoproteins carrier protein [Granulibacter
           bethesdensis CGDNIH1]
          Length = 231

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 31/192 (16%), Positives = 82/192 (42%), Gaps = 5/192 (2%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKG 64
            + ++G ++     A+    A    + D  + +   +   I T++  F Q    G V +G
Sbjct: 32  RRQILGGILASLAGAVV-VPARAEESDDALLARIAAYLNGIHTLRARFRQTAPDGQVTQG 90

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
             ++ RP    F+Y  P+ + L++    +   + ++   S  PL     S++ S++    
Sbjct: 91  TVWLERPGHIRFQYDPPTPLLLVATNGEVIFQDFQVHQVSRIPLDRTPLSILLSDHIDFN 150

Query: 125 Q-ESIQRVESNNSFI--TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
              +++ +      I  ++  + D    ++++ F     +L+ W ++D   + + +++  
Sbjct: 151 GAAAVREISRTPGVIQLSVVRRTDPGAGLLAIVFSADPLKLIQWTVVDPQHKITRVELSN 210

Query: 182 YKENTVLDPKVF 193
            +    +DP +F
Sbjct: 211 IQTGIPVDPTLF 222


>gi|158421719|ref|YP_001523011.1| putative outer membrane lipoprotein-sorting protein [Azorhizobium
           caulinodans ORS 571]
 gi|158328608|dbj|BAF86093.1| putative outer membrane lipoprotein-sorting protein [Azorhizobium
           caulinodans ORS 571]
          Length = 357

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 44/168 (26%), Positives = 84/168 (50%), Gaps = 5/168 (2%)

Query: 34  QSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSN 92
            +++K   ++ S+QT+ GTF+Q D  G    G+F+M +P +  F+Y+ P+ + LIS+G N
Sbjct: 190 ATIEKLTTYWNSVQTLVGTFVQVDADGTRKTGDFYMQKPGRVRFEYNPPTQIQLISNGQN 249

Query: 93  IAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKD--DFMGN 149
           +AV + +L+T  + PL       I +    + +  ++  V  +N +I +  ++    MG 
Sbjct: 250 VAVRDRRLNTQDLTPLNQTPLRFILAERIDLTRNSNVLGVYQDNLYIQVIMQESVPMMGT 309

Query: 150 -MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
             + + FD   ++L  W + D     + + I         DP +F I 
Sbjct: 310 YRLQILFDAKDFQLRQWTVTDPQGYDTSVAIYDLNYTQRPDPSLFVIN 357


>gi|46201081|ref|ZP_00055780.2| COG2834: Outer membrane lipoprotein-sorting protein
           [Magnetospirillum magnetotacticum MS-1]
          Length = 209

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 41/197 (20%), Positives = 89/197 (45%), Gaps = 5/197 (2%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEF 66
           +V+  ++L    A  P            +++A ++   + T++  FLQ    G  ++G+ 
Sbjct: 3   AVLCSLLLTTAQAAQPARLPLSAQDKADIERAEDYLNGVTTLKARFLQVSPNGASVEGDA 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE 126
           +++RP K   +Y  PS + +++DGS + V++ +L   S  PL      ++   N  +   
Sbjct: 63  YLSRPGKLRLQYDPPSPLLVVADGSFLIVHDQQLGEPSYIPLGSTPAGILVRPNVRLNGG 122

Query: 127 --SIQRVESNNSF--ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
             ++ RV        I++   +D     I++ F    + L  W++ D+  + + + + + 
Sbjct: 123 DVAVTRVVRLPGVVRISVVEAEDPASGEITLVFSDKPFALRQWQVKDAQHQVTTVSLYQA 182

Query: 183 KENTVLDPKVFEIPYDK 199
           +    LD K+FE    K
Sbjct: 183 QSGLTLDAKLFEFKNPK 199


>gi|90421801|ref|YP_530171.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris BisB18]
 gi|90103815|gb|ABD85852.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris BisB18]
          Length = 280

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 39/184 (21%), Positives = 85/184 (46%), Gaps = 5/184 (2%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYS 79
             P    +   +     K   +  S+ T+ G F+Q    G   KG+F++ +P K  F+Y 
Sbjct: 91  PSPLFVTFDAQQKAQAAKVSSYLSSLSTLVGNFVQVGPDGSRTKGDFYIQKPGKVRFEYD 150

Query: 80  SPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFI 138
            PS +++I+DG+++AV + KL T  +YPL       + S+   ++++ ++  V +++ FI
Sbjct: 151 EPSPIAIIADGNSVAVRDRKLATQDIYPLSQTPLRYLLSDRIDLLRDTNVVSVTADDVFI 210

Query: 139 TIFFKDD---FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
           ++  ++       + + +       +L  W + D     + + +         DP +F+I
Sbjct: 211 SVVIEEKQVLVGTSRLMLMIGAKDNQLKQWTVTDPQGYDTTVAVYNLDATKKPDPGMFKI 270

Query: 196 PYDK 199
            +  
Sbjct: 271 DFTN 274


>gi|319782044|ref|YP_004141520.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317167932|gb|ADV11470.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 211

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 47/172 (27%), Positives = 75/172 (43%), Gaps = 3/172 (1%)

Query: 36  VKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
            K   +H  S+++M G F+Q        +G FF+ RP K  F Y+  S +S+I+DG ++ 
Sbjct: 36  AKTIADHLSSVKSMSGDFVQSGPNAERTRGRFFLQRPGKIRFNYAGQSGISVIADGKSLV 95

Query: 95  VYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD--FMGNMIS 152
           VYN KL T  +Y L      ++  N        ++ V  + + +T+   D   F  + IS
Sbjct: 96  VYNRKLKTSRLYALSKTPLKLLLDNKVDFSGNRVKSVRDDGAQVTVKLSDRSTFGNSSIS 155

Query: 153 VTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
           + FD  S  L  W + D     + + I   K+        F I Y      N
Sbjct: 156 MVFDSKSLDLRRWSLTDEKGLTTTVNISNVKQGVRAPEGTFVIDYTANREFN 207


>gi|83952503|ref|ZP_00961234.1| Putative outer membrane lipoprotein carrier protein [Roseovarius
           nubinhibens ISM]
 gi|83836176|gb|EAP75474.1| Putative outer membrane lipoprotein carrier protein [Roseovarius
           nubinhibens ISM]
          Length = 206

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 46/195 (23%), Positives = 73/195 (37%), Gaps = 7/195 (3%)

Query: 14  ILFFYSAIFPFNAAYPITKDQ--SVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMAR 70
           IL   +A     A  P T  +  S+ +   +   I T  G F Q  D G V KG   + R
Sbjct: 7   ILATGAACVALAAPIPATAAEKLSLGEISRYLNGITTASGDFTQINDDGTVSKGRVIIKR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLD-TWSVYPLRYMAFSVIFSNNQHVIQESIQ 129
           P +  F+Y+ P    ++SDGS + V + K +     +PL     S+I + N  + +  + 
Sbjct: 67  PGRVRFEYAPPDRTLVVSDGSTVGVIDGKSNEPPQGFPLNRTPLSIILARNVDLTRARMV 126

Query: 130 RVESNNSFITIFFKDDFM---GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
                +   TI    D        I + F      L  W I D     + + +   ++  
Sbjct: 127 TGHRVDGAKTIVQAQDPAHPEYGNIELVFTGSPVELRQWIINDGDGARTTVVLGGLRKGG 186

Query: 187 VLDPKVFEIPYDKIH 201
                 F IP  K  
Sbjct: 187 NFSNDKFVIPGLKPG 201


>gi|85704070|ref|ZP_01035173.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseovarius sp. 217]
 gi|85671390|gb|EAQ26248.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseovarius sp. 217]
          Length = 201

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 34/172 (19%), Positives = 67/172 (38%), Gaps = 5/172 (2%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           +  S+ +   +   ++T QG F Q  + G +  G   + RP +  F+Y  P    +++DG
Sbjct: 23  EKLSLGEISTYLNGLKTAQGAFTQINEDGTISTGRILIKRPGRVRFEYDPPEEALVVADG 82

Query: 91  SNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG- 148
             + + + + +     YPL      +I + N  + +E +     ++   T     D    
Sbjct: 83  DTVGIIDPRSNDGPQGYPLNRTPLKIILARNVDLTRERMVVGYGSDGTSTTVRAQDPANP 142

Query: 149 --NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
               I + F      L  W I D S   + + +   + +  L+   F IP  
Sbjct: 143 EYGSIDLVFTGNPVELRQWVIHDGSGSQTTVVLGDMQRDVRLNDDSFVIPGK 194


>gi|149204851|ref|ZP_01881813.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseovarius sp. TM1035]
 gi|149141721|gb|EDM29776.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseovarius sp. TM1035]
          Length = 201

 Score =  191 bits (486), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 35/178 (19%), Positives = 73/178 (41%), Gaps = 5/178 (2%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           +  S+ +   +   ++T QG F Q  + G +  G   + RP +  F+Y  P    +++DG
Sbjct: 23  EKLSLPEISNYLNGLRTAQGAFTQINEDGTISTGRILIKRPGRVRFEYDPPEQALVVADG 82

Query: 91  SNIAVYNAKLDTWSV-YPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG- 148
             + + + + +   V YPL      +I + N  + +E +    +++   T     D    
Sbjct: 83  DTVGIIDPRSNDGPVGYPLHRTPLKIILARNVDLTRERMVVGHASDGTSTTVRAQDPANP 142

Query: 149 --NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
               I + F      L  W I D S   + + +   + +  L+ + F IP  +   ++
Sbjct: 143 EYGSIDLVFTGSPVELRQWVIHDGSGSQTTVVLGDMQRDVRLNDESFVIPGKERMRVD 200


>gi|254474341|ref|ZP_05087727.1| outer membrane lipoprotein carrier protein LolA [Ruegeria sp. R11]
 gi|214028584|gb|EEB69419.1| outer membrane lipoprotein carrier protein LolA [Ruegeria sp. R11]
          Length = 195

 Score =  191 bits (485), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 41/193 (21%), Positives = 75/193 (38%), Gaps = 11/193 (5%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGE 65
           K +   + L   S      +A    +  S+ +  ++   I T Q  F Q  D G +  G+
Sbjct: 2   KQIACALALTLCS------SAAWAAEKLSLNEVSQYLNGITTAQAPFSQINDDGSLSTGK 55

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVI 124
            +M RP K  F+Y +P+S  +I+    + + + K +     YPL+    S+I +    + 
Sbjct: 56  LYMHRPGKMRFEYDAPNSGVVIAGAGAVVIQDPKSNQPPETYPLKRTPLSLILARTVKLG 115

Query: 125 QESIQRVESNNSFITIFFKDDFMG---NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           Q ++      +   TI    D        I + F      L  W I D S   + + +  
Sbjct: 116 QANMVVGHDFDGTSTIVRAQDPKNPEYGSIEMMFTDSPVELRKWVIHDGSGGKTTVILGG 175

Query: 182 YKENTVLDPKVFE 194
            +    L  ++F 
Sbjct: 176 LETGVTLSSRLFN 188


>gi|296448304|ref|ZP_06890196.1| outer membrane lipoprotein carrier protein LolA [Methylosinus
           trichosporium OB3b]
 gi|296254181|gb|EFH01316.1| outer membrane lipoprotein carrier protein LolA [Methylosinus
           trichosporium OB3b]
          Length = 314

 Score =  190 bits (484), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 35/175 (20%), Positives = 84/175 (48%), Gaps = 5/175 (2%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLI 87
           P+ + +++K+A     +   M   F+Q    G   +G  F+ +  +  F+Y+ P+++ ++
Sbjct: 140 PLDRAEAIKRAEASLNASPVMTADFVQIGGDGRRAEGRLFIHKVGRMRFEYAQPATMEVV 199

Query: 88  SDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKDDF 146
           SDG  +AV + KL+T  +Y +       + +    + ++  +  V  +++   I  +D  
Sbjct: 200 SDGVTVAVRDRKLNTQDLYFIAQTPLKFLLNEKIDLEKDVKLLDVVIDDAGAAIIIEDKA 259

Query: 147 ---MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                + I + FD  ++ L  W++ D     +++ +     ++  DPK+F++  D
Sbjct: 260 TLGGTSKIKLLFDAKTFDLKQWQVTDPQGYETLVSLFNIDRDSAPDPKLFKVARD 314


>gi|312114954|ref|YP_004012550.1| outer membrane lipoprotein carrier protein LolA [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311220083|gb|ADP71451.1| outer membrane lipoprotein carrier protein LolA [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 292

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 52/180 (28%), Positives = 87/180 (48%), Gaps = 6/180 (3%)

Query: 21  IFPFNAAYPITKD--QSVKKAIEHFLSIQTMQGTFLQEDAGYVMK-GEFFMARPSKFYFK 77
           + P  AA PI +   + V K  ++F  +  +QG F+Q D     K G+F++AR  K  F 
Sbjct: 102 VTPEPAAAPIQESDLEVVAKINDYFNKMTFLQGVFVQSDPDTKQKRGKFYLARGGKVRFD 161

Query: 78  YSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNS 136
           Y +PS + +I+DG  +A+ +  L+T   YPL    F ++ S +  +I + +I  VE    
Sbjct: 162 YGAPSRLKIIADGKYLAIEDHDLNTSDRYPLEVTPFRLLLSEHVDLINDANILGVEQWTD 221

Query: 137 FITIFFKDDFMG--NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
            + +  +D        I + F +    L  W I D+    + I++   +EN    P VFE
Sbjct: 222 VVVLTVEDKKGDGSGRIRLMFSKPDMVLKEWIITDAQGLSTKIEVANLEENKAPAPDVFE 281


>gi|84500687|ref|ZP_00998936.1| outer membrane lipoprotein carrier protein LolA, putative
           [Oceanicola batsensis HTCC2597]
 gi|84391640|gb|EAQ03972.1| outer membrane lipoprotein carrier protein LolA, putative
           [Oceanicola batsensis HTCC2597]
          Length = 200

 Score =  188 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 38/172 (22%), Positives = 64/172 (37%), Gaps = 5/172 (2%)

Query: 36  VKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           +     +   I T Q  F Q    G V  G  ++ RP K  F+Y  P+   +I+D   + 
Sbjct: 28  LSTLSAYLNGITTAQAKFTQIAGDGTVSTGTLYLKRPGKMRFEYDPPNKSYVIADHGAVG 87

Query: 95  VYNAKLD-TWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG---NM 150
           +++ K D T   YPLR    S+I   +  + + ++      +   TI    D        
Sbjct: 88  IFDEKGDETVEQYPLRRTPLSIILDRHVDLGRANMVTGHREDGPSTIVRAQDPKNPEYGF 147

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
           I + F      L  W + D S   + + + + K    L   +F        N
Sbjct: 148 IELVFTGDPVELRQWVVHDDSGSATTVILGEMKTGIQLSQSLFNFQDGFRPN 199


>gi|110677451|ref|YP_680458.1| outer membrane lipoprotein carrier protein, putative [Roseobacter
           denitrificans OCh 114]
 gi|109453567|gb|ABG29772.1| outer membrane lipoprotein carrier protein, putative [Roseobacter
           denitrificans OCh 114]
          Length = 186

 Score =  188 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 36/184 (19%), Positives = 78/184 (42%), Gaps = 5/184 (2%)

Query: 24  FNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPS 82
              A    +   + +   +  S++T++GTF Q  D G V  G+ ++ RP +  F+Y  P 
Sbjct: 2   IPVASAAAEQLKLAEISAYLNSLETLKGTFRQINDDGSVSTGQLYIRRPGRMRFEYDPPE 61

Query: 83  SVSLISDGSNIAVYNAKLDTW-SVYPLRYMAFSVIFSNNQHVIQESIQ---RVESNNSFI 138
              +I+  S + + + K +     YPL     S++   +  + + ++    R +   + +
Sbjct: 62  QALVIAAASAVVIIDRKSNQPSETYPLSRTPLSLLLGRDIDLTRAAMVRNARFDGTATIV 121

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           T    D+     + + F     RL  W I D+S   + + +  ++    L   +F+   +
Sbjct: 122 TAEDPDNLENGFLEMYFTDQPTRLEQWVIHDASGAQTRVILDAFETGMELPNSLFDADRE 181

Query: 199 KIHN 202
           K  +
Sbjct: 182 KGRD 185


>gi|260574467|ref|ZP_05842471.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter sp.
           SW2]
 gi|259023363|gb|EEW26655.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter sp.
           SW2]
          Length = 215

 Score =  188 bits (478), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 69/180 (38%), Gaps = 5/180 (2%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLI 87
            + +   + K   +   + T +  F Q    G +  G  ++ RP +  F+Y+ P    ++
Sbjct: 35  ALAEKIPLAKISSYLNGLTTAEAEFTQINGDGSITSGRLYIKRPGRVRFEYAPPDKSLVM 94

Query: 88  SDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFIT-IFFKDD 145
           + G  +A+++AK +     YPL     ++I + N  + +  +    S +   T +  +D 
Sbjct: 95  AGGGQVAIFDAKSNQPPEQYPLARTPLNLILAANVDLGRAKMVTGHSEDGTSTRVQAQDP 154

Query: 146 FMG--NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
                  I + F      L  W I D     + + + +  +       +F I  +    +
Sbjct: 155 EHPEYGSIEMVFTANPTELRQWVITDDGGNQTTVILGEMSKGGSYPASLFNITTETSKRL 214


>gi|323138222|ref|ZP_08073294.1| outer membrane lipoprotein carrier protein LolA [Methylocystis sp.
           ATCC 49242]
 gi|322396474|gb|EFX99003.1| outer membrane lipoprotein carrier protein LolA [Methylocystis sp.
           ATCC 49242]
          Length = 257

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 37/171 (21%), Positives = 88/171 (51%), Gaps = 5/171 (2%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLIS 88
           + +++++K+A   F +   M   F+Q    G   +G+  + R  +  F+Y+ P+++ +++
Sbjct: 85  LNREEAIKRANAFFNTSPVMTADFVQIGADGKRSEGKLHVQRAGRVRFEYAQPATMEVVA 144

Query: 89  DGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKDDF- 146
           DG+ +AV + KL T  +Y +       +  +   + ++ ++Q V  ++S +TIF +D   
Sbjct: 145 DGAQVAVRDRKLGTQDLYFITQTPLKFLMKDKIDLEKDVTVQDVTFDDSGVTIFIEDKAT 204

Query: 147 --MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
               + + + FD  +++L  W++ D     ++I +    +    DP +F+I
Sbjct: 205 FGGTSHLRLIFDPKTFKLKQWQVKDPQGYETLISLFNIDQTKTPDPGLFKI 255


>gi|192288714|ref|YP_001989319.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris TIE-1]
 gi|192282463|gb|ACE98843.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris TIE-1]
          Length = 313

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 37/168 (22%), Positives = 74/168 (44%), Gaps = 5/168 (2%)

Query: 40  IEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNA 98
             +  S+QT+ G F+Q    G  + G+F++ +P +  F+Y  PS +S+I+DG ++ V + 
Sbjct: 143 STYLSSLQTLVGQFVQVGPDGSKLTGDFYIMKPGRVRFEYDDPSPISMIADGQSVVVRDR 202

Query: 99  KLDTWSVYPLRYMAFSV-IFSNNQHVIQESIQRVESNNSFITIFFKDD---FMGNMISVT 154
           KL T  VYPL        +      +   ++  + S++ +  I  ++       + + + 
Sbjct: 203 KLATQDVYPLSQTPLRYLLSDRLDLLRDTNVVSITSDDLYSNIIIEEKNAVIGTSRLLLM 262

Query: 155 FDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
           F     +L  W + D     + + +         DP +F+I Y     
Sbjct: 263 FGTKDGQLKQWTVTDPQGYDTTVAVYNLDTTRRPDPSMFKIDYTNYGT 310


>gi|39933357|ref|NP_945633.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris CGA009]
 gi|39652982|emb|CAE25724.1| unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 313

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 37/168 (22%), Positives = 74/168 (44%), Gaps = 5/168 (2%)

Query: 40  IEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNA 98
             +  S+QT+ G F+Q    G  + G+F++ +P +  F+Y  PS +S+I+DG ++ V + 
Sbjct: 143 STYLSSLQTLVGQFVQVGPDGSKLTGDFYIMKPGRVRFEYDDPSPISMIADGQSVVVRDR 202

Query: 99  KLDTWSVYPLRYMAFSV-IFSNNQHVIQESIQRVESNNSFITIFFKDD---FMGNMISVT 154
           KL T  VYPL        +      +   ++  + S++ +  I  ++       + + + 
Sbjct: 203 KLATQDVYPLSQTPLRYLLSDRLDLLRDTNVVSITSDDLYSNIIIEEKNAVIGTSRLLLM 262

Query: 155 FDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
           F     +L  W + D     + + +         DP +F+I Y     
Sbjct: 263 FGTKDGQLKQWTVTDPQGYDTTVAVYNLDTTRRPDPSMFKIDYTNYGT 310


>gi|83855249|ref|ZP_00948779.1| outer membrane lipoprotein carrier protein LolA, putative
           [Sulfitobacter sp. NAS-14.1]
 gi|83843092|gb|EAP82259.1| outer membrane lipoprotein carrier protein LolA, putative
           [Sulfitobacter sp. NAS-14.1]
          Length = 201

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 39/178 (21%), Positives = 75/178 (42%), Gaps = 6/178 (3%)

Query: 24  FNAAYPITKDQSVKKAIE-HFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSP 81
             A  P   D+    AI  +   ++T +G F Q  D G +  G  ++ RP K  F+Y++P
Sbjct: 16  LAAVMPAAADKLPLNAISGYLNDLKTAKGEFTQINDDGSISTGTIYIKRPGKVRFEYNAP 75

Query: 82  SSVSLISDGSNIAVYNAKLDTW-SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITI 140
            S  +++  + + +Y+ K +     YPL     S+I + N ++ Q  +    + +   T 
Sbjct: 76  DSGIVVAGSNTVVIYDKKSNQPAETYPLSKTPLSIILAANVNLGQAKMVTGHNYDGTATT 135

Query: 141 FFKDDFM---GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
               D        I + F      L  W I D +   + + +   ++   L  K+F++
Sbjct: 136 VRAQDPAHPEYGNIELKFTGNPVELRQWIINDGNGTKTTVVLGDLQKGGSLPNKLFDV 193


>gi|83941771|ref|ZP_00954233.1| outer membrane lipoprotein carrier protein LolA, putative
           [Sulfitobacter sp. EE-36]
 gi|83847591|gb|EAP85466.1| outer membrane lipoprotein carrier protein LolA, putative
           [Sulfitobacter sp. EE-36]
          Length = 200

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 39/178 (21%), Positives = 75/178 (42%), Gaps = 6/178 (3%)

Query: 24  FNAAYPITKDQSVKKAIE-HFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSP 81
             A  P   D+    AI  +   ++T +G F Q  D G +  G  ++ RP K  F+Y++P
Sbjct: 15  LAAVMPAAADKLPLNAISGYLNDLKTAKGEFTQINDDGSISTGTIYIKRPGKVRFEYNAP 74

Query: 82  SSVSLISDGSNIAVYNAKLDTW-SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITI 140
            S  +++  + + +Y+ K +     YPL     S+I + N ++ Q  +    + +   T 
Sbjct: 75  DSGIVVAGSNTVVIYDKKSNQPAETYPLSKTPLSIILAANVNLGQAKMVTGHNYDGTATT 134

Query: 141 FFKDDFM---GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
               D        I + F      L  W I D +   + + +   ++   L  K+F++
Sbjct: 135 VRAQDPAHPEYGNIELKFTGNPVELRQWIINDGNGTKTTVVLGDLQKGGSLPNKLFDV 192


>gi|83309116|ref|YP_419380.1| Outer membrane lipoprotein-sorting protein [Magnetospirillum
           magneticum AMB-1]
 gi|82943957|dbj|BAE48821.1| Outer membrane lipoprotein-sorting protein [Magnetospirillum
           magneticum AMB-1]
          Length = 218

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 39/189 (20%), Positives = 82/189 (43%), Gaps = 5/189 (2%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKF 74
               A  P            + +A E+   + T++  FLQ    G  ++G+ +++RP K 
Sbjct: 20  VTAEAAQPARTPLTAQDKADIARAEEYLNGVTTLKARFLQVSPNGASVEGDAYLSRPGKL 79

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE--SIQRVE 132
             +Y  PS + +++DGS + V++++L   S  PL      ++      +     ++ RV 
Sbjct: 80  RLQYDPPSPLLVVADGSFLIVHDSQLGEPSYIPLGSTPAGILVRPGVKLDGADVAVTRVV 139

Query: 133 SNNSF--ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
                  I++   +D     I++ F    + L  W++ D+  + + + + + +    LD 
Sbjct: 140 RLPGVVRISVVEAEDPAAGEITLVFSDKPFALRQWQVKDAQHQVTTVSLYQSQSGLSLDS 199

Query: 191 KVFEIPYDK 199
           K+FE    K
Sbjct: 200 KLFEFKNPK 208


>gi|295691546|ref|YP_003595239.1| outer membrane lipoprotein carrier protein LolA [Caulobacter segnis
           ATCC 21756]
 gi|295433449|gb|ADG12621.1| outer membrane lipoprotein carrier protein LolA [Caulobacter segnis
           ATCC 21756]
          Length = 218

 Score =  185 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 42/185 (22%), Positives = 86/185 (46%), Gaps = 4/185 (2%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYS 79
             P  AA    +   V KA  +  S+ + +G F+Q DA G   +G F++ RP K  F Y 
Sbjct: 30  TAPVPAALTAEQKALVNKATAYVQSLGSAKGRFVQTDARGTRTQGTFYLQRPGKARFAYD 89

Query: 80  SPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI-QRVESNNSFI 138
           +P+ + ++S+G+N+ +++++L T+  YPL     +++ +    + +  +   V       
Sbjct: 90  APAGLLVVSNGNNVNIWDSRLKTYESYPLSKTPLNLLLAREVRLDRGVVITDVRRLADGF 149

Query: 139 TIFFKDDFMG--NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
           +I  +D        I++ F      L+ W + D       +++  +   + LDPK+F + 
Sbjct: 150 SIVAQDAKRQALGKIALDFSDGPVALMGWTVTDIKGGQIRVRLTDFGPASGLDPKLFVLT 209

Query: 197 YDKIH 201
             +  
Sbjct: 210 DPRPK 214


>gi|254449700|ref|ZP_05063137.1| twin-arginine translocation pathway signal [Octadecabacter
           antarcticus 238]
 gi|198264106|gb|EDY88376.1| twin-arginine translocation pathway signal [Octadecabacter
           antarcticus 238]
          Length = 205

 Score =  185 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 32/190 (16%), Positives = 78/190 (41%), Gaps = 5/190 (2%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPS 72
           ++    A+  F A+    +  S+ +   +  S  + +G F Q +  G +  G  F+ RP 
Sbjct: 10  LMAVPLALAGFAASPSFAQQLSLGQVSGYLNSFTSAEGAFTQINADGTISTGTIFIKRPG 69

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQRV 131
           +  F+Y+ P    +++ G  +A+++ + +     YPL     S+I   N    +  +   
Sbjct: 70  RVRFEYNPPEESLVVAGGGQVAIFDPRSNNGPDRYPLNQTPLSIILERNIDFTRTDMVTG 129

Query: 132 ESNNS---FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
            +++     +T    D      I + +      L  W + D + + + + +   +++  +
Sbjct: 130 HTSDGTKTTVTAQDPDHPEYGSIQMVYTANPVELRQWIVTDDTGQQTTVILGDLEKDGRV 189

Query: 189 DPKVFEIPYD 198
              +F I  +
Sbjct: 190 PDILFNIQRE 199


>gi|254487598|ref|ZP_05100803.1| outer membrane lipoprotein carrier protein LolA [Roseobacter sp.
           GAI101]
 gi|214044467|gb|EEB85105.1| outer membrane lipoprotein carrier protein LolA [Roseobacter sp.
           GAI101]
          Length = 201

 Score =  184 bits (467), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 44/201 (21%), Positives = 83/201 (41%), Gaps = 15/201 (7%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIE-HFLSIQTMQGTFLQ-EDA 58
           M F+       V+ L    A     +  P T +Q    AI  +  +++T +G F Q  D 
Sbjct: 1   MRFVTTT----VLALGLGLA-----SVLPATAEQLSLGAISKYLNAMKTAKGDFTQINDD 51

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW-SVYPLRYMAFSVIF 117
           G +  G  ++ RP K  F+Y++P S  +I+  + + +Y+ K +     YPL     S+I 
Sbjct: 52  GSISTGTIYIKRPGKVRFEYNAPDSGIVIAGSNTVVIYDKKSNQPAETYPLSKTPLSIIL 111

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDD---FMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           + N ++ Q  +    S +   T     D        I + F      L  W I + +   
Sbjct: 112 AANVNLGQARMVTGHSYDGTATTVRAQDPQHPEYGNIELKFTDNPIELRQWIINNGNGDQ 171

Query: 175 SIIKILKYKENTVLDPKVFEI 195
           + + +   ++   L   +F++
Sbjct: 172 TTVVLGDMQKGVSLPNSLFDV 192


>gi|16127935|ref|NP_422499.1| hypothetical protein CC_3705 [Caulobacter crescentus CB15]
 gi|221236756|ref|YP_002519193.1| outer-membrane lipoproteins carrier protein [Caulobacter crescentus
           NA1000]
 gi|13425471|gb|AAK25667.1| hypothetical protein CC_3705 [Caulobacter crescentus CB15]
 gi|220965929|gb|ACL97285.1| outer-membrane lipoproteins carrier protein [Caulobacter crescentus
           NA1000]
          Length = 219

 Score =  184 bits (467), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 41/191 (21%), Positives = 84/191 (43%), Gaps = 4/191 (2%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSK 73
            +   +  P  A     +   + KA  +   + + +G F+Q D  G   +G F++ RP K
Sbjct: 25  AWAQGSTAPVPAQLSAEQKALLDKATAYIQGLSSAKGRFVQTDQRGTQTQGTFYLQRPGK 84

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI-QRVE 132
             F Y  P+ + ++S+G+N+ +++++L T+  YPL     +++ +    + +  +   V 
Sbjct: 85  ARFAYDPPAGLLVVSNGNNVNIFDSRLKTYESYPLSKTPLNLLLAREVRLDRGVVITDVR 144

Query: 133 SNNSFITIFFKDDFMG--NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
                 TI  +D        IS+ F      L+ W + D       +++  + E   LDP
Sbjct: 145 PLADGFTIVAQDAKRQALGRISIDFSNGLVGLMGWTVTDIKGGQIRVRLSDFAETADLDP 204

Query: 191 KVFEIPYDKIH 201
           K+F +   +  
Sbjct: 205 KLFVLTDPRRK 215


>gi|221640987|ref|YP_002527249.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides KD131]
 gi|221161768|gb|ACM02748.1| Outer membrane lipoprotein carrier protein LolA precursor
           [Rhodobacter sphaeroides KD131]
          Length = 200

 Score =  183 bits (466), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 64/173 (36%), Gaps = 5/173 (2%)

Query: 36  VKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           +     +   + T +  F Q +  G V  G  F+ RP +  F+Y+ P    +++ G  +A
Sbjct: 27  LSALSSYLNGLSTAEADFTQVNADGSVSTGRIFIKRPGRVRFEYAPPEKSLVVAGGGQVA 86

Query: 95  VYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFM---GNM 150
           +++AK +     YPL     S+I + N  + +  +      +   T     D        
Sbjct: 87  IFDAKSNQPPEQYPLSRTPLSLILAQNIDLGRAKMVVGHREDKNTTRVVAQDPAHPEYGT 146

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           I + F      L  W I D +   + + +    +   L   +F I  +     
Sbjct: 147 IEMVFTANPVALRQWVITDDAGNQTTVILGAMAQGRNLPASLFSIQSEAAKRS 199


>gi|163745445|ref|ZP_02152805.1| outer membrane lipoprotein carrier protein LolA [Oceanibulbus
           indolifex HEL-45]
 gi|161382263|gb|EDQ06672.1| outer membrane lipoprotein carrier protein LolA [Oceanibulbus
           indolifex HEL-45]
          Length = 201

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 70/164 (42%), Gaps = 5/164 (3%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           S+ +   +   ++T +G F Q  D G +  G  ++ RP K  F+Y++P S  +++  + +
Sbjct: 27  SLNEISGYLNQLKTAKGDFTQINDDGSISTGTIYIKRPGKVRFEYNAPDSGLVVAGANTV 86

Query: 94  AVYNAKLDTW-SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG---N 149
            +Y+ K +     YPL     S+I ++N ++ +  +    S +   T     D       
Sbjct: 87  VIYDKKSNQPAETYPLARTPLSIILADNVNLGRAKMVTGHSYDGTATTVTAQDPANPQYG 146

Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
            I + F     +L  W I D +   + + +   +    +   +F
Sbjct: 147 NIQMKFTGNPVQLRQWVINDGNGSATTVVLGDMQAGGNISNSLF 190


>gi|332559961|ref|ZP_08414283.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides WS8N]
 gi|332277673|gb|EGJ22988.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides WS8N]
          Length = 197

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 64/173 (36%), Gaps = 5/173 (2%)

Query: 36  VKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           +     +   + T +  F Q +  G V  G  F+ RP +  F+Y+ P    +++ G  +A
Sbjct: 24  LSALSSYLNGLSTAEADFTQVNADGSVSTGRIFIKRPGRVRFEYAPPEKSLVVAGGGQVA 83

Query: 95  VYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFM---GNM 150
           +++AK +     YPL     S+I + N  + +  +      +   T     D        
Sbjct: 84  IFDAKSNQPPEQYPLSRTPLSLILAQNIDLGRAKMVVGHREDKNTTRVVAQDPAHPEYGT 143

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           I + F      L  W I D +   + + +    +   L   +F I  +     
Sbjct: 144 IEMVFTANPVALRQWVITDDAGNQTTVILGAMAQGRNLPASLFSIQSEAAKRS 196


>gi|77462034|ref|YP_351538.1| putative outer membrane lipoprotein carrier protein [Rhodobacter
           sphaeroides 2.4.1]
 gi|126460924|ref|YP_001042038.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides ATCC 17029]
 gi|77386452|gb|ABA77637.1| Putative outer membrane lipoprotein carrier protein [Rhodobacter
           sphaeroides 2.4.1]
 gi|126102588|gb|ABN75266.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 212

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 64/173 (36%), Gaps = 5/173 (2%)

Query: 36  VKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           +     +   + T +  F Q +  G V  G  F+ RP +  F+Y+ P    +++ G  +A
Sbjct: 39  LSALSSYLNGLSTAEADFTQVNADGSVSTGRIFIKRPGRVRFEYAPPEKSLVVAGGGQVA 98

Query: 95  VYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFM---GNM 150
           +++AK +     YPL     S+I + N  + +  +      +   T     D        
Sbjct: 99  IFDAKSNQPPEQYPLSRTPLSLILAQNIDLGRAKMVVGHREDKNTTRVVAQDPAHPEYGT 158

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           I + F      L  W I D +   + + +    +   L   +F I  +     
Sbjct: 159 IEMVFTANPVALRQWVITDDAGNQTTVILGAMAQGRNLPASLFSIQSEAAKRS 211


>gi|144897973|emb|CAM74837.1| Outer-membrane lipoprotein carrier protein [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 215

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 38/178 (21%), Positives = 75/178 (42%), Gaps = 5/178 (2%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVS 85
                    V +A  +   I T++  F Q    G V +G  +  RP +   +Y  PS + 
Sbjct: 29  PLTDQDKADVVRAEAYMNGITTLKARFQQFAPNGNVSEGTAYFWRPGRMRLQYDPPSPIL 88

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE--SIQRVESNNSF--ITIF 141
           +++DG  + V++ +L   S  PL      V+   N  +  +  ++ RV        I++ 
Sbjct: 89  VVADGDFLIVHDQELGEPSYIPLGSTPAGVLVRENVQLNGKDLAVSRVTRAPGVLNISVV 148

Query: 142 FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
             DD     I++ F    + L  W+++D+    + + + + +    LD K+F+    K
Sbjct: 149 ESDDPAQGEITLVFTEQPFALRQWRVLDAQGSITTVSLYETQSGMTLDRKLFQFSDPK 206


>gi|84517261|ref|ZP_01004616.1| putative outer membrane lipoprotein carrier protein [Loktanella
           vestfoldensis SKA53]
 gi|84508936|gb|EAQ05398.1| putative outer membrane lipoprotein carrier protein [Loktanella
           vestfoldensis SKA53]
          Length = 202

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 36/195 (18%), Positives = 75/195 (38%), Gaps = 5/195 (2%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARP 71
           +I F  +     +      +  S+ +  ++   +QT QG F Q    G +  G+ ++ RP
Sbjct: 5   IIPFLVAFAMSVHGVGVSAQQLSLPQISDYLNQLQTAQGGFTQVNGDGTLSTGQIYIKRP 64

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQR 130
            +  F+Y+ P    +++ G  +A+++ + +T    YPL     +VI   N  +    +  
Sbjct: 65  GRIRFEYNPPQESLVMAGGGQLAIFDPRSNTGPDRYPLSQTPLNVILQRNVDLTAARMVT 124

Query: 131 VESNNSFI---TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
              ++  I   T+   D+     I + F      L  W I D     + + +        
Sbjct: 125 GSVSDGTITTVTVQDPDNPQYGDIQLVFTANPVELRQWIITDDLGNQTTMVLNDLTTGAP 184

Query: 188 LDPKVFEIPYDKIHN 202
           +   +F I  +    
Sbjct: 185 IGDIMFNIAAEMRRR 199


>gi|126733903|ref|ZP_01749650.1| Putative outer membrane lipoprotein carrier protein [Roseobacter
           sp. CCS2]
 gi|126716769|gb|EBA13633.1| Putative outer membrane lipoprotein carrier protein [Roseobacter
           sp. CCS2]
          Length = 201

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 40/205 (19%), Positives = 89/205 (43%), Gaps = 9/205 (4%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMK 63
           + K  + ++     +      A+    +  S+ +   +   +QT QG F Q +  G +  
Sbjct: 1   MSKRFLSIIAAVALTLY----ASAASAQQLSLGQISAYLNQLQTAQGGFTQINADGTLST 56

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQH 122
           G+ ++ RP +  F+Y++PS   +++ G  +A+++A+ +T    YPL     S+I   N +
Sbjct: 57  GQIYIKRPGRIRFEYNAPSDSLVLASGGQLAIFDARSNTGPERYPLNQTPLSIILQENVN 116

Query: 123 VIQ-ESIQRVESNNSFITIFFKDD--FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
           + + + +  V S+ +  T+  +D        I + F      L  W + D     + + +
Sbjct: 117 LEREDMVTNVVSDGTTTTVTAQDPDNPNYGSIQMVFTANPVELRQWIVTDEFGAETTVIL 176

Query: 180 LKYKENTVLDPKVFEIPYDKIHNIN 204
                 +V+   +F I  +  +  N
Sbjct: 177 NDLIAGSVIRDILFNIRAEMRNRGN 201


>gi|126724347|ref|ZP_01740190.1| Putative outer membrane lipoprotein carrier protein
           [Rhodobacterales bacterium HTCC2150]
 gi|126705511|gb|EBA04601.1| Putative outer membrane lipoprotein carrier protein
           [Rhodobacterales bacterium HTCC2150]
          Length = 202

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 34/187 (18%), Positives = 72/187 (38%), Gaps = 5/187 (2%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPS 72
           +    +      A   + +   +     +F  ++  Q  F Q +  G +  G  ++ RP 
Sbjct: 7   MALIPALTLGLAATSAMAEKIPLSDISAYFNDLKRAQTEFTQINADGTISTGTLYLHRPG 66

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQRV 131
           +  F+Y+ P    +I+ GS +A+++AK +T    +PL+    ++I   N ++    +   
Sbjct: 67  RIRFEYNPPEESLVIAGGSQVAIFDAKSNTPPEQFPLKRTPLNIILERNVNLTNSKMVVG 126

Query: 132 ESNNS-FITIFFKDDFMG--NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
             +     T+  +D        I + F      L  W I D     + + +   +    L
Sbjct: 127 HQDGGNSTTVIAQDPEHPDYGSIELVFTADPVELRQWVINDGGGSQTTVILGLMERKEKL 186

Query: 189 DPKVFEI 195
              +F I
Sbjct: 187 PASLFSI 193


>gi|310817198|ref|YP_003965162.1| twin-arginine translocation pathway signal [Ketogulonicigenium
           vulgare Y25]
 gi|308755933|gb|ADO43862.1| twin-arginine translocation pathway signal [Ketogulonicigenium
           vulgare Y25]
          Length = 197

 Score =  181 bits (459), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 32/192 (16%), Positives = 74/192 (38%), Gaps = 6/192 (3%)

Query: 13  VILFFYSAIFPFNAAYPITKDQ-SVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMAR 70
           +      +      A P    Q ++     +   + T +G F Q +  G    G  ++ R
Sbjct: 1   MASAMALSAGTLGGALPAFAQQVTLNDISAYLNGLTTAEGRFTQANADGSQSAGAIYIKR 60

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLD-TWSVYPLRYMAFSVIFSNNQHVIQESIQ 129
           P +  F+Y  P +  +++ G  +A+++ + +     YPL     ++I   N  + + ++ 
Sbjct: 61  PGRMRFEYDPPDNGRMLASGGQLAIFDPRSNLPPDRYPLNQTPLNIILERNVDLGRRNMV 120

Query: 130 R---VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
           R   V+ N + +T           I + F      L  W ++D +   +   + + +   
Sbjct: 121 RGMQVDGNRAIVTAQDPSHPEYGAIELVFQISPMTLWQWTVIDQAGGRTTTTLSEIRIGG 180

Query: 187 VLDPKVFEIPYD 198
            +   +F I  +
Sbjct: 181 QISDSIFNIESE 192


>gi|255263615|ref|ZP_05342957.1| outer membrane lipoprotein carrier protein LolA [Thalassiobium sp.
           R2A62]
 gi|255105950|gb|EET48624.1| outer membrane lipoprotein carrier protein LolA [Thalassiobium sp.
           R2A62]
          Length = 199

 Score =  181 bits (459), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 38/199 (19%), Positives = 81/199 (40%), Gaps = 17/199 (8%)

Query: 2   AFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGY 60
            FL+  +V G+V        FP  A     ++ S+     +   IQT    F Q +  G 
Sbjct: 5   TFLMGTAVAGLVG-------FPAAA-----QELSLGDMSRYLNDIQTATAEFTQINADGT 52

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSN 119
           +  G+ ++ RP +  F+Y+ P    ++++G  +A+++ + +     +PL     S+I + 
Sbjct: 53  ISTGQLYIKRPGRIRFEYNPPEQSLVLANGGQVAIFDPRSNNGPERFPLSQTPLSIILAR 112

Query: 120 NQHVIQESIQRVESNNSFITIF---FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
           N  + +  +    +++   T       D      I + F      L  W + D++ + + 
Sbjct: 113 NVDLARSGMVSGRTSDGTTTTIRAQDPDRPDMGNIQLVFTGNPVELRQWVVTDNAGQQTT 172

Query: 177 IKILKYKENTVLDPKVFEI 195
           I +    +   +    F I
Sbjct: 173 IILGDLTQGGRVPNSQFNI 191


>gi|260432333|ref|ZP_05786304.1| outer membrane lipoprotein carrier protein LolA [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260416161|gb|EEX09420.1| outer membrane lipoprotein carrier protein LolA [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 198

 Score =  180 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 34/163 (20%), Positives = 72/163 (44%), Gaps = 5/163 (3%)

Query: 36  VKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           + +   +   ++T+Q TF Q  D G +  G+ ++ RP K  F+Y  P+S  ++++   + 
Sbjct: 25  LSQISNYLNGLKTVQTTFTQINDDGSLSTGKLWLQRPGKMRFEYDPPNSAVVLANAGTVM 84

Query: 95  VYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG---NM 150
           V++ K +     YPL+    S++ + N ++ Q  +    + +   T+    D        
Sbjct: 85  VFDPKSNQPPEQYPLKRTPLSLVLARNVNLSQADMVVGHTFDGTATVVTAQDPKNPDSGR 144

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
           I + F      L  W I D++   + + +     N  +D  +F
Sbjct: 145 IELMFTSDPIELRKWVIYDNTGGQTTVLLGSLDGNVRVDSDLF 187


>gi|146278933|ref|YP_001169092.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145557174|gb|ABP71787.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 212

 Score =  180 bits (458), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 67/172 (38%), Gaps = 5/172 (2%)

Query: 36  VKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           +     +   + T +  F Q +  G +  G  F+ RP +  F+Y+ P    +++ G  +A
Sbjct: 39  LSTISAYLNRLSTAEADFTQVNADGSMSTGRLFIKRPGRVRFEYAPPERSLVMAGGGQVA 98

Query: 95  VYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSFITIFFKDDFMG--NM 150
           +++AK +     YPL     S+I + N  + +   +     + +   +  +D        
Sbjct: 99  IFDAKSNQPPEQYPLSRTPLSLILAQNIDLGRARTVVGHREDRNTTRVVAQDPAHPEYGT 158

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
           I + F      L  W I D +   + + + +  +   L   +F I  +    
Sbjct: 159 IEMVFTANPVALRQWVITDDAGSQTTVILGEMSQGGNLPASLFSIQSEAARR 210


>gi|259417374|ref|ZP_05741293.1| outer membrane lipoprotein carrier protein LolA [Silicibacter sp.
           TrichCH4B]
 gi|259346280|gb|EEW58094.1| outer membrane lipoprotein carrier protein LolA [Silicibacter sp.
           TrichCH4B]
          Length = 198

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 37/192 (19%), Positives = 72/192 (37%), Gaps = 6/192 (3%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARP 71
           V      A    +      +  S+ +   +  S  T Q  F Q  D G +  G+ ++ RP
Sbjct: 5   VFALALGATTLASTVATAAEKLSLNEISAYLNSFATAQADFTQVNDDGSLSTGQLYLRRP 64

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQR 130
            K  F+Y++ +   ++++   +A+ + K +     YPL     S+I + N ++ + ++  
Sbjct: 65  GKVRFEYAN-NGGLVLAEAGTVAIMDPKSNQPPETYPLSRTPLSIILARNVNLGRANMVV 123

Query: 131 VESNNSFITIFFKDD---FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
               +   TI    D        I + F     +L  W I   S   + + +   K    
Sbjct: 124 GHGFDGVSTIVRAHDPKAPENGSIEMMFTDNPVQLRKWVIHGGSGEETTVILGDMKTGMS 183

Query: 188 LDPKVFEIPYDK 199
               +F I   K
Sbjct: 184 FPSSLFSISRPK 195


>gi|254460832|ref|ZP_05074248.1| outer membrane lipoprotein carrier protein LolA [Rhodobacterales
           bacterium HTCC2083]
 gi|206677421|gb|EDZ41908.1| outer membrane lipoprotein carrier protein LolA [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 201

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 33/172 (19%), Positives = 73/172 (42%), Gaps = 6/172 (3%)

Query: 29  PITKDQSVKKAIE-HFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSL 86
           P+  ++    A+  +   + T +G F Q  D G +  G  F+ RP +  F+Y+ P    +
Sbjct: 19  PVAAEKISLNALSRYLNQLSTAKGAFTQVNDDGTISTGTIFIKRPGRIRFEYNPPEKALV 78

Query: 87  ISDGSNIAVYNAKLD-TWSVYPLRYMAFSVIFSNNQHVIQES-IQRVESNNSFITIFFKD 144
           ++ G  + +Y+ K +     YPL     S+I + N ++ +   +    +++   T+  +D
Sbjct: 79  LASGGTVVIYDPKTNEPPESYPLARTPLSIILAKNVNLSRAKMVVGHTADDKSTTVKAQD 138

Query: 145 DFMG--NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
                   I + F      L  W I D +   + + + +  +   ++  +F 
Sbjct: 139 PEHPEYGNIELVFTSNPIELRQWVINDDAGIRTTVILGELDKKARMNNTLFN 190


>gi|114571485|ref|YP_758165.1| outer membrane lipoprotein carrier protein LolA [Maricaulis maris
           MCS10]
 gi|114341947|gb|ABI67227.1| outer membrane lipoprotein carrier protein LolA [Maricaulis maris
           MCS10]
          Length = 221

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 41/189 (21%), Positives = 84/189 (44%), Gaps = 4/189 (2%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYF 76
            +AI       P+ ++ ++        SI T++  F+Q    G   +G   ++RP +   
Sbjct: 27  PAAIQQSPEQVPLDRETALAGINAALNSIDTLRSRFIQIAPDGSSAQGNLALSRPGRLRL 86

Query: 77  KYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNN 135
            Y  P+ + +I+DG+ IAV +  L+T    PLR      +      + ++ +I  +E   
Sbjct: 87  DYDEPNPLRIIADGTTIAVEDRALETVDRIPLRSTPLWWLLKPEIDIAEDAAIVSLEREF 146

Query: 136 SFITIFFKD--DFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
            F+ +  +D  D M   I   F +  + L  W + D+    + + ++  + +  L+P++F
Sbjct: 147 GFLYLTLRDPSDEMEGEIMFVFSQSDHALREWFVTDALGEITRVSLIDVQSDVTLNPRIF 206

Query: 194 EIPYDKIHN 202
            IP  +   
Sbjct: 207 VIPEPESRR 215


>gi|163743406|ref|ZP_02150786.1| outer membrane lipoprotein carrier protein LolA, putative
           [Phaeobacter gallaeciensis 2.10]
 gi|161383400|gb|EDQ07789.1| outer membrane lipoprotein carrier protein LolA, putative
           [Phaeobacter gallaeciensis 2.10]
          Length = 195

 Score =  178 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 39/186 (20%), Positives = 73/186 (39%), Gaps = 6/186 (3%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPS 72
           I +  +      AA+   +  S+ +  ++   I T    F Q  D G +  G+ +M RP 
Sbjct: 4   IAYAIALTLCSPAAW-AAEKLSLNEVSQYLNGISTATAPFSQINDDGSLSTGKLYMHRPG 62

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQRV 131
           +  F+Y  P+   +++    + + + K +     YPL+    S+I + N  + + ++   
Sbjct: 63  RMRFEYDPPNKGVVVAGAGAVLIQDPKSNQPPETYPLKRTPLSLILARNVDLGRANMVVG 122

Query: 132 ESNNSFITIFFKDDFMG---NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
            S +   TI    D        I + F      L  W I D S   + + +   K    L
Sbjct: 123 HSFDGTSTIIRAQDPKNPEYGSIEMMFTGDPVELRKWVIHDGSGGQTTVILGGLKTGVKL 182

Query: 189 DPKVFE 194
             K+F 
Sbjct: 183 PSKLFN 188


>gi|163739849|ref|ZP_02147256.1| outer membrane lipoprotein carrier protein LolA, putative
           [Phaeobacter gallaeciensis BS107]
 gi|161386883|gb|EDQ11245.1| outer membrane lipoprotein carrier protein LolA, putative
           [Phaeobacter gallaeciensis BS107]
          Length = 195

 Score =  178 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 39/186 (20%), Positives = 73/186 (39%), Gaps = 6/186 (3%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPS 72
           I +  +      AA+   +  S+ +  ++   I T    F Q  D G +  G+ +M RP 
Sbjct: 4   IAYAIALTLCSPAAW-AAEKLSLNEVSQYLNGISTATAPFSQINDDGSLSTGKLYMHRPG 62

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQRV 131
           +  F+Y  P+   +++    + + + K +     YPL+    S+I + N  + + ++   
Sbjct: 63  RMRFEYDPPNKGVVVAGAGAVLIQDPKSNQPPETYPLKRTPLSLILARNVDLGRANMVVG 122

Query: 132 ESNNSFITIFFKDDFMG---NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
            S +   TI    D        I + F      L  W I D S   + + +   K    L
Sbjct: 123 HSFDGTSTIIRAQDPKNPEYGSIEMMFTGDPVELRKWVIHDGSGGRTTVILGGLKTGVKL 182

Query: 189 DPKVFE 194
             K+F 
Sbjct: 183 PSKLFN 188


>gi|329847404|ref|ZP_08262432.1| outer membrane lipocarrier protein LolA family protein
           [Asticcacaulis biprosthecum C19]
 gi|328842467|gb|EGF92036.1| outer membrane lipocarrier protein LolA family protein
           [Asticcacaulis biprosthecum C19]
          Length = 223

 Score =  178 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 40/192 (20%), Positives = 86/192 (44%), Gaps = 9/192 (4%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFY 75
           F   I P    +       + KA ++  ++ T QG F Q D  G    G ++++RP K  
Sbjct: 33  FGGLITPPT--FNAADKGRIDKATQYLQALTTAQGRFEQTDFRGRKTLGNWYLSRPGKIR 90

Query: 76  FKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESN 134
           F+Y +P S+ +++DG  + +++ +L ++  YPL     S+  S    + Q   + +V+S+
Sbjct: 91  FEYDAPYSLLIVADGQKVKMWDPRLKSFDEYPLGETPLSLFLSRQIRLDQNVVVTQVKSS 150

Query: 135 NSFITIFFKDDFMG--NMISVTFDR---LSYRLLNWKIMDSSRRYSIIKILKYKENTVLD 189
               T+  +D        I++ FD+    +  L  W + D+  + + + +  +       
Sbjct: 151 ALGFTLSARDRRKQVEGHIALVFDQAGNGNLTLREWTVTDAQGKATRVHLTSFNRGGGFK 210

Query: 190 PKVFEIPYDKIH 201
             +F +   ++ 
Sbjct: 211 SDLFVLSKSQMK 222


>gi|254509851|ref|ZP_05121918.1| outer membrane lipoprotein carrier protein LolA [Rhodobacteraceae
           bacterium KLH11]
 gi|221533562|gb|EEE36550.1| outer membrane lipoprotein carrier protein LolA [Rhodobacteraceae
           bacterium KLH11]
          Length = 198

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 33/163 (20%), Positives = 69/163 (42%), Gaps = 5/163 (3%)

Query: 36  VKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           + +   +   ++T+Q TF Q  D G +  G+ ++ RP K  F+Y  P+   +++    + 
Sbjct: 25  LSQISNYLNQMKTVQTTFTQVNDDGSLSTGKLWLQRPGKMRFEYDPPNDAVVLARAGTVQ 84

Query: 95  VYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD---FMGNM 150
           +++ K +     YPL+    S++ + N ++ Q ++      +   T+    D        
Sbjct: 85  IFDPKSNQPPEQYPLKRTPLSLVLARNVNLGQANMVVGHDFDGTATVVTAQDPKNPENGR 144

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
           I + F      L  W I D++   + + +    E    D  VF
Sbjct: 145 IELMFTADPVELRKWVIHDNAGSQTTVLLGPLAEGGRFDSSVF 187


>gi|56698238|ref|YP_168611.1| outer membrane lipoprotein carrier protein LolA, putative [Ruegeria
           pomeroyi DSS-3]
 gi|56679975|gb|AAV96641.1| outer membrane lipoprotein carrier protein LolA, putative [Ruegeria
           pomeroyi DSS-3]
          Length = 198

 Score =  178 bits (451), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 73/180 (40%), Gaps = 6/180 (3%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLIS 88
                 + +   +   ++T+Q TF Q  D G +  G+ ++ RP +  F+Y  P    +++
Sbjct: 19  AADKLPLAEISTYLNGLKTVQTTFTQINDDGSLSTGKLWLHRPGRMRFEYDPPDRSVVLA 78

Query: 89  DGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFM 147
            G  + +++ K +     YPL     S++ +    + + ++    + +   T+    D  
Sbjct: 79  KGGTVIIHDPKSNQPPEQYPLNRTPLSIVLARTVDLDRANMVVGHAFDGTATVVTAQDPE 138

Query: 148 G---NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
                 I ++F      L  W I D +   + + + +  +   L+  +F I      ++N
Sbjct: 139 NPDYGRIELSFTGDPVELRKWVIHDGAGSRTTVILGQLTKGNSLNQNLF-IDGQPGVSVN 197


>gi|89070981|ref|ZP_01158204.1| Putative outer membrane lipoprotein carrier protein [Oceanicola
           granulosus HTCC2516]
 gi|89043444|gb|EAR49659.1| Putative outer membrane lipoprotein carrier protein [Oceanicola
           granulosus HTCC2516]
          Length = 202

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 35/187 (18%), Positives = 68/187 (36%), Gaps = 5/187 (2%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPS 72
           +L     I    A     +  S+ +  ++  S  T QG F Q    G +  G   + RP 
Sbjct: 7   LLLLIPLIVAALATSGQAQQLSLAQISQYMNSFSTAQGEFTQINSDGTISTGTLLIKRPG 66

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKL-DTWSVYPLRYMAFSVIFSNNQHVIQESIQRV 131
           +  F+Y+ P    +++ G ++AV++ +  +    YPL      +I   N    +  +   
Sbjct: 67  RIRFQYNPPDRSLVLAGGGSVAVFDPQSDNNPERYPLSETPLKIILEQNVDFTRAGMVTG 126

Query: 132 ESNNS---FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
              +     +T           I + F      L  W I D + + + + +    +N  +
Sbjct: 127 HGYDGTATTVTAQDPQHPEYGSIQLKFTGSPVELRQWIITDDAGQQTTVVLGDLAKNVAI 186

Query: 189 DPKVFEI 195
               F I
Sbjct: 187 GDINFNI 193


>gi|258542799|ref|YP_003188232.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256633877|dbj|BAH99852.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256636936|dbj|BAI02905.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256639989|dbj|BAI05951.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256643045|dbj|BAI09000.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256646100|dbj|BAI12048.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256649153|dbj|BAI15094.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256652140|dbj|BAI18074.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256655197|dbj|BAI21124.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 231

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 32/185 (17%), Positives = 73/185 (39%), Gaps = 4/185 (2%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYF 76
            S+  P   A   +    +K+  +     +T Q    Q DA G    G  +M RP +   
Sbjct: 45  ASSSTPVPVALSASDKAWLKRIEQALNQSKTFQARIQQLDAEGKRTTGTVWMKRPGQMRL 104

Query: 77  KYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNN 135
            Y  PS + L+++G  +   + +LD  +V P+      ++   +  +  + ++   + +N
Sbjct: 105 AYDPPSPLLLVANGGKVVFRDNQLDQTTVIPIERTPLGLLLRPHVSLTDDVTVTGFQHDN 164

Query: 136 SF--ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
               +T+          +++ F      L +W ++D+  R + + +        +    F
Sbjct: 165 GLVQVTLVRTSSPGDGSLTLVFYETPVALRSWSVLDAQGRETRVTLFDVHAGADIPASTF 224

Query: 194 EIPYD 198
            +P +
Sbjct: 225 VLPAE 229


>gi|84687991|ref|ZP_01015855.1| Putative outer membrane lipoprotein carrier protein [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84664023|gb|EAQ10523.1| Putative outer membrane lipoprotein carrier protein
           [Rhodobacterales bacterium HTCC2654]
          Length = 195

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 32/169 (18%), Positives = 74/169 (43%), Gaps = 5/169 (2%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           +  S+     +   ++T Q  F Q +  G +  G  ++ RP +  F+Y+ P    +++  
Sbjct: 18  QQLSLGALSTYLNGLKTAQAEFTQINADGTISTGTIYIKRPGRARFEYNPPEQTLVLASA 77

Query: 91  SNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQRVES-NNSFITIFFKDDFMG 148
             +A+++AK +T    YPL     ++I + N  + +  +    + + +  T+  +D    
Sbjct: 78  GQLAIFDAKSNTGPEQYPLARTPLNLILAQNVDLGRNGMVVGHNYDGTATTVTAQDPEHP 137

Query: 149 --NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
               I +TF      L  W I D + + + + + + ++   +  + F I
Sbjct: 138 EYGNIQLTFTGNPTELRQWVITDDAGQQTTVVLGELRKGGTISDRNFSI 186


>gi|254418783|ref|ZP_05032507.1| Outer membrane lipoprotein carrier protein LolA [Brevundimonas sp.
           BAL3]
 gi|196184960|gb|EDX79936.1| Outer membrane lipoprotein carrier protein LolA [Brevundimonas sp.
           BAL3]
          Length = 227

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 39/183 (21%), Positives = 78/183 (42%), Gaps = 5/183 (2%)

Query: 24  FNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPS 82
             +         V++A  +  ++ + QGTF++    G   +G F++ RP K  F+Y+SP+
Sbjct: 41  AQSNLSAEDRAVVQQAQAYLQTLTSAQGTFVETGPGGQRREGRFYLQRPGKMRFEYTSPA 100

Query: 83  SVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQ----ESIQRVESNNSFI 138
            + ++SDG N+  Y+ +L+ +   PL     S   + N  + Q    + + R+ S    I
Sbjct: 101 GLLVVSDGYNVKRYDPRLNNFQQVPLGRTPLSTFLARNVRLDQGVRIDRVTRMSSGAFAI 160

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           T           + + F     RL  W I D+    +  ++   +  + L   +F++   
Sbjct: 161 TARDSGRPNDGAVVLAFAGDPMRLHEWTITDAQGARTRTQLTALQPASNLASSLFQLRDP 220

Query: 199 KIH 201
              
Sbjct: 221 TRR 223


>gi|315122020|ref|YP_004062509.1| possible lolA type protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495422|gb|ADR52021.1| possible lolA type protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 207

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 125/204 (61%), Positives = 159/204 (77%), Gaps = 2/204 (0%)

Query: 2   AFLLYKSVIGVVILFFYSAIFPFNAAYPIT-KDQSVKKAIEHFLSIQTMQGTFLQEDA-G 59
           + L  +S++G  + FFYS  F   A   +  K+ +V+KAI+HFLSIQT+QG F+QED  G
Sbjct: 3   SLLYRRSIVGFFVFFFYSVFFVSFAYSIVDIKEHAVQKAIDHFLSIQTIQGIFVQEDTVG 62

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
            V+KGEFFM RPSKFYFKYSSPSS SL+SDG N+A+YNAKLD W+VYPL   AF +IFSN
Sbjct: 63  NVIKGEFFMTRPSKFYFKYSSPSSGSLVSDGRNVAIYNAKLDAWTVYPLPNTAFGIIFSN 122

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
            ++ +Q+SIQR+E+NN+FIT+FF++    NMIS+TFDRLSYRLLNW+I DSS    ++KI
Sbjct: 123 KRNEMQQSIQRIETNNAFITLFFREVLTKNMISLTFDRLSYRLLNWEITDSSGTSILVKI 182

Query: 180 LKYKENTVLDPKVFEIPYDKIHNI 203
           LKYKEN  L  ++F IPYDKIHNI
Sbjct: 183 LKYKENITLKSELFVIPYDKIHNI 206


>gi|99079902|ref|YP_612056.1| outer membrane lipoprotein carrier protein LolA [Ruegeria sp.
           TM1040]
 gi|99036182|gb|ABF62794.1| outer membrane lipoprotein carrier protein LolA [Ruegeria sp.
           TM1040]
          Length = 198

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 37/192 (19%), Positives = 74/192 (38%), Gaps = 6/192 (3%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARP 71
           V      A    +AA    +  S+ +   +  S  T +  F Q  D G +  G  ++ RP
Sbjct: 5   VFALALGATSLASAAASAAEQLSLNEISAYLNSFATAKADFTQVNDDGSLSTGTLYLRRP 64

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQR 130
            K  F+Y+  ++  ++++   +A+ + K +     YPL     S+I + N ++ Q ++  
Sbjct: 65  GKVRFEYAD-NAGLVLAEAGTVAIMDPKSNQPPETYPLSRTPLSIILARNVNLAQANMVV 123

Query: 131 VESNNSFITIFFKDDFMG---NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
               +   T+    D        I + F     +L  W I   S   + + + + +    
Sbjct: 124 GHGFDGVSTVVRAQDPKAPEHGSIEMMFTDNPVQLRKWVIHGGSGEETTVILGEMQTGLS 183

Query: 188 LDPKVFEIPYDK 199
               +F I   K
Sbjct: 184 FPSSLFSISRPK 195


>gi|163796427|ref|ZP_02190387.1| Outer membrane lipoprotein-sorting protein [alpha proteobacterium
           BAL199]
 gi|159178277|gb|EDP62821.1| Outer membrane lipoprotein-sorting protein [alpha proteobacterium
           BAL199]
          Length = 211

 Score =  173 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 86/199 (43%), Gaps = 6/199 (3%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-G 59
           M   L  +++GV+++          A+        + +   +F  I +M+  FLQ  + G
Sbjct: 1   MRRTLTSALMGVLVVAGLWTGSATAASLSAEDKADLARVEAYFNGITSMRSNFLQASSTG 60

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
            V KG  ++ RP +  F+Y  PS + + SDG  +   + +L   +  PL     SV+   
Sbjct: 61  LVAKGRVWLRRPGRMRFEYDPPSPILITSDGILVTYQDLELKQTNQIPLFTSPLSVLVEE 120

Query: 120 NQ----HVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           N      +I + ++R ESN   + I  + +     +++ F      L  W I+D+ +   
Sbjct: 121 NVTFGEELIVDEVKR-ESNVLRVRIRLRKEPDQGYVTLVFQDRPMSLKQWTIVDAQQVSV 179

Query: 176 IIKILKYKENTVLDPKVFE 194
            + +L  +    +  ++F 
Sbjct: 180 KVALLDPEFGVTIPNELFR 198


>gi|167648963|ref|YP_001686626.1| outer membrane lipoprotein carrier protein LolA [Caulobacter sp.
           K31]
 gi|167351393|gb|ABZ74128.1| outer membrane lipoprotein carrier protein LolA [Caulobacter sp.
           K31]
          Length = 212

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 44/204 (21%), Positives = 94/204 (46%), Gaps = 5/204 (2%)

Query: 2   AFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GY 60
             L+  + + + +     A  P  A     +   V +A  +  ++ + +G F+Q DA G 
Sbjct: 6   RRLIIAAGLSLAVAGPALAAQPPAARLSADEQALVDRATAYIQTLGSAKGRFVQTDARGS 65

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
             +G F++ RP K  F Y  P+ + ++S+G+N+ +Y+++L T+  YPL     +++ +  
Sbjct: 66  QTQGLFYLQRPGKARFAYDGPAGLLVVSNGANVNIYDSRLKTFESYPLNRTPLALLLARE 125

Query: 121 QHVIQE-SIQRVE--SNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             + +  +I  V   S+   IT           I++ F      L  W + D     + +
Sbjct: 126 VRLDRGVTITGVRKLSDGFTITAVDAKRQTLGRIALDFSNAP-ALTGWTVTDVKGGETRV 184

Query: 178 KILKYKENTVLDPKVFEIPYDKIH 201
           ++  +++ + LDPK+F +   +  
Sbjct: 185 RLADFEKTSGLDPKLFVLSDPRRR 208


>gi|329891193|ref|ZP_08269536.1| outer membrane lipocarrier protein LolA family protein
           [Brevundimonas diminuta ATCC 11568]
 gi|328846494|gb|EGF96058.1| outer membrane lipocarrier protein LolA family protein
           [Brevundimonas diminuta ATCC 11568]
          Length = 213

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 35/180 (19%), Positives = 76/180 (42%), Gaps = 5/180 (2%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVSL 86
                   +++A  +  ++ T QGTF++         G +++ RP K  F+Y+ P  + +
Sbjct: 31  LSADDQAVLRQAQTYLTAMTTAQGTFVETGPNNQRRTGRYYLQRPGKMRFEYTEPEGLLV 90

Query: 87  ISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQ----ESIQRVESNNSFITIFF 142
           ++DG+N++ ++ +L+ +   PL     S   +    + Q    + I R++S    IT   
Sbjct: 91  VADGNNVSRWDPRLNVFRQAPLGQTPLSTFLAREVRLDQGVKIDRITRMDSGAFAITARD 150

Query: 143 KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
                   + + F     RL  W I D+    + +++   +    L   +F++      N
Sbjct: 151 ARRPNEGSVILAFAGSPVRLQEWTITDAQGSRTRVQLTTLQPAPGLAASLFQLRDPTRRN 210


>gi|329114602|ref|ZP_08243361.1| Outer Membrane Lipoprotein Carrier Protein LolA [Acetobacter
           pomorum DM001]
 gi|326696082|gb|EGE47764.1| Outer Membrane Lipoprotein Carrier Protein LolA [Acetobacter
           pomorum DM001]
          Length = 231

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 29/176 (16%), Positives = 69/176 (39%), Gaps = 4/176 (2%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSL 86
              +    +K+  +     +T Q    Q DA G    G  +M RP +    Y  PS + L
Sbjct: 55  LSASDKAWLKRIEQALNQSKTFQARIQQLDAEGKRTTGTVWMKRPGQMRLAYDPPSPLLL 114

Query: 87  ISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSF--ITIFFK 143
           +++G  +   + +LD  +V P+      ++   +  +  + ++   + +N    +T+   
Sbjct: 115 VANGGKVVFRDNQLDQTTVIPIERTPLGLLLRPHVSLTDDVTVTGFQHDNGLVQVTLVRT 174

Query: 144 DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                  +++ F      L +W ++D+  R + + +        +    F +P + 
Sbjct: 175 SSPGDGSLTLVFYETPVALRSWSVLDAQGRETRVTLFDVHAGADIPASTFVLPAEN 230


>gi|296532204|ref|ZP_06894956.1| LolA family outer membrane lipoprotein carrier protein [Roseomonas
           cervicalis ATCC 49957]
 gi|296267475|gb|EFH13348.1| LolA family outer membrane lipoprotein carrier protein [Roseomonas
           cervicalis ATCC 49957]
          Length = 268

 Score =  171 bits (433), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 32/172 (18%), Positives = 67/172 (38%), Gaps = 4/172 (2%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISD 89
            +   + +A  +   I T++  FLQ    G   +G  F+ARP +  F Y  P  + L++ 
Sbjct: 89  NQQALLARAETYLNGITTLRARFLQIAQNGGSAEGTAFIARPGRMRFDYDPPEPLLLVAS 148

Query: 90  GSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSF--ITIFFKDDF 146
                 Y+ +L   S+ P+     + +         +  +  V+    F  +T+  +D  
Sbjct: 149 DGQFLYYDRELRQPSIVPVSSTPLAFLLRPRISFGGDIEVMGVQRQGGFLQVTVRRRDAP 208

Query: 147 MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
               +++ F      L  W ++DS  R + + +   +    L  ++F     
Sbjct: 209 SEGSLTLVFAEEPMELRQWVVVDSQGRQTRVTLNAIETGMALPRRLFTFNDP 260


>gi|294678843|ref|YP_003579458.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           capsulatus SB 1003]
 gi|294477663|gb|ADE87051.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           capsulatus SB 1003]
          Length = 203

 Score =  170 bits (432), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 36/200 (18%), Positives = 76/200 (38%), Gaps = 14/200 (7%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AG 59
           M F    +++ V++L          AA    +   + +   +   + T +  F Q +  G
Sbjct: 4   MRFAPVAALLPVLMLAL--------AAPAWAEKIPLAQLSAYLNGLTTAEAAFTQVNADG 55

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW-SVYPLRYMAFSVIFS 118
               G+ ++ RP +  F+YS      +++ G  +A+++ K +     YPL+    ++I +
Sbjct: 56  SKSTGKLYLKRPGRMRFEYSD-DDTLVLASGGQVAIFDPKSNQIAEQYPLKRTPLNLILA 114

Query: 119 NNQHVIQESIQRVESNNSFITIFFKDDFMG---NMISVTFDRLSYRLLNWKIMDSSRRYS 175
           +   + Q  +          T     D        I + F      L  W I D +   +
Sbjct: 115 DRIDLAQARMVVGHEAEGANTAVVAQDPQNPDYGTIRLVFSANPVTLRRWVITDDTGAKT 174

Query: 176 IIKILKYKENTVLDPKVFEI 195
           ++ + + K      P +F I
Sbjct: 175 VVILDQLKPGVDPGPLMFSI 194


>gi|148259434|ref|YP_001233561.1| outer membrane lipoprotein carrier protein LolA [Acidiphilium
           cryptum JF-5]
 gi|326402660|ref|YP_004282741.1| putative outer membrane lipoprotein carrier protein LolA
           [Acidiphilium multivorum AIU301]
 gi|146401115|gb|ABQ29642.1| outer membrane lipoprotein carrier protein LolA [Acidiphilium
           cryptum JF-5]
 gi|325049521|dbj|BAJ79859.1| putative outer membrane lipoprotein carrier protein LolA
           [Acidiphilium multivorum AIU301]
          Length = 206

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 37/197 (18%), Positives = 80/197 (40%), Gaps = 6/197 (3%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITK--DQSVKKAIEHFLSIQTMQGTFLQ-EDAGY 60
           +  ++++G+      ++  P  +A   +    Q + K +++  S++T+   F+Q    G 
Sbjct: 2   IARRALLGIAATCVAASFSPAWSAPLSSGHTQQVLGKVLDYLNSLKTVTARFMQVGPDGS 61

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
           V  G   + RP K  F+Y  P    L++    +  ++ +LD  +  PL      ++ + +
Sbjct: 62  VRTGTAIVQRPGKMRFEYDKPDPQLLVAGFGLLVYHDPQLDQTTNIPLSSTPLGILLAKH 121

Query: 121 QHVIQE-SIQRVESNNSFI--TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                +  + RV +    I  T+          I++ F      L  W++ D+  R + +
Sbjct: 122 ITFGGDVKLLRVSTPPGEIQVTLTRAGREAQGHITLVFSTNPIELRQWRLTDAQDRVTQV 181

Query: 178 KILKYKENTVLDPKVFE 194
            +   K       K FE
Sbjct: 182 SLYDLKPAAPFPDKTFE 198


>gi|300024805|ref|YP_003757416.1| outer membrane lipoprotein carrier protein LolA [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526626|gb|ADJ25095.1| outer membrane lipoprotein carrier protein LolA [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 251

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 46/171 (26%), Positives = 84/171 (49%), Gaps = 5/171 (2%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQEDAG-YVMKGEFFMARPSKFYFKYSSPSSVSLIS 88
             + + VK+  ++F S+Q ++G F+Q DA    MKG+FF+ RP +F F YS PS   +IS
Sbjct: 70  AEQTKLVKQVSDYFGSVQGLKGAFVQVDADNKRMKGKFFVKRPGRFRFDYSLPSKQIIIS 129

Query: 89  DGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFIT--IFFKDD 145
           DG N+A+ +  L+      L    F ++   +  ++++  I  V+  +  I   +  KD 
Sbjct: 130 DGENLAIQDLDLNNEDRVSLDQTPFRMLLRKDVDLLRDAKITEVQQADDLIVLGLEDKDP 189

Query: 146 FMGNMISVTFDRLS-YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
                I +         L  W   D+    + +++L  +++  LD  +F+I
Sbjct: 190 DAPGKIKLYLATKPNIELKEWVTTDAQGLNTRVELLGLEKSNDLDSNLFKI 240


>gi|254292392|ref|YP_003058415.1| outer membrane lipoprotein carrier protein LolA [Hirschia baltica
           ATCC 49814]
 gi|254040923|gb|ACT57718.1| outer membrane lipoprotein carrier protein LolA [Hirschia baltica
           ATCC 49814]
          Length = 227

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 39/192 (20%), Positives = 84/192 (43%), Gaps = 8/192 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFK 77
           SA      A     ++ + K        +T +G F Q DA G +  G+F++ RP +  F+
Sbjct: 34  SANQAIAPAVDFQNNELLTKINARMADTKTARGGFKQTDAMGEITTGDFYLRRPGRVRFE 93

Query: 78  YSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNS 136
           Y++P+   ++SDG+ +A+ + +LDT    PL             ++ ++ +I  V S   
Sbjct: 94  YAAPTPYLIVSDGTTVAIEDKELDTIDRAPLSATPLKHFLKKTLNLAEDTTILDVRSLPD 153

Query: 137 FITIFFKDDFMGNM------ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
              +  +D+           + + F + +Y L+ W  +D     + + +   + N  + P
Sbjct: 154 SHLVVIEDNPKNGDEAIDGLVFLKFSKENYDLMGWVTIDGLGNETRVDLFDMELNGNISP 213

Query: 191 KVFEIPYDKIHN 202
           ++F +  +   +
Sbjct: 214 RLFVLEDEDNRD 225


>gi|197106968|ref|YP_002132345.1| outer membrane lipoprotein carrier protein LolA [Phenylobacterium
           zucineum HLK1]
 gi|196480388|gb|ACG79916.1| outer membrane lipoprotein carrier protein LolA [Phenylobacterium
           zucineum HLK1]
          Length = 215

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 45/190 (23%), Positives = 83/190 (43%), Gaps = 4/190 (2%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFK 77
           +A     A         V++A  +  S++  +  F+Q D  G  + G+ F+ RP K  F 
Sbjct: 22  AAPAFAQAGLSAQDRALVERAAAYLESLKEAKARFVQTDSRGRSIGGDVFLKRPGKARFD 81

Query: 78  YSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNS 136
           Y  PS + ++SDG  ++V + +L T+  YPL     SV  + N  + +  ++ RV     
Sbjct: 82  YDPPSGLLVVSDGGVVSVQDTRLKTFDRYPLSATPLSVFLAKNIRLDKGVTVTRVSRMAD 141

Query: 137 FITIFFKD--DFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
             +I  +D        I +TF      L  W I D+  R + +++   +  + L   +F 
Sbjct: 142 GFSITARDGNKRTAGQIMLTFRDEPMTLTGWTITDAQGRQTRVQLQGLQRASGLAGSLFV 201

Query: 195 IPYDKIHNIN 204
           +   +  N+ 
Sbjct: 202 LKDPRPKNVG 211


>gi|89052920|ref|YP_508371.1| twin-arginine translocation pathway signal [Jannaschia sp. CCS1]
 gi|88862469|gb|ABD53346.1| Twin-arginine translocation pathway signal [Jannaschia sp. CCS1]
          Length = 203

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 70/190 (36%), Gaps = 6/190 (3%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPS 72
           +L   +A      +        + +   +  ++QT +  F Q    G V  G  ++ RP 
Sbjct: 8   LLGATAAFILAGTSAAFANAIPLAQLSGYLNAMQTAESPFTQINSDGTVSTGTVYIHRPG 67

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYN-AKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRV 131
           +  F Y     + +++ GS +A+++         YPL      +I   N  + Q  +   
Sbjct: 68  RVRFDYDG-DDLLVMAGGSQVAIFDGRASGPPEQYPLDQTPLRIILQRNVDLGQSGMVSE 126

Query: 132 ESNNSFIT-IFFKDDFMG--NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
            S +   T +  +D        I++ F      L  W I D     + + +   ++   +
Sbjct: 127 HSFDGTSTRVVARDPQRPNIGSITLVFTPNPIELRQWVITDEGGAQTTVILGALEQGGRI 186

Query: 189 DPKVFEIPYD 198
             + F IP +
Sbjct: 187 PARFFSIPQE 196


>gi|86136933|ref|ZP_01055511.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseobacter sp. MED193]
 gi|85826257|gb|EAQ46454.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseobacter sp. MED193]
          Length = 224

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 75/194 (38%), Gaps = 7/194 (3%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMK 63
           L K ++  + L   + +F  + A       S+ +   +   ++T   +F Q  D G +  
Sbjct: 24  LMKQILHAIALSCCALVF--STAAWAEGKLSLNEISGYLNGMKTATASFTQINDDGTLTT 81

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQH 122
           G+ ++ RP +  F+Y      ++++    + +++ K +     +PL+    S+I +    
Sbjct: 82  GKLYLHRPGRMRFEYDGKGGGTVVAGAGAVRIHDPKSNQPPETFPLKRTPLSIILAKQVD 141

Query: 123 VIQESIQRVESNNSFITIFFKDDFMG---NMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
           + + ++      +   T+    D        + + F      L  W + D +   + + +
Sbjct: 142 LGRANMVVGHGFDGTSTVVQAQDPENPDYGSLELMFTGEPVELRKWVVHDGAGGKTTVIL 201

Query: 180 LKYKENTVLDPKVF 193
              +    L   +F
Sbjct: 202 GALETGMRLPSTLF 215


>gi|114767089|ref|ZP_01445972.1| outer membrane lipoprotein carrier protein LolA, putative
           [Pelagibaca bermudensis HTCC2601]
 gi|114540742|gb|EAU43808.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseovarius sp. HTCC2601]
          Length = 193

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 38/191 (19%), Positives = 70/191 (36%), Gaps = 6/191 (3%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPS 72
           IL          A     +  S+     +  SIQ+ +  F Q    G +  G+  + RP 
Sbjct: 4   ILTAALTALMLTALPAAAQQLSLNTLSNYLNSIQSAESPFTQINSDGSISTGKILIKRPG 63

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKL-DTWSVYPLRYMAFSVIFSNNQHVIQESIQRV 131
           K  F+Y+ P    +++    + V++ K+      YPL     S+I   N ++ Q  +   
Sbjct: 64  KVRFEYNPPEQALVLAWSGAVYVFDRKVGGQPETYPLNQTPLSIILDRNVNLAQAGMVTG 123

Query: 132 ESNNSFITIFFKDD---FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
              +   TI    D        I + F      L  W I D +   + + +   ++   L
Sbjct: 124 HQYDGTATIVTAQDPKRPEYGSIQMKFTGNPVELRQWVIRDGNGSTTTVVLGGLEKT-SL 182

Query: 189 DPKVFEIPYDK 199
              VF++   +
Sbjct: 183 PNSVFDVNRVR 193


>gi|315497244|ref|YP_004086048.1| outer membrane lipoprotein carrier protein lola [Asticcacaulis
           excentricus CB 48]
 gi|315415256|gb|ADU11897.1| outer membrane lipoprotein carrier protein LolA [Asticcacaulis
           excentricus CB 48]
          Length = 221

 Score =  167 bits (424), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 43/221 (19%), Positives = 90/221 (40%), Gaps = 19/221 (8%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAA-------------YPITKDQSVKKAIEHFLSIQ 47
           M  L  ++++  +         P  A              +       + +A+ +  S+ 
Sbjct: 1   MTELTKRALLTGLTAASLLTTAPAWAQGRNTIQQFVTPPKFSAQDQGRIDRAVAYLQSLG 60

Query: 48  TMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY 106
           T  G F Q D  G    G++++ RP K  F+Y +P S+ ++SDG  +  ++ +L  ++ Y
Sbjct: 61  TGGGRFEQTDYKGRTTAGKWWLQRPGKIRFEYDAPYSLLVVSDGKTVNTWDPRLKAFNQY 120

Query: 107 PLRYMAFSVIFSNNQHVIQESI---QRVESNNSFITIFFKDDFMGNMISVTF--DRLSYR 161
           PL     S+  S    + Q  I       ++   +    +   +   I +TF     + +
Sbjct: 121 PLNATPLSLFLSKQIRLDQGVIVTEVTPTTDGFRLKARDRRRDVEGSILMTFIERGNALQ 180

Query: 162 LLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
           L  W + D   + + ++++ +  NT + P +F +   K  N
Sbjct: 181 LGEWTVTDQQGKGTRVRLVTFDRNTAVRPDLFVLKKPKGAN 221


>gi|260425883|ref|ZP_05779862.1| outer membrane lipoprotein carrier protein LolA [Citreicella sp.
           SE45]
 gi|260420375|gb|EEX13626.1| outer membrane lipoprotein carrier protein LolA [Citreicella sp.
           SE45]
          Length = 193

 Score =  167 bits (423), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 34/188 (18%), Positives = 69/188 (36%), Gaps = 6/188 (3%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPS 72
           ++                +  S+ +  ++  SIQ+ +  F Q    G +  G   + RP 
Sbjct: 4   LITAALTALVLTTVSAAAQQLSLNQISQYLNSIQSAKSPFTQINGDGTISTGTISIKRPG 63

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKL-DTWSVYPLRYMAFSVIFSNNQHVIQESIQRV 131
           K  F+Y+ P    +++    + V++ K+      YPL     S+I   N ++ Q  +   
Sbjct: 64  KVRFEYNPPEQALVLAWSGAVYVFDKKVRGQPETYPLSQTPLSIILERNVNLAQRGMVTG 123

Query: 132 ESNNSFITIFFKDD---FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
            S +   T     D        I + F      L  W I D +   + + +   ++   L
Sbjct: 124 HSYDGTATTVTAQDPRHPEYGSIQMKFTGNPVELRQWIIRDGNGNTTTVVLGGLQK-ANL 182

Query: 189 DPKVFEIP 196
              +F++ 
Sbjct: 183 PNSLFDVN 190


>gi|159042614|ref|YP_001531408.1| outer membrane lipoprotein carrier protein [Dinoroseobacter shibae
           DFL 12]
 gi|157910374|gb|ABV91807.1| outer membrane lipoprotein carrier protein [Dinoroseobacter shibae
           DFL 12]
          Length = 234

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 43/205 (20%), Positives = 81/205 (39%), Gaps = 9/205 (4%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMK 63
           + +     + L   +      AA  I     + +   +   +  +Q  F Q +  G    
Sbjct: 34  MNRRQFTALTLAGLATPGLARAASLIP----LPEIAAYLRGLDLVQARFTQRNADGSTST 89

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD-TWSVYPLRYMAFSVIFSNNQH 122
           G  ++ RP +  F+Y  P+ V ++  G  +A+++AK D T   YPLR    +VI S    
Sbjct: 90  GTLYLRRPGRARFEYDPPAEVLVMVGGGTVAIFDAKGDPTPESYPLRRTPLNVILSREVD 149

Query: 123 V-IQESIQRVESNNSFITIFFKDDFMG--NMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
           +   ++I   + +    T+   D        I++ F     RL  W I+  +   ++I++
Sbjct: 150 LEGSDAIFGHQLDGDLTTVLAHDPAHPEYGRIALQFAADPVRLARWVIVGETGEQTVIEL 209

Query: 180 LKYKENTVLDPKVFEIPYDKIHNIN 204
                   L   +F IP +     N
Sbjct: 210 GPLTRPAQLSSNLFNIPGETNRRRN 234


>gi|304320398|ref|YP_003854041.1| hypothetical protein PB2503_04122 [Parvularcula bermudensis
           HTCC2503]
 gi|303299300|gb|ADM08899.1| hypothetical protein PB2503_04122 [Parvularcula bermudensis
           HTCC2503]
          Length = 284

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 36/163 (22%), Positives = 71/163 (43%), Gaps = 3/163 (1%)

Query: 37  KKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAV 95
            KA+    SI  +Q  F Q   +G V  G  ++ RP K  F+Y  PS   +++ G  + V
Sbjct: 112 DKAVVSLESIDRLQAAFAQRSPSGGVYSGTLYLDRPGKLRFEYDDPSPQLIVATGGLVYV 171

Query: 96  YNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVE--SNNSFITIFFKDDFMGNMISV 153
           ++  L T   YP+     S++ S         ++ V+   +   +T+   DD +   +++
Sbjct: 172 HDEDLKTTDSYPVGETPLSLLLSERIDTQSAVLRGVQRYEDRVAVTVRSTDDAVTGDLTL 231

Query: 154 TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
            F      L +W + ++    +++ +        L  ++F IP
Sbjct: 232 IFTAPDMALRSWIVTETDGSRTVVDLSNVTAPQRLANRLFRIP 274


>gi|119385396|ref|YP_916452.1| outer membrane lipoprotein carrier protein LolA [Paracoccus
           denitrificans PD1222]
 gi|119375163|gb|ABL70756.1| outer membrane lipoprotein carrier protein LolA [Paracoccus
           denitrificans PD1222]
          Length = 198

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 70/175 (40%), Gaps = 7/175 (4%)

Query: 27  AYPITKDQ-SVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSV 84
           A+P   ++ S+ +   +  S++T +  F Q +  G +  G  ++ RP +  F+Y      
Sbjct: 17  AFPALAEKISLNEISRYLNSLKTAKADFTQVNADGSISTGIVYIQRPQRVRFEYKG-DRT 75

Query: 85  SLISDGSNIAVYNAKL-DTWSVYPLRYMAFSVIFSNNQHVIQESIQRV---ESNNSFITI 140
            +++   N+AV++ K       YPL     S+I + N  + +  +      + N + +T 
Sbjct: 76  LVMASAGNVAVFDGKTRGAPQQYPLSKTPLSLILAPNIDLSRARMVTGYTEKKNTTVVTA 135

Query: 141 FFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
                     I + F     +L  W + D + + + + +   +         F I
Sbjct: 136 QDPQHPEYGNIQMVFTANPTQLRQWVVTDDTGKRTTVILGDMQTGMSFPASTFAI 190


>gi|288962145|ref|YP_003452440.1| hypothetical protein AZL_d00700 [Azospirillum sp. B510]
 gi|288914411|dbj|BAI75896.1| hypothetical protein AZL_d00700 [Azospirillum sp. B510]
          Length = 222

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 70/171 (40%), Gaps = 4/171 (2%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVS 85
           +        V K   +   I T+Q  FLQ    G    G F + RP +   +Y  P    
Sbjct: 37  SLSAQDQAVVAKVEAYLNGITTLQSKFLQVAPNGRQATGTFSLWRPGRMRLEYDRPLKDF 96

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFF-- 142
           +++DGS +  ++ ++   S  P+       I  ++  +  + ++  V  +   I +    
Sbjct: 97  IVADGSFVFYWDGEMRQQSSAPIGSTLADFILRSDIRLSGDVTVTEVFQSPGVIEVSLLE 156

Query: 143 KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
             D     +++ F+   ++L  W+++D+    + + +L  + +   D  +F
Sbjct: 157 TKDPGKGTLTLVFEDRPFQLRKWRVLDAQGLTTEVALLNPRTDVTFDRDMF 207


>gi|149184982|ref|ZP_01863299.1| outer membrane lipoprotein-sorting protein [Erythrobacter sp.
           SD-21]
 gi|148831093|gb|EDL49527.1| outer membrane lipoprotein-sorting protein [Erythrobacter sp.
           SD-21]
          Length = 220

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 38/189 (20%), Positives = 81/189 (42%), Gaps = 13/189 (6%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARP 71
           V   FY+A  P  AA        + +A+E    I TM+  F+Q D  G  + G   + RP
Sbjct: 24  VPASFYAAPAPVEAATGD-----LDQAVEALRGISTMRANFVQTDRNGQAVSGVMTLKRP 78

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRV 131
            K  F+Y     + ++S+G ++ + + +++    +P++      +   ++ V +      
Sbjct: 79  GKIRFEYEKGVPLLVVSNGKSMYMIDYEVNQVQRWPIKNSPLGALVDPSRDVKKYGRLVP 138

Query: 132 ESNNSFITIFFKDDFMG--NMISVTFDRL-----SYRLLNWKIMDSSRRYSIIKILKYKE 184
            S++  ++I  +D       +I++ F R        RL +W  +DS    + +++   + 
Sbjct: 139 TSHSDVVSIEVRDPKRPEFGVITLIFARDASAPGGLRLTHWVALDSQNHRTTVRLSNNRY 198

Query: 185 NTVLDPKVF 193
              +    F
Sbjct: 199 GVSVADSAF 207


>gi|296282149|ref|ZP_06860147.1| outer membrane lipoprotein-sorting protein [Citromicrobium
           bathyomarinum JL354]
          Length = 222

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 36/204 (17%), Positives = 82/204 (40%), Gaps = 8/204 (3%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVM 62
           L   + I ++     +A     A        S+  A+     I TM+ +F Q D  G  +
Sbjct: 12  LAGLASIALIAGAPIAATVALPAPALAQAGGSLDDAVAALRGISTMRASFTQTDRSGQTV 71

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQH 122
           +G   + RP K  F+YS    + ++S+G ++ + + +++    +P+       +   N+ 
Sbjct: 72  RGTMTLKRPGKIRFEYSKDVPLLIVSNGKSLTMVDYEVNQVQRWPISNSPLGALLDPNRD 131

Query: 123 VIQESIQRVESNNSFITIFFKDDFMG--NMISVTFDRL-----SYRLLNWKIMDSSRRYS 175
           V +    R   N + +++  +D       +I++ F R       + L NW  +D+    +
Sbjct: 132 VKKYGKLRNTGNPNVLSVEVRDPKKPEYGVITLIFVRKAGAPGGWELTNWVSLDAQNNRT 191

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
            +++   +    +    F     +
Sbjct: 192 TVRLANQRYGVSVSDSTFTYKDPR 215


>gi|302382163|ref|YP_003817986.1| outer membrane lipoprotein carrier protein LolA [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192791|gb|ADL00363.1| outer membrane lipoprotein carrier protein LolA [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 211

 Score =  163 bits (414), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 37/182 (20%), Positives = 77/182 (42%), Gaps = 5/182 (2%)

Query: 25  NAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG-YVMKGEFFMARPSKFYFKYSSPSS 83
            +        ++  A  +  ++ + QGTF +  AG     G F++ RP +  F+Y+ P+ 
Sbjct: 26  QSGLSAEDRATLATAQTYLQNLTSAQGTFTETGAGGQRRSGRFWLQRPGRMRFEYTDPAG 85

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQ----ESIQRVESNNSFIT 139
           + ++SDGSN+  Y+ +L+ +   PL     S   + N  + Q    + + R++S    +T
Sbjct: 86  LLVVSDGSNVKRYDPRLNVFRQVPLGATPLSTFLARNVRLDQGVRIDRVTRMQSGAFALT 145

Query: 140 IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           +          + + F     RL  W I ++S   +  ++      + L   +F +    
Sbjct: 146 VRDSSRPNDGSVILAFAGNPMRLQEWTITEASGARTRTQLTSLTPASGLSASLFRLTDPT 205

Query: 200 IH 201
             
Sbjct: 206 RR 207


>gi|83595027|ref|YP_428779.1| outer membrane lipoprotein carrier protein LolA [Rhodospirillum
           rubrum ATCC 11170]
 gi|83577941|gb|ABC24492.1| Outer membrane lipoprotein carrier protein LolA [Rhodospirillum
           rubrum ATCC 11170]
          Length = 221

 Score =  163 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 35/173 (20%), Positives = 75/173 (43%), Gaps = 7/173 (4%)

Query: 29  PITKDQS--VKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVS 85
            +T+DQ   V +   +   ++ +Q  FLQ  + G   +G   ++RP++   +Y  P+ + 
Sbjct: 36  QLTQDQRAFVARVEGYLNGVRRVQARFLQVSSTGNYAEGTVSISRPNRMRLQYDPPADLL 95

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQ----RVESNNSFITIF 141
           ++++GS +  Y+ +LD  S   L      V+  +   +   +I     R       I + 
Sbjct: 96  MVANGSQLVYYDRELDQVSYIGLDSTPLGVLLRDKIELSDPNITVTAYREAKGVVEIALV 155

Query: 142 FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
             +D     +++ F      L  W+++D+      + +   +    LDPK+F 
Sbjct: 156 QTNDPGQGTLTLVFTTDPLELRQWRVLDAQNVEVSVSLFNPQVGLALDPKLFV 208


>gi|254465563|ref|ZP_05078974.1| outer membrane lipoprotein carrier protein LolA [Rhodobacterales
           bacterium Y4I]
 gi|206686471|gb|EDZ46953.1| outer membrane lipoprotein carrier protein LolA [Rhodobacterales
           bacterium Y4I]
          Length = 194

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 65/169 (38%), Gaps = 5/169 (2%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLIS 88
             +  S+ +   +   I T    F Q  D G +  G+ +M RP +  F+Y      ++++
Sbjct: 19  AAEKLSLNEISRYLNGISTASSPFTQINDDGSLSTGKLYMHRPGRMRFEYDGKGGGTVVA 78

Query: 89  DGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFM 147
            G  + +++ K +     YPL+    S+I      + + ++    S +   TI    D  
Sbjct: 79  GGGAVVIHDPKSNQPPETYPLKRTPLSIILDRRVDLGRANMVVGYSFDGTSTIVRAQDPE 138

Query: 148 ---GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
                 I + F      L  W I DS+   + + +   K    L   +F
Sbjct: 139 HPDYGSIEMMFTGDPVELRKWVIHDSAGGKTTVILGAMKTGQKLSSSLF 187


>gi|326388589|ref|ZP_08210182.1| outer membrane lipoprotein carrier protein LolA [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326206840|gb|EGD57664.1| outer membrane lipoprotein carrier protein LolA [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 231

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 37/209 (17%), Positives = 79/209 (37%), Gaps = 8/209 (3%)

Query: 2   AFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGY 60
           AF +       ++L   S     +A        +V +AI    +I TM+  F+Q D  G 
Sbjct: 19  AFAVGAFSFSSILLSAVSFPSVAHADPAGAHPAAVDEAIAALRAITTMRADFVQTDANGG 78

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
            + G   M RP K  F+Y     + ++SDG+ + + + ++     +P+R      +   N
Sbjct: 79  RLNGTLTMKRPGKIRFQYQPGVPLLIVSDGAALTMIDYEVRQVQRWPIRNSPLGALLDPN 138

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFMG--NMISVTFDRL-----SYRLLNWKIMDSSRR 173
           + V + +          +++  +D        +++   R         L +W   D+  R
Sbjct: 139 KDVARFARLIPTGRPDQVSVAVRDPSHPEYGTLTLQMVRKASAPGGLELDSWITTDAQAR 198

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDKIHN 202
            + + ++  +    ++   F        N
Sbjct: 199 RTTVHLMNPQYGIPVNEITFRYRDPNPQN 227


>gi|126738704|ref|ZP_01754409.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseobacter sp. SK209-2-6]
 gi|126720503|gb|EBA17209.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseobacter sp. SK209-2-6]
          Length = 197

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 28/167 (16%), Positives = 66/167 (39%), Gaps = 5/167 (2%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
              S+ +   +   ++T   +F Q  D G +  G+ ++ RP +  F+Y      ++++  
Sbjct: 21  DQLSLNEISGYLNGLKTATASFSQISDDGSLTTGKLYLHRPGRMRFEYDGDGGGTVVAGA 80

Query: 91  SNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG- 148
             + V++ K +     +PLR    S+I +    + + ++      +   TI    D    
Sbjct: 81  GAVVVHDPKSNQPPETFPLRRTPLSIILAKKVDLGRANMVVGHGFDGTTTIVRAQDPENP 140

Query: 149 --NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
               + + F      L  W + DS+   + + +   +    L  ++F
Sbjct: 141 DYGSLELMFTGDPVELRKWVVHDSAGGQTTVILGALERGMSLSNRLF 187


>gi|148555456|ref|YP_001263038.1| outer membrane lipoprotein carrier protein LolA [Sphingomonas
           wittichii RW1]
 gi|148500646|gb|ABQ68900.1| outer membrane lipoprotein carrier protein LolA [Sphingomonas
           wittichii RW1]
          Length = 207

 Score =  157 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 33/183 (18%), Positives = 71/183 (38%), Gaps = 7/183 (3%)

Query: 26  AAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSV 84
           AA  + +  S+ +   H   I TM   F+Q D  G  + G   + +P K  F+Y     +
Sbjct: 21  AAPAMAQTASLDEVAAHLRGITTMTADFVQTDRNGKSLSGMLTLRQPGKVRFEYQKGVPL 80

Query: 85  SLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKD 144
            ++ DG  + + +  +   S +P+     SV+    + + + +     +    IT+  +D
Sbjct: 81  LIVGDGKALTMIDYSVRQVSRWPVGNSPLSVLIDPRRDMSRFAKVVPSTIPGTITVEARD 140

Query: 145 DFMG--NMISVTF----DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                   I++ F          L  W ++D+    S +++   +    +  K F+    
Sbjct: 141 GKHPEFGTITIVFAKGAGPGGLALQGWTVLDAQNGRSTVRLTNQRFGVAISDKAFKWDDP 200

Query: 199 KIH 201
           +  
Sbjct: 201 RPK 203


>gi|85375219|ref|YP_459281.1| outer membrane lipoprotein-sorting protein [Erythrobacter litoralis
           HTCC2594]
 gi|84788302|gb|ABC64484.1| outer membrane lipoprotein-sorting protein [Erythrobacter litoralis
           HTCC2594]
          Length = 221

 Score =  156 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 29/187 (15%), Positives = 73/187 (39%), Gaps = 8/187 (4%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYS 79
           I             S+  A+     I TM+ +F Q D  G  + G   + RP +  F+Y 
Sbjct: 28  IIATPVPVAAQSAGSLDDAVAALRGISTMRASFTQTDRKGQTVGGTMTLKRPGRIRFEYE 87

Query: 80  SPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFIT 139
               + ++S+GS++ + + +++    +P++      +   ++ V +        N   ++
Sbjct: 88  KGVPLLIVSNGSSMTLVDYEVNQVQRWPIKNSPLGALLDPSRDVKRYGKLISTGNRDVLS 147

Query: 140 IFFKDDFMG--NMISVTF-----DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
           +  +D       +I++ F         ++L NW  +D+    + +++   +    +    
Sbjct: 148 VEVRDPKKPEFGVITLIFLRNASAPGGWQLTNWVALDAQNNRTTVRLSNQRYGMSVSDAT 207

Query: 193 FEIPYDK 199
           F     +
Sbjct: 208 FRYKDPR 214


>gi|126728546|ref|ZP_01744362.1| outer membrane lipoprotein carrier protein LolA, putative
           [Sagittula stellata E-37]
 gi|126711511|gb|EBA10561.1| outer membrane lipoprotein carrier protein LolA, putative
           [Sagittula stellata E-37]
          Length = 222

 Score =  156 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 65/173 (37%), Gaps = 6/173 (3%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISD 89
            +  S+ +   +  ++QT++  F Q    G +  G   + RP K  F Y+ P    ++  
Sbjct: 48  AQQLSLNEISRYLNTLQTVKSPFTQINSDGTISTGTISIKRPGKARFDYNPPERGLVLVS 107

Query: 90  GSNIAVYNAKLD-TWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDF-- 146
             ++ + + KL      YPL     S+I + N ++ Q  +    S +   T+    D   
Sbjct: 108 SGSVYILDRKLGGMPETYPLEQTPLSIILARNVNLGQAGMVTGHSFDGTATVVTAQDPRR 167

Query: 147 -MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                I + F      L  W I D     + + +   ++   +    F I  +
Sbjct: 168 PEYGNIQLKFTANPTELRQWIITDGDGVKTTVVLGGLQKT-SIPTSQFLIDTE 219


>gi|114769831|ref|ZP_01447441.1| Putative outer membrane lipoprotein carrier protein [alpha
           proteobacterium HTCC2255]
 gi|114549536|gb|EAU52418.1| Putative outer membrane lipoprotein carrier protein [alpha
           proteobacterium HTCC2255]
          Length = 210

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 36/194 (18%), Positives = 85/194 (43%), Gaps = 5/194 (2%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGE 65
           K ++ + ILF    I  F       +  S+    ++   ++ ++  F Q    G +  G+
Sbjct: 9   KMMLKIKILFKVLFITCFMTHPSFAEKISLSNISDYINELKMVEADFEQINSDGSIDAGK 68

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVI 124
            ++ RP K   +Y +P++  +I+   N+A+++ K     +++PL+    +++   + ++I
Sbjct: 69  LYIRRPGKMRLEYEAPNNALVIAGAGNVAIFDDKTKNGPTIFPLKKTPLNLLLKKDVNLI 128

Query: 125 QESIQRVESN---NSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           +  +    +    N+FI +          I + F      L +W I + S + + I +  
Sbjct: 129 KNKMVSEHTEKNKNTFIVVQDPKRLSQGKIKMVFSNQPILLESWTITNQSNQKTKIMLNN 188

Query: 182 YKENTVLDPKVFEI 195
            +E   +   +F I
Sbjct: 189 LREVATIPLYLFNI 202


>gi|103488147|ref|YP_617708.1| outer membrane lipoprotein carrier protein LolA [Sphingopyxis
           alaskensis RB2256]
 gi|98978224|gb|ABF54375.1| outer membrane lipoprotein carrier protein LolA [Sphingopyxis
           alaskensis RB2256]
          Length = 206

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 35/200 (17%), Positives = 73/200 (36%), Gaps = 8/200 (4%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARP 71
           +I  F +A              ++     H  +  TM   F+Q D  G  + G+  + RP
Sbjct: 6   MIAPFAAAGLALATPAIGQSASALSSVQAHLKASDTMTADFVQTDRNGQRLSGKLTLKRP 65

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRV 131
            K  F+Y     + ++ DGS + V + ++     +P++      +   ++ + + +    
Sbjct: 66  GKIRFQYQKGVPMLIVGDGSRLTVIDYEVRQVQSWPVKNSPLGALLDPDRDLAKYARILP 125

Query: 132 ESNNSFITIFFKDDFMG--NMISVTFDRL-----SYRLLNWKIMDSSRRYSIIKILKYKE 184
             N   +++  KD        I++ F R        RL  W  +DS    + I +   + 
Sbjct: 126 TGNKDVLSVEVKDPERPEYGTITMVFVRDASAPAGLRLRGWVALDSQNNRTRIDLSNQRF 185

Query: 185 NTVLDPKVFEIPYDKIHNIN 204
           N  +    F     + +   
Sbjct: 186 NVAVADSAFRWTDPRPNRRG 205


>gi|58040407|ref|YP_192371.1| Outer-membrane lipoprotein carrier protein [Gluconobacter oxydans
           621H]
 gi|58002821|gb|AAW61715.1| Outer-membrane lipoprotein carrier protein [Gluconobacter oxydans
           621H]
          Length = 208

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 30/188 (15%), Positives = 66/188 (35%), Gaps = 4/188 (2%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARP 71
           V L   +      A         + +  +    + T+Q  F Q    G    G   + RP
Sbjct: 18  VALPSMAFAQATPAQLRPADQGWISRIEDTLGQVTTLQARFRQTAADGSTTVGTATLDRP 77

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQR 130
            +  F Y  PS + L+++   +   +  +D  +  PL      ++      +  + ++  
Sbjct: 78  GRMRFDYDKPSPLLLVANDGRVVFQDRSVDQVTTIPLDRTPLGLLLRPELKLSGDVTVTG 137

Query: 131 VESNNSFIT--IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
            E +N  I   +          +++        LL W ++D+  R + I +   +    +
Sbjct: 138 FEHSNGQIRVQVVRTQSAGEGTLTLVLSDAPLGLLGWTVVDAQGRTTTIALSDVRLGGTV 197

Query: 189 DPKVFEIP 196
              +F +P
Sbjct: 198 PQSLFVLP 205


>gi|332187682|ref|ZP_08389417.1| outer membrane lipocarrier LolA family protein [Sphingomonas sp.
           S17]
 gi|332012248|gb|EGI54318.1| outer membrane lipocarrier LolA family protein [Sphingomonas sp.
           S17]
          Length = 206

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 31/199 (15%), Positives = 72/199 (36%), Gaps = 8/199 (4%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFF 67
           +   ++     A+              +        ++ TM   F Q D AG V+ G   
Sbjct: 2   MASALLAPTAMAMVAAPVPALAQAGGDLAAVQRSLQALTTMTADFTQTDRAGKVLTGTLT 61

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           M +P K  F+Y     + +++DG  +   +  +     +P++     V+   ++ + + +
Sbjct: 62  MKKPGKIRFQYEKGVPLLIVADGGALTFIDYSVRQVQRWPIKNSPLGVLIDPSRDIGRYA 121

Query: 128 IQRVESNNSFITIFFKDDFMG--NMISVTFDRLSYR-----LLNWKIMDSSRRYSIIKIL 180
                +++  +++   D        I++ F R         L  W  +DS    + I++ 
Sbjct: 122 KVVPSADSRLLSVEANDPKHPEYGKITLVFARDPAAPGGLMLQGWVALDSQNNRTTIRLS 181

Query: 181 KYKENTVLDPKVFEIPYDK 199
             +    +D K F     +
Sbjct: 182 NQRYGVAVDDKAFRFNDPR 200


>gi|162149018|ref|YP_001603479.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209545232|ref|YP_002277461.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787595|emb|CAP57191.1| putative outer membrane lipoprotein carrier protein LolA
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532909|gb|ACI52846.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 223

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 69/179 (38%), Gaps = 5/179 (2%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKY 78
           A      A        V++  ++   + T++  F Q    G    G  +++RP +  F+Y
Sbjct: 38  APTAMTLALAPADRAWVQRVQDYLNGVTTLEAQFQQLAPDGKRTTGTAWLSRPGRMRFEY 97

Query: 79  SSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSF 137
             PS + L+++   +   +++L   +  PL      ++      +  + ++     +N  
Sbjct: 98  DKPSPLLLVANHGQVVFNDSQLGQTTTLPLDKTPLGLLLRPGLQLSGDVTVTGFTHSNGL 157

Query: 138 --ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK-ENTVLDPKVF 193
             +T+          +++ F      L +W ++D+  + + + +   +     L   +F
Sbjct: 158 VQVTLVRTASPADGSLTLVFHDSPMSLRSWSVVDAQGQETRVDLYNIRLGGGPLPDGLF 216


>gi|87201201|ref|YP_498458.1| outer membrane lipoprotein carrier protein LolA [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87136882|gb|ABD27624.1| outer membrane lipoprotein carrier protein LolA [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 228

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 30/172 (17%), Positives = 74/172 (43%), Gaps = 8/172 (4%)

Query: 36  VKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           V +A+    S+ T++  F+Q D  G  + G   + RP K  F+Y     + ++ DG  + 
Sbjct: 51  VDRAVTALRSVSTLRANFVQTDRSGQSVSGVLTLKRPGKIRFQYQKGVPLLIVGDGKALT 110

Query: 95  VYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG--NMIS 152
           + + ++     +P+R      +   ++ V + + Q   ++   +++  +D        I+
Sbjct: 111 MIDYEVRQVQRWPIRNSPLGALLDPSKDVARFAKQLPTNDRDVVSLQVRDPKHPEYGTIT 170

Query: 153 VTF-----DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           + F          +L +W  +DS  + + +++  ++    +D K F     +
Sbjct: 171 MIFVRNGAAPGGLQLDSWVALDSQNKRTTVRLSGHQYGVAVDDKTFRWTDPR 222


>gi|330994724|ref|ZP_08318647.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           sp. SXCC-1]
 gi|329758365|gb|EGG74886.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           sp. SXCC-1]
          Length = 213

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 35/212 (16%), Positives = 82/212 (38%), Gaps = 13/212 (6%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAY------PITKDQSVKKAIEH-FLSIQTMQGTF 53
           M F    ++ G+  L     + P   A          +D ++ + +EH   +I  ++  F
Sbjct: 1   MRFPSLLALCGLSCLLAGGMMPPVAHAQEQMAVGASDQDHALLEQVEHHLDAISQLKARF 60

Query: 54  LQE-DAGYVMKGEFFMARPSK-FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM 111
            Q    G    G  ++ R ++   F+Y  PS + L+++   +   +++LD  +  P+   
Sbjct: 61  RQTAPDGKQSTGTAWIDRANRRMRFQYDPPSPLLLVANHDQVVFNDSQLDQTTTMPMEKT 120

Query: 112 AFSVIFSNNQHVIQE-SIQRVESNN--SFITIFFKDDFMGNMISVTFDRLSYRLLNWKIM 168
              ++   +  +  + ++  +  +     IT+   D      +++ F     RL  W I 
Sbjct: 121 PLGLLLRPHLQLSGDVTVTGLSHDGHTLNITLVRTDSPGDGSMTLVFHDSPLRLRGWIIQ 180

Query: 169 DSSRRYSIIKILKYKE-NTVLDPKVFEIPYDK 199
           D+ +  + + +L       V    +F     +
Sbjct: 181 DAQQETTRVDLLDITTSGGVPPDSLFNTDLPE 212


>gi|307297052|ref|ZP_07576868.1| outer membrane lipoprotein carrier protein LolA [Sphingobium
           chlorophenolicum L-1]
 gi|306877578|gb|EFN08806.1| outer membrane lipoprotein carrier protein LolA [Sphingobium
           chlorophenolicum L-1]
          Length = 212

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 29/205 (14%), Positives = 73/205 (35%), Gaps = 10/205 (4%)

Query: 7   KSVIGVVILFFYSAIF--PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMK 63
           K ++  + L   +     P   A        + K   +  ++ TM   F Q D  G  + 
Sbjct: 2   KRILAPLTLTLAAVPVVVPMIPAAAQADRSDLSKVNAYIRAVTTMTADFAQTDRNGQTLT 61

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHV 123
           G+  + +P +  F+Y     + ++ DG  + + + ++     +P+       +   N+ +
Sbjct: 62  GQLTIKQPGRIRFQYQKGVPLLIVGDGKALTMIDYEVRQVQRWPIGNSPLGALIDPNKDL 121

Query: 124 IQESIQRVESNNSFITIFFKDDFMG--NMISVTF-----DRLSYRLLNWKIMDSSRRYSI 176
            +        + + +++  +D        I++ F          +L  W  +DS    + 
Sbjct: 122 SKFGKVIQTGDPTVLSVQARDPKRPEYGTITMIFKRDVGSPAGLQLYGWVALDSQNNRTA 181

Query: 177 IKILKYKENTVLDPKVFEIPYDKIH 201
           +K+   +    +   VF     +  
Sbjct: 182 VKLSNQRYGVPVADSVFRWTDPRPK 206


>gi|114798962|ref|YP_762219.1| LolA family outer membrane lipoprotein carrier protein [Hyphomonas
           neptunium ATCC 15444]
 gi|114739136|gb|ABI77261.1| outer membrane lipoprotein carrier protein, LolA family [Hyphomonas
           neptunium ATCC 15444]
          Length = 220

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 40/170 (23%), Positives = 78/170 (45%), Gaps = 4/170 (2%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLIS 88
             +   +K+A      ++T +G F Q    G    G+F M RP K  F Y  P  + ++S
Sbjct: 45  AERATILKQASSALAGVKTARGRFEQYSPDGAYSTGQFAMQRPGKVRFDYDDPVPLLMVS 104

Query: 89  DGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHV-IQESIQRVESNNSF--ITIFFKDD 145
           DG+ +A+ +A L+T    PL     S++ S+      Q ++  V   N    IT+  K  
Sbjct: 105 DGTTVALQDADLETTDRVPLGSTPLSLLLSDRLDFESQANVLDVRRANGTTNITVQDKAG 164

Query: 146 FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
            M   +++        L+ W+ +D++   + +++   +    L+P++F +
Sbjct: 165 EMEGTLTLVLSEADNSLVGWRSVDANGGNTSVQLSDIETGAKLNPRLFIL 214


>gi|85710027|ref|ZP_01041092.1| outer membrane lipoprotein-sorting protein [Erythrobacter sp. NAP1]
 gi|85688737|gb|EAQ28741.1| outer membrane lipoprotein-sorting protein [Erythrobacter sp. NAP1]
          Length = 221

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 32/193 (16%), Positives = 75/193 (38%), Gaps = 9/193 (4%)

Query: 11  GVVILFFYSAIFPFNAAYPITKDQS-VKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFM 68
              I    S      A + + +  + + +A+    SI TM+  F Q D  G   +G   +
Sbjct: 17  AGTIALGVSLPHGEPAPHALAQSSADLDRAVSALRSISTMKADFSQTDRQGRTARGTMTL 76

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI 128
             P K  F Y   S + ++S+G ++ + + +++    +P+R      +    + +     
Sbjct: 77  KSPGKIRFDYGRDSDLLIVSNGRSLYMVDYEVNQVERWPIRNSPLGALLDPERDMKDYGT 136

Query: 129 QRVESNNSFITIFFKDDFMG--NMISVTFDRLS-----YRLLNWKIMDSSRRYSIIKILK 181
                N   ++I  +D        +++ F R S      +L +W  +D+    + +++  
Sbjct: 137 LIPTGNPDVLSIDVRDPNKPELGRMNLIFVRNSSAPGGLQLTHWVALDAQNHRTTVRLTN 196

Query: 182 YKENTVLDPKVFE 194
           ++    +    F 
Sbjct: 197 HRYGVSVPDSTFN 209


>gi|209966057|ref|YP_002298972.1| outer membrane lipoprotein carrier protein LolA,putative
           [Rhodospirillum centenum SW]
 gi|209959523|gb|ACJ00160.1| outer membrane lipoprotein carrier protein LolA,putative
           [Rhodospirillum centenum SW]
          Length = 240

 Score =  151 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 31/162 (19%), Positives = 68/162 (41%), Gaps = 4/162 (2%)

Query: 36  VKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           + +   +   I T++  FLQ  D G  +KG F +ARP +    Y  P    +++DG  + 
Sbjct: 67  LARVEAYLNGIGTLRSRFLQVADDGSSVKGTFALARPGRMRIDYDPPVGNFIVADGRFVY 126

Query: 95  VYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKD--DFMGNMI 151
            ++A+L   S  P+       +      +  + ++  V  +   + +      D     +
Sbjct: 127 FWDAELKQQSNAPIGSTLADFLLRPQISLSGDVTVTEVAHDGGVLEVTLAQTKDPALGRL 186

Query: 152 SVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
           ++ F+   + L  W+++D+    + I +L  +    L  + F
Sbjct: 187 TLVFEERPFALRKWRVLDAQGLTTEISLLSPETGVELKDEQF 228


>gi|294013495|ref|YP_003546955.1| outer membrane lipoprotein carrier protein LolA [Sphingobium
           japonicum UT26S]
 gi|292676825|dbj|BAI98343.1| outer membrane lipoprotein carrier protein LolA [Sphingobium
           japonicum UT26S]
          Length = 217

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 28/207 (13%), Positives = 70/207 (33%), Gaps = 8/207 (3%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYV 61
           F  +   +  + L       P   A        + +   +  ++ TM   F Q D  G  
Sbjct: 5   FAPHGLTLAALTLAVAPFAAPMMPAAAQAGQSDLSRVNAYIRAVTTMTADFAQTDRNGQT 64

Query: 62  MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQ 121
           + G   + +P K  F+Y     + ++ DG  + + + ++     +P+       +   N+
Sbjct: 65  LTGRLTIKQPGKIRFQYQKGVPLLIVGDGKALTMIDYEVRQVQRWPIGNSPLGALIDPNK 124

Query: 122 HVIQESIQRVESNNSFITIFFKDDFMG--NMISVTF-----DRLSYRLLNWKIMDSSRRY 174
            + +        + + +++  +D        I++ F          +L  W  +DS    
Sbjct: 125 DLSKFGKVIQTGDPTVLSVQARDPRRPEYGTITMIFKRDAGSPAGLQLYGWVALDSQNNR 184

Query: 175 SIIKILKYKENTVLDPKVFEIPYDKIH 201
           + +K+   +    +    F     +  
Sbjct: 185 TAVKLSNQRYGVPVADSAFRWTDPRPK 211


>gi|94496588|ref|ZP_01303164.1| outer membrane lipoprotein carrier protein LolA [Sphingomonas sp.
           SKA58]
 gi|94423948|gb|EAT08973.1| outer membrane lipoprotein carrier protein LolA [Sphingomonas sp.
           SKA58]
          Length = 212

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 26/183 (14%), Positives = 67/183 (36%), Gaps = 8/183 (4%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVS 85
           A     D  + +   +  ++ TM   F Q D  G  + G+  + +P K  F+Y     + 
Sbjct: 24  AAAQQGDADLSRVNAYIRAVTTMTADFSQTDRNGQTLTGKLTLKQPGKIRFQYQKGVPLL 83

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD 145
           ++ DG  + V + ++     +P+       +   ++ + +        + S +++  +D 
Sbjct: 84  IVGDGKALTVIDYEVRQVQRWPIGNSPLGALIDPSKDLSKFGKVIPTDDPSILSVQARDP 143

Query: 146 FMG--NMISVTF-----DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                  I++ F          +L  W  +DS    + +++   +    ++   F     
Sbjct: 144 KRPEFGTITMIFKRDAASPAGLQLYGWVALDSQNNRTAVRLTNQRYGAPVEDSAFRWTDP 203

Query: 199 KIH 201
           +  
Sbjct: 204 RPR 206


>gi|83945068|ref|ZP_00957434.1| Outer-membrane lipoprotein carrier protein [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851850|gb|EAP89705.1| Outer-membrane lipoprotein carrier protein [Oceanicaulis alexandrii
           HTCC2633]
          Length = 236

 Score =  147 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 31/187 (16%), Positives = 74/187 (39%), Gaps = 11/187 (5%)

Query: 25  NAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK-GEFFMARPSKFYFKYSSPSS 83
            A   IT +    +A      + T++  F Q  A      G   + RP +  F Y  P+ 
Sbjct: 40  TAPGQITPEAGADRAQAWLEGLDTLRARFEQIAADNSETAGVLEIDRPGRARFDYDDPNP 99

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI-QESIQRVESNNS--FITI 140
           V +++DGS +A+ +  L+T    P+       +  ++  +    ++      +   F+T+
Sbjct: 100 VLVVADGSTVAIADFDLETIDRAPIGATPLRFLLEDDLDLAGSGAVVDAGRYDGRLFVTL 159

Query: 141 FFKDDFMGNMISVTF-------DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
              +  +   +++ F          +  L  W  +D+    + +K+ + +    + P+ F
Sbjct: 160 EDPEGEVQGRLTLVFEDATPDAGPETMALAGWYAVDAMGGLTEVKLTEIETGVRISPRQF 219

Query: 194 EIPYDKI 200
            +  + +
Sbjct: 220 ILDDEDV 226


>gi|71083032|ref|YP_265751.1| Outer membrane lipoprotein carrier protein [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|91762543|ref|ZP_01264508.1| Outer membrane lipoprotein carrier protein [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|71062145|gb|AAZ21148.1| Outer membrane lipoprotein carrier protein [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|91718345|gb|EAS84995.1| Outer membrane lipoprotein carrier protein [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 184

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 40/186 (21%), Positives = 79/186 (42%), Gaps = 10/186 (5%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARP 71
           ++IL F+S   P N++          K I        +   F Q        G+  +  P
Sbjct: 5   IIILLFFSFYLPGNSSPK-------DKIISQMKLTNNLNFNFKQTINDKSEDGKCIIEYP 57

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQ-ESIQR 130
            K +  Y++ +   L+S+GS++ +      ++  YPL       +      + + E ++ 
Sbjct: 58  KKIFCVYNNANKKILVSNGSSLVIETNNKGSYYRYPLNKTPLEFLLDKEYLISKIEKLEP 117

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
            + +N ++   FK     N I++ FD+    L+ W+  D  +  SI  I   K+N  +D 
Sbjct: 118 RDIDNKYLN--FKIFENNNEINIFFDKKDLNLIGWQTKDIYQNLSITFISSIKKNQEIDG 175

Query: 191 KVFEIP 196
            +F++P
Sbjct: 176 NIFKLP 181


>gi|218680394|ref|ZP_03528291.1| outer membrane lipoprotein carrier protein LolA [Rhizobium etli
           CIAT 894]
          Length = 137

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 36/125 (28%), Positives = 61/125 (48%), Gaps = 3/125 (2%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITK--DQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
            +  + ++G   +   ++  P  A          + +   +HF  + TMQG F+Q    G
Sbjct: 12  TVTRRDLLGAFAIAATASAIPLGAHAQAAAPASGTAQAIADHFSGVTTMQGEFVQFGPRG 71

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G+FF+ RP K  F Y  PS + +I+DG N+A+ N KL TW +YPL     S++ + 
Sbjct: 72  EQTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNVAIGNTKLKTWDLYPLSKTPLSLLLAQ 131

Query: 120 NQHVI 124
           +  + 
Sbjct: 132 HIDLS 136


>gi|296116274|ref|ZP_06834891.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295977208|gb|EFG83969.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 237

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 28/187 (14%), Positives = 71/187 (37%), Gaps = 12/187 (6%)

Query: 13  VILFFYSAIFPFNAAYPI-----TKDQS-VKKAIEHFLSIQTMQGTFLQE-DAGYVMKGE 65
           ++L   +   P +A   +      +D + + +  EH  +I  +   F Q    G    G 
Sbjct: 34  LVLGLGAYAQPASAQAQMVVGASDQDHALINRIEEHLNTITLLTAQFHQVASDGKQSTGT 93

Query: 66  FFMARPSK-FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
            ++ R ++   F+Y  PS + L+++   +   +++L   +  P+      ++   +  + 
Sbjct: 94  AWLDRRNRRMRFQYDPPSPLLLVANHDQVVFNDSELGQTTTMPMDKTPIGLLLRPHLELS 153

Query: 125 QE-SIQR-VESNNSF-ITIFFKDDFMGNMISVTF-DRLSYRLLNWKIMDSSRRYSIIKIL 180
            +  +   +       IT+   D      +++ F +    RL  W + D+    + + +L
Sbjct: 154 GDVRVTALMHEGPEIEITLVRADSPGDGSLTLLFQEDKGLRLRGWIVQDAQGESTRVDLL 213

Query: 181 KYKENTV 187
                  
Sbjct: 214 HATVGGR 220


>gi|241762157|ref|ZP_04760240.1| outer membrane lipoprotein carrier protein LolA [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241373407|gb|EER63007.1| outer membrane lipoprotein carrier protein LolA [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 222

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/201 (17%), Positives = 75/201 (37%), Gaps = 10/201 (4%)

Query: 11  GVVILFFYSAIFPFNAAYPITKDQSV-KKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFM 68
             +      + FP  AA       +V  +  +H   + TM   F+Q D  G  + G   +
Sbjct: 20  AFLSTGLCLSAFPAIAAPASDASSTVFPQIQKHLREVSTMTAHFVQVDRNGQALDGSLTL 79

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI 128
            +P    F+Y     + ++ DG  + + +  +   S +P+     S++   ++ +   + 
Sbjct: 80  KKPGLIRFQYQKDVPLLVVGDGKALVMIDYSVRQVSRWPIGDSPLSILIDPSKDIASYA- 138

Query: 129 QRVESNNSFITIFFKDDFMG--NMISVTFDRLSYR-----LLNWKIMDSSRRYSIIKILK 181
                +   I I   D        I++ F R         L+ W ++D+    S I + +
Sbjct: 139 TLTSDDGKNIVITGHDPKHPDFGTIAINFQRDKSAPAQLMLMGWTVIDAQNNRSQIILSE 198

Query: 182 YKENTVLDPKVFEIPYDKIHN 202
            K N  +   +F     + +N
Sbjct: 199 QKFNQPVSNNMFRWNDPRGNN 219


>gi|260753747|ref|YP_003226640.1| outer membrane lipoprotein carrier protein LolA [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|258553110|gb|ACV76056.1| outer membrane lipoprotein carrier protein LolA [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 222

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 36/201 (17%), Positives = 75/201 (37%), Gaps = 10/201 (4%)

Query: 11  GVVILFFYSAIFPFNAAYPITKDQSV-KKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFM 68
             +      + FP  AA       +V  +  +H   + TM   F+Q D  G  + G   +
Sbjct: 20  AFLSTGLCLSAFPAIAAPASDASSTVFPQIQKHLREVATMTAHFVQVDRNGQALDGSLTL 79

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI 128
            +P    F+Y     + ++ DG  + + +  +   S +P+     S++   ++ +   + 
Sbjct: 80  KKPGLIRFQYQKDVPLLVVGDGKALVMIDYSVRQVSRWPIGDSPLSILIDPSKDIASYA- 138

Query: 129 QRVESNNSFITIFFKDDFMG--NMISVTFDRLSYR-----LLNWKIMDSSRRYSIIKILK 181
                +   I I   D        I++ F R         L+ W ++D+    S I + +
Sbjct: 139 TLTSDDGKNIVITGHDPKHPDFGTIAINFQRDKSAPAQLMLMGWTVIDAQNNRSQIILSE 198

Query: 182 YKENTVLDPKVFEIPYDKIHN 202
            K N  +   +F     + +N
Sbjct: 199 QKFNQPVSNNMFRWNDPRGNN 219


>gi|283856532|ref|YP_163436.2| outer membrane lipoprotein carrier protein LolA [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|283775537|gb|AAV90325.2| outer membrane lipoprotein carrier protein LolA [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 222

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 36/201 (17%), Positives = 75/201 (37%), Gaps = 10/201 (4%)

Query: 11  GVVILFFYSAIFPFNAAYPITKDQSV-KKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFM 68
             +      + FP  AA       +V  +  +H   + TM   F+Q D  G  + G   +
Sbjct: 20  AFLSTGLCLSAFPAIAAPASDASSTVFPQIQKHLREVATMTAHFVQVDRNGQALDGSLTL 79

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI 128
            +P    F+Y     + ++ DG  + + +  +   S +P+     S++   ++ +   + 
Sbjct: 80  KKPGLIRFQYQKDVPLLVVGDGKALVMIDYSVRQVSRWPIGDSPLSILIDPSKDIASYAA 139

Query: 129 QRVESNNSFITIFFKDDFMG--NMISVTFDRLSYR-----LLNWKIMDSSRRYSIIKILK 181
                +   I I   D        I++ F R         L+ W ++D+    S I + +
Sbjct: 140 LT-SDDGKNIVITGHDPKHPDFGTIAINFQRDKSAPAQLMLMGWTVIDAQNNRSQIILSE 198

Query: 182 YKENTVLDPKVFEIPYDKIHN 202
            K N  +   +F     + +N
Sbjct: 199 QKFNQPVSNNMFRWNDPRGNN 219


>gi|294085376|ref|YP_003552136.1| outer membrane lipoprotein carrier protein LolA [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664951|gb|ADE40052.1| outer membrane lipoprotein carrier protein LolA [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 195

 Score =  118 bits (296), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 31/158 (19%), Positives = 61/158 (38%), Gaps = 4/158 (2%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           + F  + TMQ  F Q    G   +G  ++ RP +   +Y    ++ LI+    + V   K
Sbjct: 32  DWFADLTTMQADFTQISSDGSAAEGTLYLRRPHRMKIEYDGDDALVLITTPVWLHVDQPK 91

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQ---RVESNNSFITIFFKDDFMGNMISVTFD 156
               + YP+   A S+I      +  +  Q   RV    + I +  +       +++ F 
Sbjct: 92  QKRVTSYPISETALSLILKEKVVLRADDFQTSARVADGIATIYLSKESGEAAGDLALEFS 151

Query: 157 RLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
              ++L  W + DS    + + +   K       ++F 
Sbjct: 152 LQPFQLRKWTVRDSVGVTTSVTLQNMKFGLTFRNELFR 189


>gi|192358939|ref|YP_001983015.1| outer membrane lipoprotein carrier protein LolA [Cellvibrio
           japonicus Ueda107]
 gi|190685104|gb|ACE82782.1| outer membrane lipoprotein carrier protein LolA [Cellvibrio
           japonicus Ueda107]
          Length = 207

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 38/197 (19%), Positives = 76/197 (38%), Gaps = 23/197 (11%)

Query: 11  GVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKG 64
            V +L    ++        +  DQ+  +  +H  ++ ++QG F Q              G
Sbjct: 7   CVALLLACCSLIA------MADDQAATQLRKHLDAMNSLQGQFTQTVRDAQGEIQEQSHG 60

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNN 120
           +F + RP KFY+  + P    L+S+  NI +Y+  L+T +V      LR     ++ S +
Sbjct: 61  DFMLMRPGKFYWNTAEPMPQLLVSNNKNIWLYDPDLETVNVREFSNDLRETPA-LLLSED 119

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFMG----NMISVTFDRLSYRLLNWKIMDSSRRYSI 176
              ++++             F     +       + + F     +L  + I DS  + + 
Sbjct: 120 VEKLRKNFTITRKAEGTTEQFTLTPKVTEGLFQQLVLVFGAG--QLSEFVIQDSLGQMTR 177

Query: 177 IKILKYKENTVLDPKVF 193
            ++   K N  L  + F
Sbjct: 178 CELSNVKRNQTLPEEKF 194


>gi|254456048|ref|ZP_05069477.1| outer membrane lipoprotein carrier protein [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207083050|gb|EDZ60476.1| outer membrane lipoprotein carrier protein [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 181

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 45/193 (23%), Positives = 87/193 (45%), Gaps = 21/193 (10%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARP 71
           ++IL F+  I         +K +  +K IE+  +++ ++  F Q   G +  G   +  P
Sbjct: 5   ILILIFFVLI-------SNSKAEIKEKIIENLQNVENLKFKFEQNINGKIENGICTIKYP 57

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN-----QHVIQE 126
            K Y KYS  ++  L+S+G ++ +      ++  Y L+    ++I   N      + ++E
Sbjct: 58  KKIYCKYSK-NNKILVSNGKSLVIKTE--TSFYRYSLKKTPLNLILDKNFLIKKINFLKE 114

Query: 127 SIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
           +I  ++ N    TI   D    N I V FD  ++ L+ WK  D  +  +I  +   + N 
Sbjct: 115 NI--IDKNLINYTIVEND----NEIDVFFDIKTFNLVGWKTRDIYQNTNITYLSSIETNK 168

Query: 187 VLDPKVFEIPYDK 199
            +   +F+IP   
Sbjct: 169 EITKNLFKIPSQN 181


>gi|288941165|ref|YP_003443405.1| outer membrane lipoprotein carrier protein LolA [Allochromatium
           vinosum DSM 180]
 gi|288896537|gb|ADC62373.1| outer membrane lipoprotein carrier protein LolA [Allochromatium
           vinosum DSM 180]
          Length = 219

 Score =  104 bits (260), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 82/201 (40%), Gaps = 17/201 (8%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMK-----GEFFMA 69
           +   A+F    +  +   +  ++  ++   + +++  F Q        +     G  ++ 
Sbjct: 17  WLIPALFALCCSNSVFAAEGAQRVDDYLKGLNSLKADFEQFTFNAERTQMMERRGTLYLQ 76

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW----SVYPLRYMAFSVIFSNNQHVIQ 125
           RP +F ++Y  P    +I+D   + +++ +L           LR    +++ SN   + Q
Sbjct: 77  RPGRFRWEYEGPDKQIIIADSQRVYMHDVELKQVSHQSQTKALRGTP-ALLLSNTDPIEQ 135

Query: 126 -ESIQRVESNN--SFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
              ++ +ES +   ++ +  KD       I + F R +  L +  + DS  + + +    
Sbjct: 136 HFEVRPIESTDGRDWVELIPKDAETDVVRIELGFGRDT--LDSLIMEDSFGQETRLNFTG 193

Query: 182 YKENTVLDPKVFEIPYDKIHN 202
            + N  L P +F+I    + +
Sbjct: 194 AQRNVSLKPDLFKIDQRAVDD 214


>gi|114320864|ref|YP_742547.1| outer membrane lipoprotein carrier protein LolA [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|122941173|sp|Q0A7Y0|LOLA_ALHEH RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|114227258|gb|ABI57057.1| outer membrane lipoprotein carrier protein LolA [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 214

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 85/207 (41%), Gaps = 19/207 (9%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKA--IEHFLSIQTMQGTFLQ---EDAGYV--- 61
           +   +L          +  P+  +Q+  +A    ++  + ++QG F Q   +++G +   
Sbjct: 5   LAFAVLLALCLSL---SVMPVLAEQAATRADLARYYDDVTSLQGRFTQQTHDESGRILEE 61

Query: 62  MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS---VIFS 118
             GEF++ RP +F + Y+ P    ++SDG  + VY+  LD  +V  L          +  
Sbjct: 62  SSGEFWIERPDRFRWNYAEPWPQEIVSDGERLWVYDQDLDQVTVRSLADSLGRGPATLLG 121

Query: 119 NNQHVIQESIQRVESNNSFITIFFKDDFMGNMISV--TFDRLSYRLLNWKIMDSSRRYSI 176
                ++E+ +        + +  ++  +     +    D +   L    + D   + ++
Sbjct: 122 GTLGELEEAFELTFPEPGRVALQPREATLDYEHVLLRLEDGVPVELE---LEDGLGQITV 178

Query: 177 IKILKYKENTVLDPKVFEIPYDKIHNI 203
           +++   + +  +DP  FE    +  ++
Sbjct: 179 LRLEALERDVEIDPGRFEFQPPEGADV 205


>gi|77163879|ref|YP_342404.1| Outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           oceani ATCC 19707]
 gi|254435438|ref|ZP_05048945.1| outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           oceani AFC27]
 gi|76882193|gb|ABA56874.1| Outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           oceani ATCC 19707]
 gi|207088549|gb|EDZ65821.1| outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           oceani AFC27]
          Length = 236

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 37/181 (20%), Positives = 70/181 (38%), Gaps = 15/181 (8%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV------MKGEFFMARPSKFYFKYSS 80
           A+ ++ ++             +++  F Q             KG FF+ RP KF + Y  
Sbjct: 43  AFTLSAEEPGDHLETFLQKTHSLRAEFQQILLDERNQPLEESKGVFFLQRPGKFRWDYHE 102

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQESIQRVESNNS 136
           P S ++++DG ++  Y+  L   +V      L      ++          SI  + S+N 
Sbjct: 103 PFSQTIVADGEHVWFYDPDLAQVTVKNQGLALGDTPALLLSGKRLPAENFSISNLPSDNH 162

Query: 137 F--ITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
              + +  +D       + + FD     L   ++ DS  R + +   K + N  LDP +F
Sbjct: 163 LAWVELRPRDKEAAFERLLLAFDDDG--LRQMELHDSFGRTTRLVFSKLEINLSLDPSLF 220

Query: 194 E 194
            
Sbjct: 221 V 221


>gi|300115267|ref|YP_003761842.1| outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           watsonii C-113]
 gi|299541204|gb|ADJ29521.1| outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           watsonii C-113]
          Length = 219

 Score =  100 bits (250), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 40/206 (19%), Positives = 76/206 (36%), Gaps = 21/206 (10%)

Query: 11  GVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------EDAGYVMKG 64
            ++ +   S +F   A  P        +         +++  F Q             +G
Sbjct: 16  ALLGMILGSLVFTLRAEEPGA------RLDTFLQKTHSLRAEFQQILLDERNQPMEESRG 69

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIFSNN 120
            FF+ RP KF + Y  P S ++++DG ++  Y+  L   +V      L      ++    
Sbjct: 70  VFFLQRPGKFRWDYHKPFSQTIVADGEHVWFYDPDLAQVTVKNQASALGDTPALLLSGKR 129

Query: 121 QHVIQESIQRVESNNSF--ITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             V   SI  + S N    + +  +D       + + FD     L   ++ DS  R + +
Sbjct: 130 LPVENFSISNLPSGNHLAWVELRPRDKEAAFERLLLGFDDDG--LRQMELHDSFGRTTRL 187

Query: 178 KILKYKENTVLDPKVFEIPYDKIHNI 203
              K + N  LDP +F     +  ++
Sbjct: 188 VFSKLEINPSLDPSLFVFTPPEGADV 213


>gi|58038536|ref|YP_190500.1| Outer-membrane lipoprotein carrier protein [Gluconobacter oxydans
           621H]
 gi|58000950|gb|AAW59844.1| Outer-membrane lipoprotein carrier protein [Gluconobacter oxydans
           621H]
          Length = 197

 Score = 98.8 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/178 (14%), Positives = 71/178 (39%), Gaps = 9/178 (5%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEF-FMARPSKFYFKYSSPSSVS 85
            P  +   V +   +   +Q +Q  FLQ         G F ++  P      Y +P  + 
Sbjct: 22  LPAAEQDDVHRIEAYLNGVQGLQAAFLQHGPDAGESAGRFSYI--PGHLRLDYVAPHPME 79

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSF--ITIFF 142
           L++   ++ + +      +   LR+    ++         +  +  V   +    I++  
Sbjct: 80  LVAGDGHLVLDDPATGAVTHLSLRHNPLGLLLKYPIRFDGDVQVTDVRHGDGSLQISVAQ 139

Query: 143 KDDFMGNMISVTFDRLSYR--LLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
            D+    ++++ F  ++ +  L+  + +D+ + + ++++   ++   + P VF  P +
Sbjct: 140 ADNPSQGLLTIQFSEVNGQLGLIGLQGVDARQHHFVVELSAVQQGVAIAPSVFTPPAE 197


>gi|226940195|ref|YP_002795268.1| NadE [Laribacter hongkongensis HLHK9]
 gi|226715121|gb|ACO74259.1| NadE [Laribacter hongkongensis HLHK9]
          Length = 739

 Score = 98.1 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 30/183 (16%), Positives = 72/183 (39%), Gaps = 11/183 (6%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK---GEFFMARPSKFYFKYSSPSSVSL 86
             +  ++    +     ++M+  F Q  +G   +   G   ++RP KF + YS P    +
Sbjct: 556 AAQADAIASLKQFVGQTRSMKAEFTQVVSGRQTQTASGSLELSRPGKFRWTYSQPYPQLI 615

Query: 87  ISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESI--QRVESNNSFITI 140
           + DG  + VY++ L   +       L     +++  +N+      +    +++   ++  
Sbjct: 616 VGDGQRLWVYDSDLAQVTSKKLDDALGSSPAALLAGSNEIERDYRLKNLGMQNGFDWLEA 675

Query: 141 FFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
             K +   N + + F      L    + DS  + + +   + ++N  +DP  F     K 
Sbjct: 676 TPKKEGSFNSVRMGF--KGSELAGMVLTDSFGQTTTLTFSQVQKNPKIDPDRFRFTPPKG 733

Query: 201 HNI 203
            ++
Sbjct: 734 VDV 736


>gi|292493396|ref|YP_003528835.1| outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           halophilus Nc4]
 gi|291581991|gb|ADE16448.1| outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           halophilus Nc4]
          Length = 195

 Score = 96.5 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/181 (17%), Positives = 70/181 (38%), Gaps = 15/181 (8%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQ------EDAGYVMKGEFFMARPSKFYFKYSS 80
           A+ +  ++   +       + +++  F Q       +     +G FF+ RP KF + Y  
Sbjct: 2   AFALKAEEPGARLETFLERVHSLRAEFHQILLDEYNEPLEESRGIFFLQRPGKFRWDYHE 61

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQESIQRVESNNS 136
           P + ++++DG  I  Y+  L+  +V      L      ++           I  + S+N 
Sbjct: 62  PFTQAIVADGERIWFYDPDLEQVTVKNQKLALGDTPALLLSGERLPEETFQINNLASHNH 121

Query: 137 FITIFF--KDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
              +    ++       + + FD  +  L   ++ DS  + + +   + + N  LD  +F
Sbjct: 122 LAWVELLPRNKEAAFERLLLGFDNNT--LRQMELHDSFGQITRLSFSEVEVNLSLDSSLF 179

Query: 194 E 194
            
Sbjct: 180 V 180


>gi|88798709|ref|ZP_01114292.1| outer-membrane lipoprotein carrier protein precursor [Reinekea sp.
           MED297]
 gi|88778472|gb|EAR09664.1| outer-membrane lipoprotein carrier protein precursor [Reinekea sp.
           MED297]
          Length = 209

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/199 (19%), Positives = 79/199 (39%), Gaps = 16/199 (8%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------EDAGYVM 62
           +IG  I  F  +     A+Y    DQ+    IE   +++T+   F Q           V 
Sbjct: 1   MIGKKISVFAISFMVMAASY--ADDQARAALIEQLEALETLSADFEQRTYQETSPRADVS 58

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFS 118
            G F +++P++F++    P    +I+DG  + VY+  L+  +       L      ++  
Sbjct: 59  SGTFQLSKPNRFHWHVQEPFEQRVIADGELLWVYDPDLEQATYQSLNQNLSQSPAMILTQ 118

Query: 119 NNQHVIQE-SIQRVESNNSFITIFFK--DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
             Q +  +  + +V   +          DD + + + + FD   + +   +I+DS  + +
Sbjct: 119 PRQTLTDDYGVIKVALEDGVAYRLTPSSDDAIFDELLMRFDPAGH-INQLRILDSLGQET 177

Query: 176 IIKILKYKENTVLDPKVFE 194
            +       N+ L   +F 
Sbjct: 178 QVTFSNVDVNSPLADDLFV 196


>gi|153871550|ref|ZP_02000694.1| Outer membrane lipoprotein carrier protein LolA [Beggiatoa sp. PS]
 gi|152071984|gb|EDN69306.1| Outer membrane lipoprotein carrier protein LolA [Beggiatoa sp. PS]
          Length = 202

 Score = 94.2 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/170 (18%), Positives = 70/170 (41%), Gaps = 23/170 (13%)

Query: 41  EHFLSIQTMQGTFLQ---EDAGY---VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
                +QT++G F Q    + G      +G+ +M RP +F ++Y  P +  +++DG NI 
Sbjct: 25  NFLQGLQTLRGQFYQELYNEKGTLLERSQGKMYMQRPDQFRWEYEQPYNQLIVADGKNIF 84

Query: 95  VYNAKLDTWSVYPLRYMAFS---VIFSNNQHVIQE---SIQRVESNNSFITIFFKDDFMG 148
           +Y+  L+  ++  L          + S ++ + ++   +    + + +   +  KD    
Sbjct: 85  IYDIDLEQVTLRSLDKTIGKTPAFLLSRSRQLGEDFFVNQLSQQEDKTRFELIPKDAQAQ 144

Query: 149 NMISVTFDRLSYRLLNWK-----IMDSSRRYSIIKILKYKENTVLDPKVF 193
                 FD +   L         ++D+  + + I   +   N  LD  +F
Sbjct: 145 ------FDSIRINLRGNTLQSFELVDNLGQTTYITFRQLIRNKKLDEGLF 188


>gi|121998176|ref|YP_001002963.1| outer membrane lipoprotein carrier protein LolA [Halorhodospira
           halophila SL1]
 gi|189028553|sp|A1WWU9|LOLA_HALHL RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|121589581|gb|ABM62161.1| outer membrane lipoprotein carrier protein LolA [Halorhodospira
           halophila SL1]
          Length = 208

 Score = 93.4 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 35/177 (19%), Positives = 79/177 (44%), Gaps = 19/177 (10%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEFFMARPSKFYFKYSSPSSV 84
            +   ++   +++  ++T+QG F Q   +D G V     G+F + RP +F++ Y+ P S 
Sbjct: 19  AQAGQLQALEDYYRDVETVQGVFNQFTLDDRGQVIEESSGDFAIHRPDRFHWSYAGPFSQ 78

Query: 85  SLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQESIQRVESNNSFITI 140
            +I+DG  + VY+ +LD  +V      L      ++  +   +  E +  +     ++ +
Sbjct: 79  EIIADGERLWVYDVELDQVTVRDQRAVLGSAPAQLLSGDYADL--EELFELAETEDYVRL 136

Query: 141 FFKD---DFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
             +D    F    + +  D     L    I D+  + + +++ + + N  +D + F 
Sbjct: 137 TPRDGGEAFDEARLGMR-DGHPSALE---IDDALGQVTRVELDEVRLNDAVDEERFR 189


>gi|253998903|ref|YP_003050966.1| outer membrane lipoprotein carrier protein LolA [Methylovorus sp.
           SIP3-4]
 gi|253985582|gb|ACT50439.1| outer membrane lipoprotein carrier protein LolA [Methylovorus sp.
           SIP3-4]
          Length = 209

 Score = 93.4 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/201 (15%), Positives = 79/201 (39%), Gaps = 18/201 (8%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV----- 61
           +S +  ++L F SA     A   + +    ++    + +   ++  F Q  +        
Sbjct: 2   RSFLNTLLLAFSSASMLAPA---LAQADGPERLKAFYQNTVGLKAQFKQTVSDAQGRKVQ 58

Query: 62  -MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVI 116
            + G+  + RP KF + Y  P    ++ DG  + +Y+ +L+  +V  L         +++
Sbjct: 59  EVTGDMQLQRPGKFRWDYQKPYVQQIVGDGQKVWLYDPELNQVTVRSLSKAIGSSPAAML 118

Query: 117 FSNNQHVIQESIQRVESNNSF--ITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRR 173
             + +     ++Q   +      +    ++   G   I + F     +L   +++DS   
Sbjct: 119 AGSKEMEKSFALQDGGNQGGLEWVKATPREKESGFEQIMIGFKGD--QLAQMELLDSFGH 176

Query: 174 YSIIKILKYKENTVLDPKVFE 194
            ++I+  + + N  L  + F 
Sbjct: 177 RTLIEFSQIERNPTLAAQAFR 197


>gi|146282640|ref|YP_001172793.1| outer-membrane lipoprotein carrier protein [Pseudomonas stutzeri
           A1501]
 gi|145570845|gb|ABP79951.1| periplasmic chaperone LolA [Pseudomonas stutzeri A1501]
          Length = 215

 Score = 92.3 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 36/210 (17%), Positives = 72/210 (34%), Gaps = 21/210 (10%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MK 63
           + ++ L   S +    A     +  S K+        +T+ G F Q   + +G       
Sbjct: 8   MQLIRLLCASVLMVALAPVHADQAASTKRLTGLLNQAETLTGRFSQLSLDGSGTQLQETS 67

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSN 119
           GE  + RP +F +   +P    L+S+G  + +Y+  L+  ++  L         +++ S 
Sbjct: 68  GELALKRPGQFRWHTDAPMEQLLVSNGKKVWLYDPDLEQVTIQELDQRLTHTP-ALLLSG 126

Query: 120 NQHVIQESI-QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RR 173
           +   I E+     +     +    K           FD L        I D        +
Sbjct: 127 DVSTISENFEVSHKEAGDVVDFTLKPKAKDT----LFDNLRLSFRGGVINDMQLIDSVGQ 182

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            + I  +  K N  L   +F     +  ++
Sbjct: 183 RTNILFMGVKMNQPLKADLFTFEIPEGADV 212


>gi|254489676|ref|ZP_05102872.1| outer membrane lipoprotein carrier protein LolA [Methylophaga
           thiooxidans DMS010]
 gi|224465085|gb|EEF81338.1| outer membrane lipoprotein carrier protein LolA [Methylophaga
           thiooxydans DMS010]
          Length = 212

 Score = 91.9 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 76/193 (39%), Gaps = 18/193 (9%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---DAGY---VMKGEFFM 68
           LF    +    +    T +  + + ++H   ++T Q  F Q      G      +G F +
Sbjct: 10  LFLSLLLVTGLSQAQTTGEDKLNQFVQH---VETFQAAFEQTVIDPEGQVMEQAQGLFVL 66

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVI 124
           +RP KF + Y +P    +++DG NI  Y+  L+  +V      L     +++        
Sbjct: 67  SRPGKFRWDYETPYPQKIVADGKNIWFYDVDLEQVTVKSQQEALAETPATLLSGELVPED 126

Query: 125 QESIQRVESNNSFITIFFKDDFMGNM---ISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           + +I  + S++  + +        +    +++ FD     L    + DS  + + +   +
Sbjct: 127 KYNINNLPSDDGLLWVELTPKQTESNFQAVTLAFDGD--VLQQMIMRDSFDQRTRLTFTQ 184

Query: 182 YKENTVLDPKVFE 194
             EN      +F+
Sbjct: 185 VIENPKFKQDMFK 197


>gi|327480898|gb|AEA84208.1| outer-membrane lipoprotein carrier protein [Pseudomonas stutzeri
           DSM 4166]
          Length = 215

 Score = 91.9 bits (227), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 39/207 (18%), Positives = 72/207 (34%), Gaps = 23/207 (11%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MK 63
           + ++ L   S +    A     +  S K+        +T+ G F Q   + +G       
Sbjct: 8   MQLIRLLCASVLMVALAPAHADQAASTKRLTGLLNQAETLTGRFSQLSLDGSGTQLQETS 67

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSN 119
           GE  + RP +F +   +P    L+S+G  + +Y+  L+  ++  L         +++ S 
Sbjct: 68  GELALKRPGQFRWHTDAPMEQLLVSNGKKVWLYDPDLEQVTIQELDQRLTHTP-ALLLSG 126

Query: 120 NQHVIQESI-QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RR 173
           +   I E+     +     +    K           FD L        I D        +
Sbjct: 127 DVSTISENFEVSHKEAGDVVDFTLKPKAKDT----LFDNLRLSFRGGVINDMQLIDSVGQ 182

Query: 174 YSIIKILKYKENTVLDPKV--FEIPYD 198
            + I  +  K N  L   +  FEIP  
Sbjct: 183 RTNILFMGVKMNQPLKADLFTFEIPDG 209


>gi|313201002|ref|YP_004039660.1| outer membrane lipoprotein carrier protein lola [Methylovorus sp.
           MP688]
 gi|312440318|gb|ADQ84424.1| outer membrane lipoprotein carrier protein LolA [Methylovorus sp.
           MP688]
          Length = 209

 Score = 91.5 bits (226), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 32/201 (15%), Positives = 79/201 (39%), Gaps = 18/201 (8%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV----- 61
           +S +  ++L F SA      A  + +    ++    + +   ++  F Q  +        
Sbjct: 2   RSFLNTLLLAFSSASM---LAPTLAQADGPERLKAFYQNTVGLKAQFKQTVSDAQGRKVQ 58

Query: 62  -MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVI 116
            + G+  + RP KF + Y  P    ++ DG  + +Y+ +L+  +V  L         +++
Sbjct: 59  EVTGDMQLQRPGKFRWDYQKPYVQQIVGDGQKVWLYDPELNQVTVRSLSKAIGSSPAAML 118

Query: 117 FSNNQHVIQESIQRVESNNSF--ITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRR 173
             + +     ++Q   +      +    ++   G   I + F     +L   +++DS   
Sbjct: 119 AGSKEMEKSFALQDGGNQGGLEWVKATPREKESGFEQIMIGFKGD--QLAQMELLDSFGH 176

Query: 174 YSIIKILKYKENTVLDPKVFE 194
            ++I+  + + N  L  + F 
Sbjct: 177 RTLIEFSQIERNPTLAAQAFR 197


>gi|53804159|ref|YP_114221.1| outer membrane lipoprotein carrier protein LolA [Methylococcus
           capsulatus str. Bath]
 gi|81681833|sp|Q607H7|LOLA_METCA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|53757920|gb|AAU92211.1| outer membrane lipoprotein carrier protein LolA [Methylococcus
           capsulatus str. Bath]
          Length = 208

 Score = 90.7 bits (224), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 33/170 (19%), Positives = 65/170 (38%), Gaps = 15/170 (8%)

Query: 38  KAIEHFLSIQTMQGTFLQE---DAG---YVMKGEFFMARPSKFYFKYSSPSSVSLISDGS 91
           +      S +T+Q  F Q    ++G       G F++ RP KF + Y+ P    ++S G 
Sbjct: 28  RLKSFLDSARTLQADFTQVRLDESGRPRQESGGSFYLQRPGKFRWDYTKPYRQQIVSSGG 87

Query: 92  NIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE---SIQRVESNNSFITIFFKD 144
            +  Y+  L+  +   L         +++ S    +        Q  E    +I +  K 
Sbjct: 88  KVWFYDVDLEQVTAKRLGQAVGSTP-ALLLSGEMALEDNFTIEDQGTEEGMYWIKLVPKS 146

Query: 145 DFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
           +  G    +       +L   ++ D+  + + I     +    LDPK+F+
Sbjct: 147 EEGGFRYVLIGLEGD-KLAGMELSDNFGQLTRIYFANLRTGITLDPKLFQ 195


>gi|74317515|ref|YP_315255.1| outer membrane lipoprotein carrier protein LolA [Thiobacillus
           denitrificans ATCC 25259]
 gi|123731796|sp|Q3SIS5|LOLA_THIDA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|74057010|gb|AAZ97450.1| outer membrane lipoprotein carrier protein LolA [Thiobacillus
           denitrificans ATCC 25259]
          Length = 202

 Score = 90.7 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 32/187 (17%), Positives = 69/187 (36%), Gaps = 15/187 (8%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQE--DAGYVMK----GEFFMARPSKFYFKYSSPSS 83
                 V++        +T +  F Q   D    +     G+   ARP KF + Y +P  
Sbjct: 15  AAHAGGVERLKAFIAGAKTAEADFTQTVADRNNRVTQEASGKMAFARPGKFRWDYRAPYE 74

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFIT 139
             ++ DG+ + +Y+A LD  +V PL         +++  ++      S++    +     
Sbjct: 75  QVIVGDGAKLWLYDADLDQVTVKPLGEVIAGTPAALLAGDDAIEKYFSLKNAGESGGLEW 134

Query: 140 IFFKDDFMGN---MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
           +             I + F      L+  ++ D+  + + +K+  +  N  + P  F   
Sbjct: 135 LEATPKSRDTSFERIRMGFKGD--VLVQMELFDTFGQRTTLKLSNFARNPRIAPSRFVFT 192

Query: 197 YDKIHNI 203
             K  ++
Sbjct: 193 PPKGADV 199


>gi|54297678|ref|YP_124047.1| hypothetical protein lpp1729 [Legionella pneumophila str. Paris]
 gi|81601795|sp|Q5X4E7|LOLA_LEGPA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|53751463|emb|CAH12881.1| hypothetical protein lpp1729 [Legionella pneumophila str. Paris]
          Length = 202

 Score = 90.4 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 69/189 (36%), Gaps = 14/189 (7%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY-----VMKGEFFMARPSKFYFKYSSP 81
           ++ +    S +       +IQTM   F Q             G   + RP +F ++   P
Sbjct: 13  SHEVFSQTSAEVLQSKLNAIQTMTANFSQIVKAKNHEVSRSSGSMALQRPGRFRWQTKDP 72

Query: 82  SSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQESIQRVESNNSF 137
               +++DG  + +Y+  L+  +V      L   A   +   ++ +  +     +     
Sbjct: 73  LEQLIVADGQKMWIYDVDLEQVTVKNQEKGLGGTAALFLSGYDETLTHDFDVSEKQKGKL 132

Query: 138 ITIFFKDDFMG---NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
                K          I + F +    L+  ++ D   + + +K+++ K N  L  K+F+
Sbjct: 133 TVFDLKSKSAKENFQRIKLIFSQS--ALIGLELYDQLGQITDVKLVQIKSNPKLPAKLFQ 190

Query: 195 IPYDKIHNI 203
               K  ++
Sbjct: 191 FKPPKGVDV 199


>gi|34497069|ref|NP_901284.1| outer membrane lipoproteins carrier protein [Chromobacterium
           violaceum ATCC 12472]
 gi|47117164|sp|Q7NXL2|LOLA_CHRVO RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|34102926|gb|AAQ59290.1| outer membrane lipoproteins carrier protein [Chromobacterium
           violaceum ATCC 12472]
          Length = 206

 Score = 90.4 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/167 (18%), Positives = 63/167 (37%), Gaps = 13/167 (7%)

Query: 38  KAIEHFLSIQTMQGTFLQE--DAGYVMK--GEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           +        +T+   F Q   + G   +  G   +ARP KF ++Y+ P +  ++ DG  +
Sbjct: 28  QLKAFVSGSKTLSADFNQTVTNKGKREEASGRLEIARPGKFRWEYTKPYAQLIVGDGKTL 87

Query: 94  AVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFF---KDDF 146
            +Y+  L   +       L     +++  NN+      +           +     K D 
Sbjct: 88  WIYDQDLAQVTRKAQGAALGSSPAALLAGNNEIERSYKLNEAGKQGDLEWLAASPKKQDN 147

Query: 147 MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
             + I + F   +  L+  ++ DS    + I   + ++N  L P  F
Sbjct: 148 TFSAIRMGF--KNNVLVEMQLTDSFGNDTRIVFSQQRQNAALPPARF 192


>gi|54294652|ref|YP_127067.1| hypothetical protein lpl1729 [Legionella pneumophila str. Lens]
 gi|81601313|sp|Q5WVT2|LOLA_LEGPL RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|53754484|emb|CAH15968.1| hypothetical protein lpl1729 [Legionella pneumophila str. Lens]
          Length = 202

 Score = 90.4 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 70/189 (37%), Gaps = 14/189 (7%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY-----VMKGEFFMARPSKFYFKYSSP 81
           ++ +    S +       +IQTM   F Q             G   + RP +F ++   P
Sbjct: 13  SHEVFSQTSAEVLQSKLNAIQTMTANFSQIVKAKNREVSRSSGSMALQRPGRFRWQTKDP 72

Query: 82  SSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQESIQRVESNNSF 137
               +++DG  + +Y+  L+  +V      L   A   +   ++ +  +     +     
Sbjct: 73  LEQLIVADGQKMWIYDVDLEQVTVKNQEKGLGGTAALFLSGYDETLTHDFDVSEKQKGKL 132

Query: 138 ITIFFKDDFMG---NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
                K          I + F + +  L+  ++ D   + + +K+++ K N  L  K+F+
Sbjct: 133 TVFDLKSKSAKENFQRIKLIFSQST--LIGLELYDQLGQITDVKLVQIKSNPKLPAKLFQ 190

Query: 195 IPYDKIHNI 203
               K  ++
Sbjct: 191 FNPPKGVDV 199


>gi|52841992|ref|YP_095791.1| outer membrane lipoprotein carrier protein [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|52629103|gb|AAU27844.1| outer membrane lipoprotein carrier protein [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
          Length = 204

 Score = 90.0 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 70/189 (37%), Gaps = 14/189 (7%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY-----VMKGEFFMARPSKFYFKYSSP 81
           ++ +    S +       +IQTM   F Q             G   + RP +F ++   P
Sbjct: 15  SHEVFSQTSAEVLQSKLNAIQTMTANFSQIVKAKNREVSRSSGSMALQRPGRFRWQTKDP 74

Query: 82  SSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQESIQRVESNNSF 137
               +++DG  + +Y+  L+  +V      L   A   +   ++ +  +     +     
Sbjct: 75  LEQLIVADGQKMWIYDVDLEQVTVKNQEKGLGGTAALFLSGYDETLTHDFDVSEKQKGKL 134

Query: 138 ITIFFKDDFMG---NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
                K          I + F + +  L+  ++ D   + + +K+++ K N  L  K+F+
Sbjct: 135 TVFDLKSKSAKENFQRIKLIFSQST--LIGLELYDQLGQITDVKLVQIKSNPKLPAKLFQ 192

Query: 195 IPYDKIHNI 203
               K  ++
Sbjct: 193 FKPPKGVDV 201


>gi|148359309|ref|YP_001250516.1| outer membrane lipoprotein carrier protein [Legionella pneumophila
           str. Corby]
 gi|296107356|ref|YP_003619056.1| Outer membrane lipoprotein-sorting protein [Legionella pneumophila
           2300/99 Alcoy]
 gi|172047872|sp|A5ICS0|LOLA_LEGPC RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|148281082|gb|ABQ55170.1| outer membrane lipoprotein carrier protein [Legionella pneumophila
           str. Corby]
 gi|295649257|gb|ADG25104.1| Outer membrane lipoprotein-sorting protein [Legionella pneumophila
           2300/99 Alcoy]
 gi|307610464|emb|CBX00035.1| hypothetical protein LPW_17911 [Legionella pneumophila 130b]
          Length = 202

 Score = 90.0 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 70/189 (37%), Gaps = 14/189 (7%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY-----VMKGEFFMARPSKFYFKYSSP 81
           ++ +    S +       +IQTM   F Q             G   + RP +F ++   P
Sbjct: 13  SHEVFSQTSAEVLQSKLNAIQTMTANFSQIVKAKNREVSRSSGSMALQRPGRFRWQTKDP 72

Query: 82  SSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQESIQRVESNNSF 137
               +++DG  + +Y+  L+  +V      L   A   +   ++ +  +     +     
Sbjct: 73  LEQLIVADGQKMWIYDVDLEQVTVKNQEKGLGGTAALFLSGYDETLTHDFDVSEKQKGKL 132

Query: 138 ITIFFKDDFMG---NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
                K          I + F + +  L+  ++ D   + + +K+++ K N  L  K+F+
Sbjct: 133 TVFDLKSKSAKENFQRIKLIFSQST--LIGLELYDQLGQITDVKLVQIKSNPKLPAKLFQ 190

Query: 195 IPYDKIHNI 203
               K  ++
Sbjct: 191 FKPPKGVDV 199


>gi|91775478|ref|YP_545234.1| outer membrane lipoprotein carrier protein LolA [Methylobacillus
           flagellatus KT]
 gi|122400017|sp|Q1H294|LOLA_METFK RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|91709465|gb|ABE49393.1| outer membrane lipoprotein carrier protein LolA [Methylobacillus
           flagellatus KT]
          Length = 205

 Score = 89.6 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/176 (16%), Positives = 64/176 (36%), Gaps = 15/176 (8%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQEDAGYV------MKGEFFMARPSKFYFKYSSPSSVS 85
           +   V+     F S   M+  F Q            ++G   + RP KF + Y+ P    
Sbjct: 20  RADGVESLKAFFKSTSAMRAHFRQVVTDAQGNKVQEVEGHMQLQRPGKFRWDYNKPYVQQ 79

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFI--- 138
           ++ DG  + +Y+  L+  +V P+         S++          ++  V  ++      
Sbjct: 80  IVGDGEKVWLYDPDLNQLTVRPMSKAIGSSPASLLAGAQDAERNFTLTTVIRSDGLAWAQ 139

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
            +   +D   + + + F      L   ++ DS    + I+  + + N  +    F+
Sbjct: 140 AVPKAEDSGFDKVLLGFKGD--ELQKMELHDSFGHVTSIQFSQLQRNPAIANSSFQ 193


>gi|30249051|ref|NP_841121.1| Outer membrane lipoprotein carrier protein LolA [Nitrosomonas
           europaea ATCC 19718]
 gi|47117197|sp|Q82VM2|LOLA_NITEU RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|30138668|emb|CAD84963.1| Outer membrane lipoprotein carrier protein LolA [Nitrosomonas
           europaea ATCC 19718]
          Length = 206

 Score = 89.2 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 37/203 (18%), Positives = 73/203 (35%), Gaps = 25/203 (12%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE--DAG----Y 60
             ++ V++L       P  A+   +    V KA+       T Q  F Q   D       
Sbjct: 2   TRLLFVLVLSVCLLPVPVKASAVKSLKTFVNKAL-------TFQANFSQTLLDKNFQVIR 54

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVI 116
              G     RP KF + Y  P    ++ DG  +  Y+  L   +V+ L         +++
Sbjct: 55  KASGSMMFERPGKFRWTYDQPYQQLIVGDGKQVWFYDQDLAQVTVHRLDQALGSTPAALL 114

Query: 117 -----FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS 171
                   + ++ +  +Q        I    ++ F   +I + F   +  L    + DS 
Sbjct: 115 AGGNTIERDFNLQEIDVQGETEWLEAIPKNQENSFE--LIRLGFS-KTGILREMVLRDSF 171

Query: 172 RRYSIIKILKYKENTVLDPKVFE 194
            + + +   + ++N  L P +F+
Sbjct: 172 DQVTWLIFSEIEQNPTLTPDLFQ 194


>gi|167041847|gb|ABZ06588.1| putative Outer membrane lipoprotein carrier protein LolA
           [uncultured marine microorganism HF4000_097M14]
          Length = 192

 Score = 89.2 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 41/197 (20%), Positives = 76/197 (38%), Gaps = 9/197 (4%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKG 64
           + K +  ++ +FF        ++  + KD      I    +I+T+   F Q+ +     G
Sbjct: 1   MTKKLFFLLNIFFIYLFSAGVSSADLQKD-----LINKLTAIKTLSFDFKQKISDKEEIG 55

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN--QH 122
             F+  P      Y +    ++IS+G  +A+   K      YP++      I       +
Sbjct: 56  NCFIKYPLLMKCNYQNLKQKTIISNGKTVAIIKKKYKKIYYYPIKSTPLFFILKKEKIIN 115

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
           +I++++   E N   I   F D    N + + FD+ S     WK  D         I   
Sbjct: 116 LIRKNL-PTEINAGLIEFEFIDQKT-NKVKILFDKNSLEFKGWKTKDVYSNNVSFTINNL 173

Query: 183 KENTVLDPKVFEIPYDK 199
           K N  +    F+IP ++
Sbjct: 174 KINNQIIDDFFKIPKEE 190


>gi|209542305|ref|YP_002274534.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209529982|gb|ACI49919.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 202

 Score = 89.2 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 24/192 (12%), Positives = 67/192 (34%), Gaps = 7/192 (3%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARP 71
           ++L    A+    AA      + V +   +  + + +     Q    G V +G      P
Sbjct: 11  LVLTAPLALAACQAAPGPVGGRDVARIERYLNTTRGLSAHVAQTWPDGGVGEGTLSYD-P 69

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQR 130
                 Y +P  + L++ G ++   +A   + +   L      ++ +   H+  E ++  
Sbjct: 70  GYLRLDYDTPHRMRLVAAGGHLVFRDAVRQSVTRMNLSRQPLGLLLATPVHLGGEVTVTA 129

Query: 131 VESNNSFITIFFKD--DFMGNMISVTFD--RLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
           ++  +  + +      +    ++++ F        L+   I+D     + + +   +  T
Sbjct: 130 IQHGDHVLQVSLARTANPSQGLLTLGFSDFAGQLSLVAIDILDERHNRTRLHLTDQRTGT 189

Query: 187 VLDPKVFEIPYD 198
                 F +  +
Sbjct: 190 AFPADFFSLTAE 201


>gi|91204861|ref|YP_537216.1| Outer membrane lipoprotein-sorting protein LolA [Rickettsia bellii
           RML369-C]
 gi|157826507|ref|YP_001495571.1| Outer membrane lipoprotein-sorting protein LolA [Rickettsia bellii
           OSU 85-389]
 gi|91068405|gb|ABE04127.1| Outer membrane lipoprotein-sorting protein LolA [Rickettsia bellii
           RML369-C]
 gi|157801811|gb|ABV78534.1| Outer membrane lipoprotein-sorting protein LolA [Rickettsia bellii
           OSU 85-389]
          Length = 214

 Score = 88.8 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 31/193 (16%), Positives = 79/193 (40%), Gaps = 7/193 (3%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMAR 70
           +  L          AA+      ++ +   +  +++++   F QED  G +++G+  +++
Sbjct: 4   IFFLIIVCIFTNSIAAFGSDDKAAILELKTYLRTMKSIAVDFTQEDSKGNIVQGKLLISK 63

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQR 130
           P  F   Y  P  + ++   + +++Y+  ++  S        F+ +  +N++  ++ +  
Sbjct: 64  PYNFRCNYYPPFPIIIVGTKNFVSMYDYDMEQVSRIARDENIFNFLLEDNENFDKDFVVE 123

Query: 131 ---VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
               E   S I I+ K     + I++        LL   I + +   + IK     +   
Sbjct: 124 SVVNEKEFSRINIYHKVTERHSEITLNKANKQIELLK--IFEDTNVVT-IKFDNIVKVQK 180

Query: 188 LDPKVFEIPYDKI 200
            D  +F++   +I
Sbjct: 181 FDEDLFKLKNPEI 193


>gi|92114553|ref|YP_574481.1| outer-membrane lipoprotein carrier protein [Chromohalobacter
           salexigens DSM 3043]
 gi|122990444|sp|Q1QUS6|LOLA_CHRSD RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|91797643|gb|ABE59782.1| outer membrane lipoprotein carrier protein LolA [Chromohalobacter
           salexigens DSM 3043]
          Length = 210

 Score = 88.8 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 36/205 (17%), Positives = 74/205 (36%), Gaps = 20/205 (9%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE--DAGYV--- 61
                  +    +   P  A     +    ++      S+ +    F Q+  D G     
Sbjct: 1   MRAFKWALAIGATLALPLTA---QAQTGGAERLAALLESVTSYSADFDQQILDGGGQRLQ 57

Query: 62  -MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVI 116
             +G  +++RP KF+++  +P    ++SDG  + +Y+  L+  SV PL          ++
Sbjct: 58  EAEGHMWLSRPGKFHWEVEAPYRQVVVSDGDKVYLYDPDLEQVSVRPLDTRVTHTPALLL 117

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGN---MISVTFDRLSYRLLNWKIMDSSRR 173
             +   + +         +   T              + +TF+    RL   ++ DS+ +
Sbjct: 118 SGSADALTENYAVESRQGDDEETFTLTPKSPDTLFESLQLTFENE--RLEGLQMEDSTGQ 175

Query: 174 YSIIKILKYKENTVLDPK--VFEIP 196
            + I     + N  +D     FEIP
Sbjct: 176 RTAIAFDDIEVNGDIDASRFTFEIP 200


>gi|255019844|ref|ZP_05291920.1| Outer membrane lipoprotein carrier protein LolA [Acidithiobacillus
           caldus ATCC 51756]
 gi|254970773|gb|EET28259.1| Outer membrane lipoprotein carrier protein LolA [Acidithiobacillus
           caldus ATCC 51756]
          Length = 228

 Score = 88.4 bits (218), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 32/208 (15%), Positives = 74/208 (35%), Gaps = 15/208 (7%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG- 59
           M     +  IG++  +                  +V+     F    T+   F QE A  
Sbjct: 9   MKTERRRGGIGLLWRWLMGFTLGLLLVGVAQAAGAVQDLHRFFQDTHTVTADFSQEIANA 68

Query: 60  -----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY---- 110
                    G  +++RP KF + Y+  +   ++S+G  + +Y   L   +V PL      
Sbjct: 69  QGEIIKRASGRLWVSRPGKFRWDYAGANGQVIVSNGERVWLYEPALQQVTVQPLGKSLGS 128

Query: 111 MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNM----ISVTFDRLSYRLLNWK 166
              ++I   +       ++ + +      +  +           + + FD    +L   +
Sbjct: 129 TPAALIAGRDTLDQDFKVKALPAKAGLQWVLLEPKEGQTQGFTSLRLGFDGRG-QLREMR 187

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFE 194
           + D+  + ++++  K + N  +   VF+
Sbjct: 188 MEDAFSQTTLLRFTKVRVNAPVAAHVFQ 215


>gi|71906931|ref|YP_284518.1| Outer membrane lipoprotein carrier protein LolA [Dechloromonas
           aromatica RCB]
 gi|123746928|sp|Q47GI3|LOLA_DECAR RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|71846552|gb|AAZ46048.1| Outer membrane lipoprotein carrier protein LolA [Dechloromonas
           aromatica RCB]
          Length = 208

 Score = 88.0 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 28/203 (13%), Positives = 72/203 (35%), Gaps = 20/203 (9%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAG-- 59
           +  +++  ++     A+ P      +    +V +  +   + +T++  F Q      G  
Sbjct: 1   MRMNIVQKILSATCFALLPL-----LAHAGAVDQLHDFLKNTRTLKAEFSQAVISRNGRK 55

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFS 114
                G   ++RP K  ++   P    ++ DG  I +++ +L   +V      +     +
Sbjct: 56  PQQSSGTIAISRPGKLRWEIVKPFPQLVVGDGEKIWIHDPELQQVTVRKAGQAIGSSPAA 115

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGN---MISVTFDRLSYRLLNWKIMDSS 171
           ++  NN      +++          +        +    + + F      L   ++ DS 
Sbjct: 116 LLSGNNDLEKNFTLKDAGEAEGMAWVDATPKAGDSGFEKVRLGFSGGD--LRAMELFDSF 173

Query: 172 RRYSIIKILKYKENTVLDPKVFE 194
            + + I+  K + N  L    F+
Sbjct: 174 GQTTQIRFSKIERNPALPAATFK 196


>gi|270159556|ref|ZP_06188212.1| outer membrane lipoprotein carrier protein LolA [Legionella
           longbeachae D-4968]
 gi|289165648|ref|YP_003455786.1| Outer-membrane lipoprotein carrier protein precursor [Legionella
           longbeachae NSW150]
 gi|269987895|gb|EEZ94150.1| outer membrane lipoprotein carrier protein LolA [Legionella
           longbeachae D-4968]
 gi|288858821|emb|CBJ12735.1| Outer-membrane lipoprotein carrier protein precursor [Legionella
           longbeachae NSW150]
          Length = 202

 Score = 88.0 bits (217), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 29/175 (16%), Positives = 61/175 (34%), Gaps = 14/175 (8%)

Query: 41  EHFLSIQTMQGTFLQEDAGY-----VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAV 95
                I+ M   F Q             G   + RP +F ++ + P +  +++DG  I V
Sbjct: 27  AKLNGIRAMTANFKQSVKAKHRVVSRSSGTMALQRPGRFRWQTAQPMAQLMVADGQRIWV 86

Query: 96  YNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGN-- 149
           Y+  L+  +V      L   A   +   +  V ++           +    K        
Sbjct: 87  YDKDLEQVTVKKQSKGLGGTAALFLSGYDDTVTRDFNVSQTGVGDELVFDLKSKSSKASF 146

Query: 150 -MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
             I + F +    L   ++ D   + + +++ + K N  L   +F+    K  ++
Sbjct: 147 QRIKLNFRQD--LLTGLELYDQLGQVTTVQLSQIKLNPKLASNMFQFKTPKGVDV 199


>gi|85712405|ref|ZP_01043455.1| Outer membrane lipoprotein-sorting protein [Idiomarina baltica
           OS145]
 gi|85693848|gb|EAQ31796.1| Outer membrane lipoprotein-sorting protein [Idiomarina baltica
           OS145]
          Length = 204

 Score = 87.7 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 28/195 (14%), Positives = 73/195 (37%), Gaps = 22/195 (11%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV------MKGEF 66
           + L   +++    +      +Q+ ++  +    ++++Q +F Q   G        + GE 
Sbjct: 6   IALALIASVV--MSPLSWATEQAKQQLQDKMQQLESVQASFEQTVTGSSGEVLQSLTGEL 63

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQH 122
            + RP+   ++ + P    LI+DG ++  YN  ++  +VY            ++   ++ 
Sbjct: 64  ALQRPAMLRWRSNPPDDTLLIADGESVWYYNPFVEQVTVYAQSNAVENSPLLLLMEGSKE 123

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYR---LLNWKIMDSSRRYSIIKI 179
             Q+     +S      +  ++   G+ ++++F         L            + I +
Sbjct: 124 RWQQFDVTYDSAEGAFEVVNEN--TGSELNLSFTGDKLARIVLKQ-----KQGDTTTIAL 176

Query: 180 LKYKENTVLDPKVFE 194
                N  L   +F+
Sbjct: 177 TDVVMNERLPTDLFQ 191


>gi|331001207|ref|ZP_08324834.1| outer membrane lipoprotein carrier protein LolA [Parasutterella
           excrementihominis YIT 11859]
 gi|329569139|gb|EGG50931.1| outer membrane lipoprotein carrier protein LolA [Parasutterella
           excrementihominis YIT 11859]
          Length = 221

 Score = 87.7 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 42/213 (19%), Positives = 80/213 (37%), Gaps = 17/213 (7%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------ 56
            L  K  +    L   + +FPF     +   Q +          +   G F Q+      
Sbjct: 10  RLRKKRFMKKTALLTITGLFPF-----VVFSQPLDLLNNFLNETKQASGAFEQQTFQKDG 64

Query: 57  -DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYM 111
             A  + KG F  +RP KF + Y+SP    ++ DGS I +++  L+  +V      +   
Sbjct: 65  KPAEELQKGTFSFSRPGKFVWTYTSPYPQKMVCDGSRIYIWDEDLNQVTVRSAKGAIPKS 124

Query: 112 AFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMI-SVTFDRLSYRLLNWKIMDS 170
             S++F    +    +  + +  + +  I          + SV+F   S +L     + S
Sbjct: 125 PASILFGTQSYKKDWNATQPKQEDGYTWITLTPKAKDASVNSVSFGFKSEKLEKLIFVGS 184

Query: 171 SRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
               + + I   K +  L P+ F+    K  ++
Sbjct: 185 MGEKTNLTISDLKTDVQLSPETFKFTAPKGADV 217


>gi|157826350|ref|YP_001494070.1| hypothetical protein A1C_06695 [Rickettsia akari str. Hartford]
 gi|157800308|gb|ABV75562.1| hypothetical protein A1C_06695 [Rickettsia akari str. Hartford]
          Length = 212

 Score = 87.7 bits (216), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 33/196 (16%), Positives = 83/196 (42%), Gaps = 6/196 (3%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGE 65
           K +  V+I  F +++  F  A       ++ +   +  +I+++   F QED+ G +++G+
Sbjct: 2   KKIFLVIICVFINSVVAFGGA---DDKTTISELKTYLRTIKSIAIDFTQEDSYGKIVEGK 58

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQ 125
             + +P  F   Y  P  + +I   + +++Y+  ++  S       A + +  +N+H  +
Sbjct: 59  LLIHKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENALNFLLEDNKHFDK 118

Query: 126 ESI-QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           + + + V +  +   I            +TF++ + ++   KI  +      I   K  +
Sbjct: 119 DFVFESVINERNISKITIYHTLTEKRSEITFNKATKQIEALKIF-ADNNIVTITFDKIAK 177

Query: 185 NTVLDPKVFEIPYDKI 200
                  +F++    I
Sbjct: 178 VQKFSDDLFKLKNPAI 193


>gi|56479431|ref|YP_161020.1| outer membrane lipoprotein carrier protein LolA [Aromatoleum
           aromaticum EbN1]
 gi|56315474|emb|CAI10119.1| Outer membrane lipoprotein carrier protein LolA [Aromatoleum
           aromaticum EbN1]
          Length = 216

 Score = 87.7 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 59/174 (33%), Gaps = 19/174 (10%)

Query: 36  VKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISD 89
           V++  E   + ++ QG F Q              G F   RP KF + Y  P    L+SD
Sbjct: 35  VEQLREFVDTARSAQGEFEQTVSSASGRRAQQASGSFVFLRPGKFRWSYDKPYPQLLVSD 94

Query: 90  GSNIAVYNAKLDTWSVY----PLRYMAFSVI-----FSNNQHVIQESIQRVESNNSFITI 140
           G  +  ++  L+  +V      L     +++        +  + +        +     +
Sbjct: 95  GEKLWSWDRDLNQVTVKRLGDALGSTPAAILAGSGTLDRDFDLAEAG----SGDGLDWVL 150

Query: 141 FFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
                   +  S+        L   ++ D+  + ++I     + N   DP +F 
Sbjct: 151 ATPKHAESSFQSIRLGLAGELLKRMELQDNFGQTTMIVFTSLEPNARPDPSLFR 204


>gi|257093875|ref|YP_003167516.1| outer membrane lipoprotein carrier protein LolA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257046399|gb|ACV35587.1| outer membrane lipoprotein carrier protein LolA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 204

 Score = 87.3 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/205 (15%), Positives = 71/205 (34%), Gaps = 27/205 (13%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG---- 59
           ++ +++   + L     +             ++ K  +   S +TM+  F Q  A     
Sbjct: 1   MMRRTLFAAICLLITQTVSAG----------AIDKLHQFLESTRTMRAEFAQSVAARNGR 50

Query: 60  --YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAF 113
              +  G    ARP KF ++   P +  L+ DG  + +++  L   +V      L     
Sbjct: 51  KPQLSSGVMMFARPGKFRWEIEKPYAQLLVGDGERVWIHDPDLRQVTVRKVGSALGGTPA 110

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMD 169
             + +    + +    R   +   +          +     +S+ F      L   +++D
Sbjct: 111 -ALLAGESTIEKNFTLREAGDKDGLEWVEATPRSPDSGFEKVSLGFAGSD--LRAMELLD 167

Query: 170 SSRRYSIIKILKYKENTVLDPKVFE 194
           S  + + ++    + N  L P +F 
Sbjct: 168 SLGQTTSLRFAHLERNPRLAPSLFR 192


>gi|303257769|ref|ZP_07343781.1| outer membrane lipoprotein carrier protein LolA [Burkholderiales
           bacterium 1_1_47]
 gi|302859739|gb|EFL82818.1| outer membrane lipoprotein carrier protein LolA [Burkholderiales
           bacterium 1_1_47]
          Length = 211

 Score = 86.9 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/210 (19%), Positives = 79/210 (37%), Gaps = 17/210 (8%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-------DA 58
            K  +    L   + +FPF     +   Q +          +   G F Q+        A
Sbjct: 3   KKRFMKKTALLTITGLFPF-----VVFSQPLDLLNNFLNETKQASGAFEQQTFQKDGKPA 57

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFS 114
             + KG F  +RP KF + Y+SP    ++ DGS I +++  L+  +V      +     S
Sbjct: 58  EELQKGTFSFSRPGKFVWTYTSPYPQKMVCDGSRIYIWDEDLNQVTVRSAKGAIPKSPAS 117

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMI-SVTFDRLSYRLLNWKIMDSSRR 173
           ++F    +    +  + +  + +  I          + SV+F   S +L     + S   
Sbjct: 118 ILFGTQSYKKDWNATQPKQEDGYTWITLTPKAKDASVNSVSFGFKSEKLEKLIFVGSMGE 177

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            + + I   K +  L P+ F+    K  ++
Sbjct: 178 KTNLTISDLKTDVQLSPETFKFTAPKGADV 207


>gi|296116140|ref|ZP_06834758.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295977246|gb|EFG84006.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 207

 Score = 85.7 bits (211), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 19/182 (10%), Positives = 64/182 (35%), Gaps = 7/182 (3%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYS 79
                 +  +++   + +   +      +   F+Q    G    G+ +   P +    Y+
Sbjct: 24  CQAVPDSATLSQKDEITRVEHYLNDTHGLGAHFVQTWPDGGKGDGKLYYD-PGRLRLDYT 82

Query: 80  SPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVES---NNS 136
           +P+++ L +   ++   + + D+ +   L +    ++     H+    +        N+ 
Sbjct: 83  TPAAMKLTAANGHLVFIDPRRDSVTRMSLGHQPLGLLLQQPVHLDGAIVVTAVQHGTNSL 142

Query: 137 FITIFFKDDFMGNMISVTFD--RLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
            I++   D     ++++ F        L+  ++ D  R++  + +            +F 
Sbjct: 143 QISMARSDSPSQGLLTLGFSDIAGKLSLIAIEMTDVERQHIRLDLDGAHTGPAWPDDLFS 202

Query: 195 IP 196
           + 
Sbjct: 203 LN 204


>gi|254786026|ref|YP_003073455.1| outer membrane lipoprotein carrier protein LolA [Teredinibacter
           turnerae T7901]
 gi|237684194|gb|ACR11458.1| outer membrane lipoprotein carrier protein LolA [Teredinibacter
           turnerae T7901]
          Length = 211

 Score = 85.7 bits (211), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 31/191 (16%), Positives = 71/191 (37%), Gaps = 14/191 (7%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---DAG---YVMKGEFFMA 69
           FF +A+        ++    V        ++ T    F Q    D+G      +G+  ++
Sbjct: 7   FFTAAVLLSGLFCSVSWADDVDDLSAKLRALNTFSAHFEQRLLDDSGAELQKTEGQVKVS 66

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY---PLRYMAFSVIFSNNQHVIQE 126
            P +F+++   P   ++++DG  + VY+  ++  +VY    L      ++  +   + + 
Sbjct: 67  NPGRFFWQVEPPFEQTVVTDGEQLWVYDPDMEQVTVYSKQQLASTPAQLLSGDFAELAKT 126

Query: 127 SIQRVESNNSFITIFFKDDFMGNM----ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
                  N   +T               +   FD+   RL    + D   + +++   K 
Sbjct: 127 YAITASMNKGALTYRMAPKDEQTSNFAGLEFIFDKKD-RLEGMILEDKLGQRTVVTFSKR 185

Query: 183 KENTVLDPKVF 193
           + N  +D  +F
Sbjct: 186 QLNKPIDASIF 196


>gi|226944895|ref|YP_002799968.1| outer-membrane lipoprotein carrier protein [Azotobacter vinelandii
           DJ]
 gi|259491785|sp|C1DKZ1|LOLA_AZOVD RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|226719822|gb|ACO78993.1| outer membrane lipoprotein carrier protein, LolA [Azotobacter
           vinelandii DJ]
          Length = 207

 Score = 85.7 bits (211), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 36/212 (16%), Positives = 77/212 (36%), Gaps = 23/212 (10%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV-- 61
             +  V++L    +   F  +     ++S+++  +     QT+   F Q   + +G    
Sbjct: 1   MRLFRVLLL----SAVAFALSPAQADERSIQRLTQLLDRAQTLTARFSQLSLDGSGTQLQ 56

Query: 62  -MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVI 116
              GE  + RP  F +   +P    L+S+G  + +Y+  L+  +V  L         +++
Sbjct: 57  ETSGEMALKRPGLFRWHTDAPQEQLLVSNGKTVWLYDPDLEQVTVRSLDQRLTHTP-ALL 115

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS----- 171
            S +   I E+ +        +  F       + +   FD L     +  + D       
Sbjct: 116 LSGDLSKIGENFEITHKEAGGVVDFILKPKSKDTL---FDNLRLSFRDGVVNDMQLIDGV 172

Query: 172 RRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            + + I     K N  LD   F+    +  ++
Sbjct: 173 GQRTNILFFGVKMNQSLDAAQFDFKVPEGTDV 204


>gi|67459755|ref|YP_247379.1| hypothetical protein RF_1363 [Rickettsia felis URRWXCal2]
 gi|67005288|gb|AAY62214.1| unknown [Rickettsia felis URRWXCal2]
          Length = 207

 Score = 85.3 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 38/195 (19%), Positives = 87/195 (44%), Gaps = 9/195 (4%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGE 65
           K +  ++I  F +++  F A        ++ +   +  +I+++   F QED+ G ++KG+
Sbjct: 2   KKIFLIIICVFINSVVAFGA----DDKTTISELKTYLHTIKSVAIDFTQEDSYGKIVKGK 57

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQ 125
             + +P  F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N+  + 
Sbjct: 58  LLIHKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENTFNFLLEDNKDFVF 117

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           ES+   E N S ITI+       + I+  F++ + ++   KI +       I   K  + 
Sbjct: 118 ESVIN-ERNISKITIYHTLTEKRSEIT--FNKATKQIEALKIFED-NNIVTITFDKIAKV 173

Query: 186 TVLDPKVFEIPYDKI 200
                 +F++   +I
Sbjct: 174 QKFSDDLFKLKNPEI 188


>gi|307545646|ref|YP_003898125.1| outer-membrane lipoprotein carrier protein [Halomonas elongata DSM
           2581]
 gi|307217670|emb|CBV42940.1| outer-membrane lipoprotein carrier protein [Halomonas elongata DSM
           2581]
          Length = 210

 Score = 85.0 bits (209), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 28/191 (14%), Positives = 75/191 (39%), Gaps = 17/191 (8%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQE---DAGYVMK---GEFFMARPSKFYFKYSS 80
                 D++ ++       ++T    F QE    +G  ++   G  ++ARP +F ++  +
Sbjct: 18  PLTAMADEAAERLTHLLEPVKTYVADFDQEILDSSGQRLQEASGRMWLARPGRFRWEVDA 77

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQ----ESIQRVE 132
           P    ++S+G  + +Y+  L   ++  L          ++  +   + +       Q+  
Sbjct: 78  PYEQIVVSNGDEVTLYDPDLQQATIQALDERVTHTPALLLSGSTDELTESYEVTRSQQGT 137

Query: 133 SNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
           +    +T    D    + + +TF   +   L   + DS+ + + I     ++N  +    
Sbjct: 138 AETFTLTPHDADTLFES-LKMTFYGETLGRLQ--MTDSTGQRTAIGFDDAQQNVEVADSR 194

Query: 193 FEIPYDKIHNI 203
           F++   +  ++
Sbjct: 195 FQLDLPEGTDV 205


>gi|49079610|gb|AAT49911.1| PA2614 [synthetic construct]
          Length = 209

 Score = 85.0 bits (209), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 37/200 (18%), Positives = 71/200 (35%), Gaps = 19/200 (9%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGE 65
           ++   F +A+    +        +V++        QT+   F Q   + +G       G+
Sbjct: 3   LIRTLFVAALAMGASLAHADDSAAVQRLTGLLNKAQTLTARFSQLTLDGSGTRLQETAGQ 62

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQ 121
             + RP  F +   +P+   LIS+G  + +Y+  L+  ++  L         +++ S + 
Sbjct: 63  LSLKRPGLFRWHTDAPNEQLLISNGEKVWLYDPDLEQVTIQKLDQRLTQTP-ALLLSGDI 121

Query: 122 HVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSI 176
             I ES          +  F       + +   FD L     + K+ D        + + 
Sbjct: 122 SKISESFAITYKEGGNVVDFVLKPKTKDTL---FDTLRLSFRSGKVNDMQMIDGVGQRTN 178

Query: 177 IKILKYKENTVLDPKVFEIP 196
           I     K N  LD K F   
Sbjct: 179 ILFFDVKMNEALDAKQFTFD 198


>gi|15597810|ref|NP_251304.1| outer-membrane lipoprotein carrier protein [Pseudomonas aeruginosa
           PAO1]
 gi|107102136|ref|ZP_01366054.1| hypothetical protein PaerPA_01003186 [Pseudomonas aeruginosa PACS2]
 gi|116050601|ref|YP_790580.1| outer-membrane lipoprotein carrier protein [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218891225|ref|YP_002440091.1| outer-membrane lipoprotein carrier protein [Pseudomonas aeruginosa
           LESB58]
 gi|254235600|ref|ZP_04928923.1| periplasmic chaperone LolA [Pseudomonas aeruginosa C3719]
 gi|254241047|ref|ZP_04934369.1| periplasmic chaperone LolA [Pseudomonas aeruginosa 2192]
 gi|296388927|ref|ZP_06878402.1| outer-membrane lipoprotein carrier protein [Pseudomonas aeruginosa
           PAb1]
 gi|313107650|ref|ZP_07793833.1| periplasmic chaperone LolA [Pseudomonas aeruginosa 39016]
 gi|21759265|sp|Q9I0M4|LOLA_PSEAE RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|122259724|sp|Q02NA6|LOLA_PSEAB RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|226737655|sp|B7UW08|LOLA_PSEA8 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|9948680|gb|AAG06002.1|AE004690_2 periplasmic chaperone LolA [Pseudomonas aeruginosa PAO1]
 gi|115585822|gb|ABJ11837.1| periplasmic chaperone protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126167531|gb|EAZ53042.1| periplasmic chaperone LolA [Pseudomonas aeruginosa C3719]
 gi|126194425|gb|EAZ58488.1| periplasmic chaperone LolA [Pseudomonas aeruginosa 2192]
 gi|218771450|emb|CAW27217.1| periplasmic chaperone LolA [Pseudomonas aeruginosa LESB58]
 gi|310880335|gb|EFQ38929.1| periplasmic chaperone LolA [Pseudomonas aeruginosa 39016]
          Length = 208

 Score = 84.6 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 37/200 (18%), Positives = 71/200 (35%), Gaps = 19/200 (9%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGE 65
           ++   F +A+    +        +V++        QT+   F Q   + +G       G+
Sbjct: 3   LIRTLFVAALAMGASLAHADDSAAVQRLTGLLNKAQTLTARFSQLTLDGSGTRLQETAGQ 62

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQ 121
             + RP  F +   +P+   LIS+G  + +Y+  L+  ++  L         +++ S + 
Sbjct: 63  LSLKRPGLFRWHTDAPNEQLLISNGEKVWLYDPDLEQVTIQKLDQRLTQTP-ALLLSGDI 121

Query: 122 HVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSI 176
             I ES          +  F       + +   FD L     + K+ D        + + 
Sbjct: 122 SKISESFAITYKEGGNVVDFVLKPKTKDTL---FDTLRLSFRSGKVNDMQMIDGVGQRTN 178

Query: 177 IKILKYKENTVLDPKVFEIP 196
           I     K N  LD K F   
Sbjct: 179 ILFFDVKMNEALDAKQFTFD 198


>gi|152989440|ref|YP_001347958.1| outer-membrane lipoprotein carrier protein [Pseudomonas aeruginosa
           PA7]
 gi|166230494|sp|A6V4H3|LOLA_PSEA7 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|150964598|gb|ABR86623.1| outer membrane lipoprotein carrier protein LolA [Pseudomonas
           aeruginosa PA7]
          Length = 208

 Score = 84.6 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 37/200 (18%), Positives = 70/200 (35%), Gaps = 19/200 (9%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGE 65
           ++   F +A+    +        +V++        QT+   F Q   + +G       G+
Sbjct: 3   LIRTLFVAALAMGTSLAHADDSAAVQRLTGLLNKAQTLTARFSQLTLDGSGTRLQETAGQ 62

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQ 121
             + RP  F +   +P+   LIS+G  + +Y+  L+  ++  L          ++ S + 
Sbjct: 63  LSLKRPGLFRWHTDAPNEQLLISNGEKVWLYDPDLEQVTIQKLDQRLTQTPA-LLLSGDI 121

Query: 122 HVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSI 176
             I ES          +  F       + +   FD L     + K+ D        + + 
Sbjct: 122 SKISESFAITYKEGGNVVDFVLKPKTKDTL---FDTLRLSFRSGKVNDMQMIDGVGQRTN 178

Query: 177 IKILKYKENTVLDPKVFEIP 196
           I     K N  LD K F   
Sbjct: 179 ILFFDVKMNEALDAKQFTFD 198


>gi|239948371|ref|ZP_04700124.1| outer membrane lipoprotein-sorting protein LolA [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239922647|gb|EER22671.1| outer membrane lipoprotein-sorting protein LolA [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 212

 Score = 84.6 bits (208), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 33/196 (16%), Positives = 84/196 (42%), Gaps = 6/196 (3%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGE 65
           K +  ++I++ +      N A+      ++ +   +  +I+++   F QED+ G ++KG+
Sbjct: 2   KKIFFLIIIYLF---VNSNLAFGAGDKTAISELKTYLRTIKSVVIDFTQEDSYGKIVKGK 58

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQ 125
             + +P  F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N+H  +
Sbjct: 59  LLIHKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSKNTFNFLLEDNEHFDK 118

Query: 126 ESIQRVESNNSFIT-IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           + +     N   I+ I            +TF++ + ++   KI +     + I   K  +
Sbjct: 119 DFVFESVVNEGNISKITIYHTLTEKRSEITFNKATKQIEALKIFEDKNIIT-ITFDKIAK 177

Query: 185 NTVLDPKVFEIPYDKI 200
                  +F++   +I
Sbjct: 178 VQKFSDDLFKLKNPEI 193


>gi|15893258|ref|NP_360972.1| hypothetical protein RC1335 [Rickettsia conorii str. Malish 7]
 gi|15620478|gb|AAL03873.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 212

 Score = 84.2 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/196 (16%), Positives = 83/196 (42%), Gaps = 6/196 (3%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGE 65
           K +  ++I++ +      + A+      ++ +   +   I+++   F QED+ G ++KG+
Sbjct: 2   KKIFFLIIIYLF---VNSSLAFGADDKTAISELKTYLRKIKSVAIDFTQEDSYGKIVKGK 58

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQ 125
             + +P  F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N+H+ +
Sbjct: 59  LLIHKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENTFNFLLEDNEHLDK 118

Query: 126 ESIQRVESNNSFIT-IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           + +     N   I+ I            +TF++ + ++   KI +       I   K  +
Sbjct: 119 DFVFEAVINARNISKITIYHTLTEKRSEITFNKATQQIEALKIFED-NNIVTITFDKIAK 177

Query: 185 NTVLDPKVFEIPYDKI 200
                  +F+I   +I
Sbjct: 178 VQKFSDDLFKIKNPEI 193


>gi|261856113|ref|YP_003263396.1| outer membrane lipoprotein carrier protein LolA [Halothiobacillus
           neapolitanus c2]
 gi|261836582|gb|ACX96349.1| outer membrane lipoprotein carrier protein LolA [Halothiobacillus
           neapolitanus c2]
          Length = 273

 Score = 84.2 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/203 (17%), Positives = 73/203 (35%), Gaps = 18/203 (8%)

Query: 8   SVIGVVILFFYSAIFPFNAA-YPITKDQSVKKA---IEHFLSIQTMQGTFLQ---EDAGY 60
           ++  +  + + S I P  A  +P+    +        E   +++T    F+Q      G 
Sbjct: 60  AISALGSVSYASDIQPAEAQTFPLGASSAAADIRPLTEFVRTLKTFSADFVQQQVNVRGQ 119

Query: 61  V---MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL---RYMAFS 114
                 G F +ARP +F++ Y  P    LI++   + VY+  L   +  PL   R     
Sbjct: 120 KQPASSGHFVLARPGRFFWAYEKPYVQKLIANEGVLWVYDPDLAQVTRSPLADNRGAPIG 179

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG---NMISVTFDRLSYRLLNWKIMDSS 171
           +   N        +  +  N+       KD       N + +  D    + +     D  
Sbjct: 180 IFLGNQPLQEAFDVSSIGKNDGLNWYSLKDRSAKSDFNQVQIGMDAKGIKAM--VFTDKL 237

Query: 172 RRYSIIKILKYKENTVLDPKVFE 194
              + ++  + + N  +D  +F+
Sbjct: 238 DNRTTVQFSQREVNQKVDDSLFQ 260


>gi|253996803|ref|YP_003048867.1| outer membrane lipoprotein carrier protein LolA [Methylotenera
           mobilis JLW8]
 gi|253983482|gb|ACT48340.1| outer membrane lipoprotein carrier protein LolA [Methylotenera
           mobilis JLW8]
          Length = 216

 Score = 83.4 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/188 (18%), Positives = 67/188 (35%), Gaps = 15/188 (7%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV------MKGEFFMARPS 72
             + P     P      +      +   Q ++ +F Q            ++G   + RP+
Sbjct: 18  LLVLPALFLMPAAHADGMDSVKAFYEKTQAVRASFHQVVTDKQGRKVQEVQGTMQLKRPN 77

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQESI 128
           KF + Y  P    +ISDG  + +Y+ +L   +V      L     +++          ++
Sbjct: 78  KFRWDYHKPYEQQIISDGKQVWLYDTELAQVTVRDIGKALGSSPAALLAGGKAIEETFTL 137

Query: 129 QRVESNNSF--ITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
               + +    ++   KD   G   I + F     ++    ++DS    + I   K + N
Sbjct: 138 ANASNRDGLNWVSAQPKDKESGFEKILLGF--KDNQIQEMALLDSFGHNTKIVFSKVEVN 195

Query: 186 TVLDPKVF 193
             LD K F
Sbjct: 196 PALDEKSF 203


>gi|198282687|ref|YP_002219008.1| outer membrane lipoprotein carrier protein LolA [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218668025|ref|YP_002424879.1| outer membrane lipoprotein carrier protein LolA, putative
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198247208|gb|ACH82801.1| outer membrane lipoprotein carrier protein LolA [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218520238|gb|ACK80824.1| outer membrane lipoprotein carrier protein LolA, putative
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 230

 Score = 83.4 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/198 (15%), Positives = 72/198 (36%), Gaps = 15/198 (7%)

Query: 11  GVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKG 64
             +  +F   +              +    + F    T+   F QE A           G
Sbjct: 22  SGLARWFLVPLLILGGIQLAAAATGLAMLQDFFQKTHTITAQFRQEVANHDGRIVKRTSG 81

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNN 120
           + +++RP KF + Y   +  +++S+G  + +Y   L+  +V PL         ++I  N+
Sbjct: 82  KLWISRPGKFRWDYDGRNGQTIVSNGEKVWLYEPALEQATVQPLGKAIGSTPAALIAGND 141

Query: 121 QHVIQESIQRVESNNSFITIFFK----DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
               +  I  +   +    +        D     + + FD     L   ++ D+ ++ ++
Sbjct: 142 DLGRRFRITDLGEKDGLRWLLLHPKTGQDQGFTALRLGFDAQG-ALREMRMEDAFQQQTV 200

Query: 177 IKILKYKENTVLDPKVFE 194
           ++    + N  +  + F+
Sbjct: 201 LRFEHIRINHPISAQEFQ 218


>gi|93006577|ref|YP_581014.1| outer membrane lipoprotein carrier protein LolA [Psychrobacter
           cryohalolentis K5]
 gi|92394255|gb|ABE75530.1| outer membrane lipoprotein carrier protein LolA [Psychrobacter
           cryohalolentis K5]
          Length = 233

 Score = 83.4 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/212 (16%), Positives = 76/212 (35%), Gaps = 19/212 (8%)

Query: 8   SVIGVVILFFYSAIFPFNA------AYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV 61
             +  V++       P  A      A P     + K+  +   + ++M   F Q   G  
Sbjct: 22  GALAGVLMTTLGVAAPMMAITQSAMAAPADNITAAKRLNKLLTNTKSMTANFSQTTKGAN 81

Query: 62  MK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFS 114
                G   + RP+ F ++  SPS   ++++GS++ VY+  L+  +       +      
Sbjct: 82  SGTFSGTMSVQRPNNFRWETKSPSEQLIVANGSSMWVYDKDLEQATKQNVDSQVGNTPAL 141

Query: 115 VIFSN--NQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFD-RLSYRLLNWKIMDSS 171
           ++  +        +  Q   + N ++     D      +S++F       +    + DS 
Sbjct: 142 LLSGDPSKIDKNFKITQPYANKNYYVLYPKSDSASFKSLSMSFSGGKPVMM---VLNDSL 198

Query: 172 RRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            + + IK    K N  +    F+    K  +I
Sbjct: 199 GQTTSIKFSGIKMNPSISSNQFKFTPPKGVDI 230


>gi|117924967|ref|YP_865584.1| outer membrane lipoprotein carrier protein LolA [Magnetococcus sp.
           MC-1]
 gi|117608723|gb|ABK44178.1| outer membrane lipoprotein carrier protein LolA [Magnetococcus sp.
           MC-1]
          Length = 223

 Score = 83.4 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/195 (17%), Positives = 66/195 (33%), Gaps = 16/195 (8%)

Query: 22  FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------GEFFMARPSKFY 75
            P   A P     +V +       I TM+ TF+Q              G F   RP KF 
Sbjct: 29  VPKAEATPHA---AVVRLQAFVDGITTMEATFIQRVRSNDSTEIEESRGRFLALRPGKFR 85

Query: 76  FKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP---LRYMAFSVIFSN-NQHVIQESIQRV 131
           + Y SP    ++ DG  + ++  +L   +      L     + + S         +    
Sbjct: 86  WDYESPEVQHIVCDGKTVWLHEPELQQVTRISADRLDRAPAAFLVSKSRIAESFFTKVVH 145

Query: 132 ESNNSFITIFFKDDFMG---NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
                  T+F            +++T D+    +  +++ D+    S  + +  + N  +
Sbjct: 146 NEKLDLDTVFLSPKAEAAHFKEVAITLDKSGQEIQFFQVTDTLGNRSYFQFVGMRMNQRV 205

Query: 189 DPKVFEIPYDKIHNI 203
           D   FE    K  ++
Sbjct: 206 DESRFEFQIPKGADL 220


>gi|171057446|ref|YP_001789795.1| outer membrane lipoprotein carrier protein LolA [Leptothrix
           cholodnii SP-6]
 gi|229485833|sp|B1Y153|LOLA_LEPCP RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|170774891|gb|ACB33030.1| outer membrane lipoprotein carrier protein LolA [Leptothrix
           cholodnii SP-6]
          Length = 212

 Score = 83.0 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 31/202 (15%), Positives = 72/202 (35%), Gaps = 19/202 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---DAG--- 59
            +  +G     F + +      +   +   V    +   ++Q+ + TF Q      G   
Sbjct: 5   RRRALGF---SFQALLLCAAGWHGAAQADGVSALRDFVQNVQSGRATFNQTVTSPDGAKK 61

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
               G F   RP++F F Y+ P    +++DG  + +++  L+  +V P    L     ++
Sbjct: 62  KTSTGSFEFLRPNRFRFDYTKPYEQQIVADGVKVWLHDVDLNQVTVRPFDQALGSTPAAL 121

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMI---SVTFDRLSYRLLNWKIMDSSR 172
           +   +      ++  +        +          I    V F      L  ++I D+  
Sbjct: 122 LAGASIE-RDFTLANLPEEAGLQWVQALPKAREGSIRSLRVAFRGKD--LAAFEITDAFG 178

Query: 173 RYSIIKILKYKENTVLDPKVFE 194
           + S +   +++ N  +    F+
Sbjct: 179 QRSRLDFNRFEGNAAVPAARFK 200


>gi|58426761|gb|AAW75798.1| outer-membrane lipoproteins carrier protein precursor [Xanthomonas
           oryzae pv. oryzae KACC10331]
          Length = 256

 Score = 83.0 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 70/190 (36%), Gaps = 18/190 (9%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHF-LSIQTMQGTFLQE---DAGYV---MKGEFFMARPSK 73
                A +  T   + ++ ++ F   ++ + G F Q      G V     G   +A P +
Sbjct: 55  AVLATALFASTAFAAARQELDTFTRGLKGLDGQFSQRVTDANGKVKENSSGRVALATPRQ 114

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY---------PLRYMAFSVIFSNNQHVI 124
           F ++Y+ P    +++DG  + V++  L+  +V          PL  +    +      V 
Sbjct: 115 FRWEYAKPYRQLIVADGKKVWVFDPDLEQVTVRAQGSEEQNSPLVALINPALLDKKYDVS 174

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           +E+  R       +T     D    M S+ F +     +   ++D+  + + I    +K 
Sbjct: 175 EEAAPRDGLQWLSLTPKVDTDASFQMASLGFGKDGLAKME--VVDAVGQRTTISFSGWKR 232

Query: 185 NTVLDPKVFE 194
           N       F 
Sbjct: 233 NPAFAADTFR 242


>gi|154706276|ref|YP_001424635.1| outer-membrane lipoproteins carrier protein [Coxiella burnetii
           Dugway 5J108-111]
 gi|212212419|ref|YP_002303355.1| outer-membrane lipoproteins carrier protein [Coxiella burnetii
           CbuG_Q212]
 gi|189028548|sp|A9KFP6|LOLA_COXBN RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229485825|sp|B6IZT2|LOLA_COXB2 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|154355562|gb|ABS77024.1| outer-membrane lipoproteins carrier protein [Coxiella burnetii
           Dugway 5J108-111]
 gi|212010829|gb|ACJ18210.1| outer-membrane lipoproteins carrier protein [Coxiella burnetii
           CbuG_Q212]
          Length = 211

 Score = 83.0 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/200 (18%), Positives = 76/200 (38%), Gaps = 21/200 (10%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGY-----VM 62
           +IG++ +F +S      +     +  +  +  +   + +T Q  F Q    G        
Sbjct: 7   LIGLLGIFLFSL-----SGIVSAQSDATTQLSQLLSNFRTYQAKFNQITFDGQDRVIQQS 61

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFS 118
            G   + RP +F ++  SP+   +I++G  + VY+  L   +  PL         S++  
Sbjct: 62  HGRVMIMRPGRFRWETDSPTKQIIITNGKTLWVYDVDLSQATQQPLAQKTNINPASLLSG 121

Query: 119 NNQHVIQESIQRVESNNSFITIF----FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           + + + Q+    +       T             N I + F +   +L    ++++    
Sbjct: 122 SVKDLKQKFTITISPTPDAATFQLVPHLGKSLNFNWIRLKFSKK--QLTEMTVLNNLDER 179

Query: 175 SIIKILKYKENTVLDPKVFE 194
           SI +  + K N  L   +FE
Sbjct: 180 SIFQFSQIKVNAPLSSTLFE 199


>gi|146307410|ref|YP_001187875.1| outer-membrane lipoprotein carrier protein [Pseudomonas mendocina
           ymp]
 gi|166230495|sp|A4XUX7|LOLA_PSEMY RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|145575611|gb|ABP85143.1| outer membrane lipoprotein carrier protein LolA [Pseudomonas
           mendocina ymp]
          Length = 208

 Score = 83.0 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 80/211 (37%), Gaps = 20/211 (9%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV-- 61
             VI +++L   S       A    ++ + K+  E     QT+   F Q   + +G    
Sbjct: 1   MRVIRLLMLAALSFTLLTAQA---DEEAATKRLTELLSQAQTISARFSQLTLDASGTQLQ 57

Query: 62  -MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVI 116
              G+  + RP  F +    P    L+S+G  + +Y+  L+  ++  L          ++
Sbjct: 58  ETAGQLVLKRPGLFRWHTDEPMEQLLVSNGQKVWLYDPDLEQVTIQSLDQRLTHTPA-LL 116

Query: 117 FSNNQHVIQESIQ-RVESNNSFITIFFKDDFMGN---MISVTFDRLSYRLLNWKIMDSSR 172
            S +   I+E+ +   +   S +    K     +    + ++F       +   ++DS  
Sbjct: 117 LSGDVSQIRENFEIDYKEGGSVVDFILKPKAKDSLFDSLRLSFRNRMLNDMQ--LIDSIG 174

Query: 173 RYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           + + I  L  K N  ++  +F     +  ++
Sbjct: 175 QRTNILFLNVKMNEPVEDHLFTFDIPEGADV 205


>gi|241765336|ref|ZP_04763312.1| outer membrane lipoprotein carrier protein LolA [Acidovorax
           delafieldii 2AN]
 gi|241364935|gb|EER59873.1| outer membrane lipoprotein carrier protein LolA [Acidovorax
           delafieldii 2AN]
          Length = 210

 Score = 83.0 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/208 (15%), Positives = 69/208 (33%), Gaps = 25/208 (12%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE----------DAGYVMKGEF 66
             +AI    +A   + D  +K        + T +  F Q                  G F
Sbjct: 4   LIAAILIATSAQLASADG-LKSLESFMKGVHTGRAEFTQVVTSPPKDGQAARTKTSSGTF 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQH 122
              RP +F F Y  P   ++++DG  + +Y+A L+  +       L       + ++   
Sbjct: 63  EFQRPGRFKFVYKKPFEQTIVADGQTLWLYDADLNQVTQRSQAKALGSTPA-ALLASTPD 121

Query: 123 VI----QESIQRVESNNSFITIFFKDDFMGNMISVT---FDRLSYRLLNWKIMDSSRRYS 175
           +       +++     +    +  +       +      F     +L    I+DS  + S
Sbjct: 122 LSALRADFTLEAAPDQDGLQWVLARPKAKEGQLQSVRVGFAGE--QLAALDILDSFGQRS 179

Query: 176 IIKILKYKENTVLDPKVFEIPYDKIHNI 203
            I+    + N  L P  F+    +  ++
Sbjct: 180 AIRFTGMQTNATLPPATFQFQPPQGADV 207


>gi|289549309|ref|YP_003474297.1| outer membrane lipoprotein carrier protein LolA [Thermocrinis albus
           DSM 14484]
 gi|289182926|gb|ADC90170.1| outer membrane lipoprotein carrier protein LolA [Thermocrinis albus
           DSM 14484]
          Length = 201

 Score = 82.7 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 30/174 (17%), Positives = 65/174 (37%), Gaps = 22/174 (12%)

Query: 43  FLSIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY 96
              I+T++ +F+Q+          V KG F+  +  KF  +Y  P  + ++SDG  I +Y
Sbjct: 26  LEEIRTLRASFIQKVQYSWYPKPEVSKGFFYAQKGGKFRIEYEQPQRMLIVSDGKRILIY 85

Query: 97  NAKLDTW--SVYPLRYMAFS---VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMI 151
           + + +T           A      + S     + + +  +  NN  + +           
Sbjct: 86  DPEENTAILDRVERNRSAVVEALFLLSRPLRDVFDKVGEISRNNGHVIVLKPKVQDP--- 142

Query: 152 SVTFDRLSYRLLNWK------IMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
              F R+   +  W+      + +    ++ ++++  K N      +F I   K
Sbjct: 143 --YFSRVYVEVDGWRNIKSIKVEEKDGSFTTVELVDVKYNFTPSEDLFRITVPK 194


>gi|120554469|ref|YP_958820.1| outer-membrane lipoprotein carrier protein [Marinobacter aquaeolei
           VT8]
 gi|120324318|gb|ABM18633.1| outer membrane lipoprotein carrier protein LolA [Marinobacter
           aquaeolei VT8]
          Length = 216

 Score = 82.7 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 39/211 (18%), Positives = 83/211 (39%), Gaps = 17/211 (8%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQ-SVKKAIEHFLSIQTMQGTFLQ---EDAGYV-- 61
            +   ++L   +     + A  +   + + ++        +T Q  F+Q    + G    
Sbjct: 3   RMFSGILLMLAATWSGLSQAESVQASRGAAEQLTSILKGYETYQADFIQIVVNENGSQVQ 62

Query: 62  -MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVI 116
             +G     RP  FY++  +P S  ++SDG  + VY+  L+  +V+ L          ++
Sbjct: 63  ETRGSLKAKRPGLFYWETGAPLSQFIVSDGDKVEVYDPDLEQVTVHSLDERVQTTPALLL 122

Query: 117 FSNNQHVIQESIQRV----ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSR 172
               +++ +     V    ES   F  +    D +   + ++F      L   ++ DS  
Sbjct: 123 SGEVENLDESYEVSVRDLGESTREFTLVPRSQDSLFTSLRLSFY--DGELQEMRMRDSLS 180

Query: 173 RYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           + SI+     + N  LD  VF + Y +  ++
Sbjct: 181 QMSILSFDHIELNQALDSSVFRLDYPEGVDV 211


>gi|29654493|ref|NP_820185.1| outer-membrane lipoproteins carrier protein [Coxiella burnetii RSA
           493]
 gi|161830784|ref|YP_001597053.1| outer membrane lipoprotein carrier protein LolA [Coxiella burnetii
           RSA 331]
 gi|732273|sp|P39917|LOLA_COXBU RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|189028549|sp|A9NDR3|LOLA_COXBR RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|468530|emb|CAA53290.1| unnamed protein product [Coxiella burnetii]
 gi|29541760|gb|AAO90699.1| outer-membrane lipoproteins carrier protein [Coxiella burnetii RSA
           493]
 gi|161762651|gb|ABX78293.1| outer membrane lipoprotein carrier protein LolA [Coxiella burnetii
           RSA 331]
          Length = 211

 Score = 82.7 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/200 (18%), Positives = 76/200 (38%), Gaps = 21/200 (10%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGY-----VM 62
           +IG++ +F +S      +     +  +  +  +   + +T Q  F Q    G        
Sbjct: 7   LIGLLGIFLFSL-----SGIVSAQSDATTQLSQLLSNFRTYQAKFNQITFDGQDRVIQQS 61

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFS 118
            G   + RP +F ++  SP+   +I++G  + VY+  L   +  PL         S++  
Sbjct: 62  HGRVMIMRPGRFRWETDSPTKQIIITNGKTLWVYDVDLSQATQQPLAQKTNINPASLLSG 121

Query: 119 NNQHVIQESIQRVESNNSFITIF----FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           + + + Q+    +       T             N I + F +   +L    ++++    
Sbjct: 122 SVKDLKQKFTITISPTPDAATFQLVPNLGKSLNFNWIRLKFSKK--QLTEMTVLNNLDER 179

Query: 175 SIIKILKYKENTVLDPKVFE 194
           SI +  + K N  L   +FE
Sbjct: 180 SIFQFSQIKVNAPLSSTLFE 199


>gi|71066126|ref|YP_264853.1| outer membrane lipoprotein carrier [Psychrobacter arcticus 273-4]
 gi|71039111|gb|AAZ19419.1| probable outer membrane lipoprotein carrier [Psychrobacter arcticus
           273-4]
          Length = 233

 Score = 82.7 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/215 (17%), Positives = 83/215 (38%), Gaps = 18/215 (8%)

Query: 4   LLYKSVIGVVILFFY-----SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA 58
           L+  ++ GV++          A+     A P  K  + K+  +   + ++M   F Q   
Sbjct: 19  LMGGALAGVLMTTLGVAAPMMALTQSATAAPADKLTASKRLNKLLTNTKSMTANFSQTTK 78

Query: 59  GYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV----YPLRYM 111
           G       G   + RP+ F ++  SPS   ++++GS++ VY+  L+  +       +   
Sbjct: 79  GANSGTFSGAMSVQRPNNFRWETKSPSEQLIVANGSSMWVYDKDLEQATKQKVDSQVGNT 138

Query: 112 AFSVIFSN--NQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFD-RLSYRLLNWKIM 168
              ++  +        +  Q   + N ++     D      +S++F       +    + 
Sbjct: 139 PALLLSGDPSKIDKNFKITQPYANKNYYVLYPKSDSASFKSLSMSFSGGKPVMM---VLN 195

Query: 169 DSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           DS  + + I+  + K N+ +    F+    K  +I
Sbjct: 196 DSLGQTTSIRFSRIKMNSSISSSQFKFTPPKGVDI 230


>gi|291615034|ref|YP_003525191.1| outer membrane lipoprotein carrier protein LolA [Sideroxydans
           lithotrophicus ES-1]
 gi|291585146|gb|ADE12804.1| outer membrane lipoprotein carrier protein LolA [Sideroxydans
           lithotrophicus ES-1]
          Length = 204

 Score = 82.7 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/177 (19%), Positives = 68/177 (38%), Gaps = 14/177 (7%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQE---DAGYVMK---GEFFMARPSKFYFKYSSPSS 83
            +   +  K         + Q  F QE    +G  M+   G     RP KF + Y  P  
Sbjct: 16  ASHAAATGKLKSFIAGTHSAQANFTQEVLEKSGKRMQFASGTMQFVRPGKFRWVYQKPYE 75

Query: 84  VSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQESIQRVESNNSFIT 139
             ++ DG    +Y+  L+  +V      L     +++  NN+     +++ +E  + F  
Sbjct: 76  QLIVGDGKKFWMYDIDLNQVTVKKLDAALGSSPAALLSGNNEIERDFTLKDLEDRDGFEW 135

Query: 140 IFFKDDFMGNM---ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
           +             I + F+  S  L   ++ D+   +++++  + K N  L  K+F
Sbjct: 136 LQATPKSKETTFEKILMAFNGKS-ELAVMELYDAFGHHTVLRFTELKNNPSLSAKLF 191


>gi|220935171|ref|YP_002514070.1| outer membrane lipoprotein carrier protein LolA [Thioalkalivibrio
           sp. HL-EbGR7]
 gi|219996481|gb|ACL73083.1| outer membrane lipoprotein carrier protein LolA [Thioalkalivibrio
           sp. HL-EbGR7]
          Length = 205

 Score = 82.3 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/181 (15%), Positives = 65/181 (35%), Gaps = 18/181 (9%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV------MKGEFFMARPSKFYFKYSS 80
           A+     QS+++    F  +      F Q             +G   + RP +F + Y  
Sbjct: 18  AFAADARQSLER---FFSEVSRFDARFEQLVINEQDEVLQASEGRVQLQRPGRFRWDYEQ 74

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS---VIFSNNQHVIQE---SIQRVESN 134
           P    +I+DG  +  Y+ +L   +  P+  +      ++ S  + + Q+   S+      
Sbjct: 75  PFRQLIIADGQFLWTYDEELAQATAQPMERVLAGAPIMLLSEPRPLEQDFEVSVVGERGE 134

Query: 135 NSFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
            +++ +  +D       I +  D     ++   + D   + + I+    + N  +    F
Sbjct: 135 LNWVELTPRDRDADFTRILIGMDGDRVGMM--VLYDQFGQQTRIRFSNMRINPSIPAATF 192

Query: 194 E 194
            
Sbjct: 193 R 193


>gi|94499676|ref|ZP_01306213.1| outer-membrane lipoprotein carrier protein precursor [Oceanobacter
           sp. RED65]
 gi|94428430|gb|EAT13403.1| outer-membrane lipoprotein carrier protein precursor [Oceanobacter
           sp. RED65]
          Length = 211

 Score = 82.3 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/186 (16%), Positives = 75/186 (40%), Gaps = 14/186 (7%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV------MKGEFFMARPSKFYFKYSSPSSV 84
             +QS+ K       ++TM+  F Q              G F +++P++FY+K   P + 
Sbjct: 22  ADEQSLSKLQNVLAPLKTMKAEFKQISEDGRGVVLQTQAGSFVLSKPNRFYWKSEEPFAQ 81

Query: 85  SLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESIQRVESNNSFITI 140
            L+S+G  + VY+  L+  ++      L      ++    + + Q+     ++ +   T 
Sbjct: 82  LLVSNGETLWVYDEDLEQVTIQKLDPSLTSTPVLLLSGTIEDIQQQYKVYSDTTDGKTTF 141

Query: 141 FFKDDFMG---NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
                  G   + +++  D+ S  +    I D   + + ++    ++N  +  + F+   
Sbjct: 142 SLLPKETGSLFSRLTLYVDQGSM-ITGLTIKDEVGQVTRVEFKNIQKNVEVASEKFQFNP 200

Query: 198 DKIHNI 203
            +  +I
Sbjct: 201 PEGVDI 206


>gi|157829165|ref|YP_001495407.1| hypothetical protein A1G_07300 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933894|ref|YP_001650683.1| hypothetical protein RrIowa_1560 [Rickettsia rickettsii str. Iowa]
 gi|157801646|gb|ABV76899.1| hypothetical protein A1G_07300 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908981|gb|ABY73277.1| hypothetical protein RrIowa_1560 [Rickettsia rickettsii str. Iowa]
          Length = 212

 Score = 82.3 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 33/196 (16%), Positives = 82/196 (41%), Gaps = 6/196 (3%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGE 65
           K +  ++I++ +      + A+      ++ +   +   I+++   F QED+ G ++KG+
Sbjct: 2   KKIFFLIIIYLF---VNSSLAFGADDKTAISELKTYLRKIKSVAIDFTQEDSYGKIVKGK 58

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQ 125
             + +P  F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N+H  +
Sbjct: 59  LLIHKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENTFNFLLEDNEHFDK 118

Query: 126 ESIQRVESNNSFIT-IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           + +     N   I+ I            +TF++ + ++   KI +       I   K  +
Sbjct: 119 DFVFEAVINARNISKITIYHTLTEKRSEITFNKATQQIEALKIFED-NNIVTITFDKIAK 177

Query: 185 NTVLDPKVFEIPYDKI 200
                  +F+I   +I
Sbjct: 178 VQKFSDDLFKIKNPEI 193


>gi|238651108|ref|YP_002916966.1| hypothetical protein RPR_07545 [Rickettsia peacockii str. Rustic]
 gi|238625206|gb|ACR47912.1| hypothetical protein RPR_07545 [Rickettsia peacockii str. Rustic]
          Length = 212

 Score = 82.3 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 33/196 (16%), Positives = 82/196 (41%), Gaps = 6/196 (3%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGE 65
           K +  ++I++ +      + A+      ++ +   +   I+++   F QED+ G ++KG+
Sbjct: 2   KKIFFLIIIYLF---VNSSLAFGADDKTAILELKTYLRKIKSVAIDFTQEDSYGKIVKGK 58

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQ 125
             + +P  F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N+H  +
Sbjct: 59  LLIHKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENTFNFLLEDNEHFDK 118

Query: 126 ESIQRVESNNSFIT-IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           + +     N   I+ I            +TF++ + ++   KI +       I   K  +
Sbjct: 119 DFVFEAVINARNISKITIYHTLTEKRSEITFNKATQQIEALKIFED-NNIVTITFDKIAK 177

Query: 185 NTVLDPKVFEIPYDKI 200
                  +F+I   +I
Sbjct: 178 VQKFSDDLFKIKNPEI 193


>gi|224826931|ref|ZP_03700030.1| outer membrane lipoprotein carrier protein LolA [Lutiella
           nitroferrum 2002]
 gi|224600918|gb|EEG07102.1| outer membrane lipoprotein carrier protein LolA [Lutiella
           nitroferrum 2002]
          Length = 201

 Score = 82.3 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/167 (16%), Positives = 63/167 (37%), Gaps = 13/167 (7%)

Query: 38  KAIEHFLSIQTMQGTFLQ--EDAGYVMK--GEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           +        +T+  +F Q     G   +  G+  ++RP KF ++Y+ P    ++ D   +
Sbjct: 24  QLKAFVAGSKTLSASFSQVVSAKGKREEASGQLEISRPGKFRWEYAKPYEQLIVGDSKRL 83

Query: 94  AVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGN 149
            +Y+ +L   +       L     +++  +N       ++   + +    +        N
Sbjct: 84  WIYDKELAQVTSKSLDAALGSSPAALLAGSNAIERDYHLKEAGAQDGIEWLSAAPKKSEN 143

Query: 150 M---ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
               I + F   +   +   + DS    ++I+    K+N VL P  F
Sbjct: 144 TFQSIRMGFRANTLVTME--LHDSFGNTTLIRFADMKKNPVLAPSRF 188


>gi|331004979|ref|ZP_08328389.1| Outer membrane lipoprotein carrier protein LolA [gamma
           proteobacterium IMCC1989]
 gi|330421221|gb|EGG95477.1| Outer membrane lipoprotein carrier protein LolA [gamma
           proteobacterium IMCC1989]
          Length = 206

 Score = 82.3 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 39/191 (20%), Positives = 79/191 (41%), Gaps = 15/191 (7%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---DAGYV---MKGEFFMARP 71
               F  +    +     V    E  + + T  G F Q    D G V     G FF+ RP
Sbjct: 9   CGFCFCLSVFTTMANAADVDVLAEKLVQLSTFSGDFRQTLIDDQGEVLQESTGVFFLERP 68

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQES 127
             F+++  +P    L+SD ++I +Y+  L+  +V P    +      ++ S +   +  S
Sbjct: 69  GYFHWETIAPFPQLLVSDLASIWLYDPDLEQVTVRPYDESVSQTPA-LLLSGDVSKMSAS 127

Query: 128 IQRVESNNSFITIFFK-DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
            + V++ ++  ++  K    +   + V F     +L++  + DS  + +    L    N 
Sbjct: 128 YEVVQTTDNQFSLTPKSQQELFTQLMVEFAEG--QLVSMSLQDSLGQTTTFTFLNGIYNQ 185

Query: 187 VLDPKVFE-IP 196
            +  ++F+ IP
Sbjct: 186 PIPSELFQFIP 196


>gi|282403535|pdb|2W7Q|A Chain A, Structure Of Pseudomonas Aeruginosa Lola
 gi|282403536|pdb|2W7Q|B Chain B, Structure Of Pseudomonas Aeruginosa Lola
          Length = 204

 Score = 82.3 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 36/187 (19%), Positives = 65/187 (34%), Gaps = 19/187 (10%)

Query: 25  NAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEFFMARPSKFYFKY 78
             +  I    +V++        QT+   F Q   + +G       G+  + RP  F +  
Sbjct: 12  RGSIAIDDSAAVQRLTGLLNKAQTLTARFSQLTLDGSGTRLQETAGQLSLKRPGLFRWHT 71

Query: 79  SSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQESIQRVESN 134
            +P+   LIS+G  + +Y+  L+  ++  L          ++ S +   I ES       
Sbjct: 72  DAPNEQLLISNGEKVWLYDPDLEQVTIQKLDQRLTQTPA-LLLSGDISKISESFAITYKE 130

Query: 135 NSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSIIKILKYKENTVLD 189
              +  F       + +   FD L     + K+ D        + + I     K N  LD
Sbjct: 131 GGNVVDFVLKPKTKDTL---FDTLRLSFRSGKVNDMQMIDGVGQRTNILFFDVKMNEALD 187

Query: 190 PKVFEIP 196
            K F   
Sbjct: 188 AKQFTFD 194


>gi|254449278|ref|ZP_05062725.1| outer membrane lipoprotein carrier protein LolA [gamma
           proteobacterium HTCC5015]
 gi|198261133|gb|EDY85431.1| outer membrane lipoprotein carrier protein LolA [gamma
           proteobacterium HTCC5015]
          Length = 211

 Score = 82.3 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 66/167 (39%), Gaps = 15/167 (8%)

Query: 41  EHFLS-IQTMQGTFLQE---DAG---YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           EHFLS  + ++  F Q     +G       G   + RP++F + Y  P    L++DG N+
Sbjct: 27  EHFLSHTKNLKADFSQTLEDSSGRQLQQQTGTVVLQRPNRFVWHYQQPYEQQLVADGRNL 86

Query: 94  AVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG- 148
             Y+  L+  SV P    L     +++ S+     Q  I  +   +    +  +      
Sbjct: 87  WHYDVDLEQVSVRPLDEALGAAPIALLSSDTPLKEQFVITELGKIDGRYMVQLEAKVKDT 146

Query: 149 --NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
                 + FD    +L   ++ D   + + I +     NT ++P  F
Sbjct: 147 DYGFALLAFDAQG-QLDIMQLKDPMGQVTTIDLDNLASNTAIEPGTF 192


>gi|258593355|emb|CBE69694.1| putative Outer-membrane lipoprotein carrier protein precursor [NC10
           bacterium 'Dutch sediment']
          Length = 240

 Score = 81.9 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 33/195 (16%), Positives = 65/195 (33%), Gaps = 18/195 (9%)

Query: 18  YSAIFPFNAA-YPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------GEFFMAR 70
            S + P  A    +T D+   K    +     +QG+F Q     +        G  F+  
Sbjct: 28  PSTLHPTPAPVSALTADEVADKVQATYQGFSDLQGSFFQRATNKLSGMTQEASGRLFLKW 87

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT---WSVY-PLRYMAFSVIFSN---NQHV 123
           P +  ++Y  P S   + DG  +  Y+          V   L      ++F      +  
Sbjct: 88  PGRMRWEYEKPESRLFLIDGKTLWSYSPSERQAIAQDVSGALTTTPIGILFGMSNLRRDF 147

Query: 124 IQESIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
               I      +S  +I              + +  DR S+ +    + D     + +++
Sbjct: 148 QVRPIVHAGIRDSSESILELTPKGKGLAFKRVILGVDRASFLIRRLTVFDLYGNTTTVEL 207

Query: 180 LKYKENTVLDPKVFE 194
            K   N+ L  ++F+
Sbjct: 208 SKQTVNSNLKDELFQ 222


>gi|114332439|ref|YP_748661.1| outer membrane lipoprotein carrier protein LolA [Nitrosomonas
           eutropha C91]
 gi|123026693|sp|Q0AD86|LOLA_NITEC RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|114309453|gb|ABI60696.1| outer membrane lipoprotein carrier protein LolA [Nitrosomonas
           eutropha C91]
          Length = 206

 Score = 81.9 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 36/203 (17%), Positives = 70/203 (34%), Gaps = 25/203 (12%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE--DAG----Y 60
             ++ V  L          A+   +    V KA+       T +  F Q   D       
Sbjct: 2   SRLLFVFALSICLLPVSAKASAVESLKAFVNKAL-------TFRADFSQTLLDKNFQVVK 54

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVI 116
              G     RP KF + Y  P    ++ DG  +  Y+  L   +V+ L         +++
Sbjct: 55  KASGSMMFERPGKFRWVYDQPYQQLIVGDGKQVWFYDQDLAQVTVHRLDQTLGSTPAALL 114

Query: 117 -----FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS 171
                   + ++ +  +Q        I    ++ F   +I + F +    L    + DS 
Sbjct: 115 AGGNTIERDFNLQEIDVQGETEWLEAIPKNQENAFE--LIRLGFSQTGM-LREMILRDSF 171

Query: 172 RRYSIIKILKYKENTVLDPKVFE 194
            + + +     ++N VL P +F+
Sbjct: 172 DQVTWLIFSGTEQNPVLTPDLFQ 194


>gi|165919036|ref|ZP_02219122.1| outer membrane lipoprotein carrier protein LolA [Coxiella burnetii
           RSA 334]
 gi|165917291|gb|EDR35895.1| outer membrane lipoprotein carrier protein LolA [Coxiella burnetii
           RSA 334]
          Length = 211

 Score = 81.9 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 36/200 (18%), Positives = 77/200 (38%), Gaps = 21/200 (10%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGY-----VM 62
           +IG++ +F +S      +     +  +  +  +   + +T Q  F Q    G        
Sbjct: 7   LIGLLGIFLFSL-----SGIVSAQSDATTQLSQLLSNFRTYQAKFNQITFDGQDRVIQQS 61

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFS 118
            G   + RP +F ++  SP+   +I++G  + VY+  L   +  PL         S++  
Sbjct: 62  HGRVMIMRPGRFRWETDSPTKQIIITNGKTLWVYDVDLSQATQQPLAQKTNINPASLLSG 121

Query: 119 NNQHVIQESIQRVESNNSFITIF----FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           + + + Q+    +   +   T             N I + F +   +L    ++++    
Sbjct: 122 SVKDLKQKFTITISPTSDAATFQLVPHLGKSLNFNWIRLKFSKK--QLTEMTVLNNLDER 179

Query: 175 SIIKILKYKENTVLDPKVFE 194
           SI +  + K N  L   +FE
Sbjct: 180 SIFQFSQIKVNAPLSSTLFE 199


>gi|229587232|ref|YP_002845733.1| Outer membrane lipoprotein-sorting protein LolA [Rickettsia africae
           ESF-5]
 gi|228022282|gb|ACP53990.1| Outer membrane lipoprotein-sorting protein LolA [Rickettsia africae
           ESF-5]
          Length = 212

 Score = 81.9 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 35/198 (17%), Positives = 81/198 (40%), Gaps = 7/198 (3%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMK 63
           + K    ++I  F ++   F A        ++ +   +   I+++   F QED+ G ++K
Sbjct: 1   MKKIFFLIIIYLFVNSSLTFGA----DDKTAISELKTYLRKIKSVAIDFTQEDSYGKIVK 56

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHV 123
           G+  + +P  F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N+H 
Sbjct: 57  GKLLIHKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENTFNFLLEDNEHF 116

Query: 124 IQESIQRVESNNSFIT-IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
            ++ +     N   I+ I            +TF++ + ++   KI +       I   K 
Sbjct: 117 DKDFVFEAVINARNISKITIYHTLTEKRSEITFNKATQQIEALKIFED-NNIVTITFDKI 175

Query: 183 KENTVLDPKVFEIPYDKI 200
            +       +F+I   +I
Sbjct: 176 AKVQKFSDDLFKIKNPEI 193


>gi|255318824|ref|ZP_05360050.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           radioresistens SK82]
 gi|262378916|ref|ZP_06072073.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           radioresistens SH164]
 gi|255304080|gb|EET83271.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           radioresistens SK82]
 gi|262300201|gb|EEY88113.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           radioresistens SH164]
          Length = 231

 Score = 81.9 bits (201), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 80/218 (36%), Gaps = 26/218 (11%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA----------- 58
           +G   L    +     A    ++ Q+    ++    IQ++   F Q              
Sbjct: 13  VGAATLAPVISTSVIAAPVAASEQQATANLVQQLKGIQSLSANFEQTTKVSGNAPKKQKG 72

Query: 59  ------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL---- 108
                     KG   + RP KF+++ SSPS  ++++ G  + +Y+  L       L    
Sbjct: 73  LTAQHMNQTFKGTMKVERPGKFFWETSSPSKQTIVTTGKTVWIYDPDLQQAVRQSLDEQV 132

Query: 109 RYMAFSVIFSNNQHVIQ-ESIQRVESNNSFITIFFKDDFMG-NMISVTF-DRLSYRLLNW 165
                 ++  N   ++Q   + +     ++ T++ K++      ++++F    +  L+  
Sbjct: 133 SNTPALLLSGNTSQIMQSYRVTQPNKAKTYYTLYPKNNEGAFQSLTISFGTNKAPSLM-- 190

Query: 166 KIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            + DS  + + +K    K N  +    F     K  +I
Sbjct: 191 ILEDSLGQTTYVKFSNVKVNASIPASTFNFTPPKGTDI 228


>gi|73667459|ref|YP_303475.1| hypothetical protein Ecaj_0846 [Ehrlichia canis str. Jake]
 gi|72394600|gb|AAZ68877.1| hypothetical protein Ecaj_0846 [Ehrlichia canis str. Jake]
          Length = 193

 Score = 81.5 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 38/190 (20%), Positives = 88/190 (46%), Gaps = 11/190 (5%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK--GEFF 67
           I VV +FF+  I  F + +  + ++   +A+ +F +I + +  F+Q ++   +   G   
Sbjct: 3   ISVVYIFFF--IVCFFSVHSYSSEKIKVEALSYFNTIHSFKAEFVQTNSANNVAQYGTLI 60

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           M +P    + Y +P+  S+I  G+ I+ Y+ +L+ +S Y +       + S++   I++ 
Sbjct: 61  MKKPGLLKWDYYAPTPASIIIQGTTISYYDKELEEYS-YAIVNNPIINLLSSDIKNIEDI 119

Query: 128 I-QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI--LKYKE 184
           I   + + ++   I  +D     + +V F+     ++   I++     S I I     + 
Sbjct: 120 IFTNISTVDNNKIITLQDKKTQILAAVVFNVNPITIVGLNIINP---DSTIYIKFYNIQN 176

Query: 185 NTVLDPKVFE 194
           N  ++   F+
Sbjct: 177 NITIEESEFK 186


>gi|160900794|ref|YP_001566376.1| outer membrane lipoprotein carrier protein LolA [Delftia
           acidovorans SPH-1]
 gi|160366378|gb|ABX37991.1| outer membrane lipoprotein carrier protein LolA [Delftia
           acidovorans SPH-1]
          Length = 211

 Score = 81.5 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 33/203 (16%), Positives = 68/203 (33%), Gaps = 21/203 (10%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE----------DAGYVMKGEFFMAR 70
                A+   +    +K       + Q  +  F Q                  G+F   R
Sbjct: 7   AVVIAASATASWADGLKSLEAFMKNSQAGRAEFTQAVTAPSKDGQPPRTKNSSGQFEFQR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQ--HVI 124
           P KF F Y+ P   ++++DG  + +Y+A L+  +  P    L     +++ S N    + 
Sbjct: 67  PGKFRFVYTKPFEQTIVADGKTLWLYDADLNQVTQRPQAQALGSTPAAILASANDLKALS 126

Query: 125 QE-SIQRVESNNSFITIFFKDDFMGNMISVT---FDRLSYRLLNWKIMDSSRRYSIIKIL 180
            +  +Q     +    +          +      F     +L    I+DS  + S+I+  
Sbjct: 127 ADFDLQSAPEQDGLQWVQASPKDKNGQLKSVRVGFAA-DGQLSALDILDSFGQRSLIRFN 185

Query: 181 KYKENTVLDPKVFEIPYDKIHNI 203
           + +    L    F+       ++
Sbjct: 186 QLQTQASLPASTFDFKVPAGADV 208


>gi|188576728|ref|YP_001913657.1| outer-membrane lipoprotein carrier protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|188576919|ref|YP_001913848.1| outer-membrane lipoprotein carrier protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|188521180|gb|ACD59125.1| outer membrane lipoprotein carrier protein LolA [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|188521371|gb|ACD59316.1| outer membrane lipoprotein carrier protein LolA [Xanthomonas oryzae
           pv. oryzae PXO99A]
          Length = 216

 Score = 81.5 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 70/190 (36%), Gaps = 18/190 (9%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHF-LSIQTMQGTFLQE---DAGYV---MKGEFFMARPSK 73
                A +  T   + ++ ++ F   ++ + G F Q      G V     G   +A P +
Sbjct: 15  AVLATALFASTAFAAARQELDTFTRGLKGLDGQFSQRVTDANGKVKENSSGRVALATPRQ 74

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY---------PLRYMAFSVIFSNNQHVI 124
           F ++Y+ P    +++DG  + V++  L+  +V          PL  +    +      V 
Sbjct: 75  FRWEYAKPYRQLIVADGKKVWVFDPDLEQVTVRAQGSEEQNSPLVALINPALLDKKYDVS 134

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           +E+  R       +T     D    M S+ F +     +   ++D+  + + I    +K 
Sbjct: 135 EEAAPRDGLQWLSLTPKVDTDASFQMASLGFGKDGLAKME--VVDAVGQRTTISFSGWKR 192

Query: 185 NTVLDPKVFE 194
           N       F 
Sbjct: 193 NPAFAADTFR 202


>gi|113866782|ref|YP_725271.1| outer-membrane lipoprotein carrier protein [Ralstonia eutropha H16]
 gi|123329507|sp|Q0KDL8|LOLA_RALEH RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|113525558|emb|CAJ91903.1| outer membrane lipoprotein-sorting protein [Ralstonia eutropha H16]
          Length = 211

 Score = 81.5 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 31/206 (15%), Positives = 69/206 (33%), Gaps = 18/206 (8%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------EDAGYVMK---G 64
           I+    A     A        +  +       +++ +G F Q         G V     G
Sbjct: 5   IIVSACAALAMFAIQAPAHAAATDQLQSFVTGVKSARGEFTQRQVKGQGANGKVTGTSSG 64

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNN 120
            F  +RP KF ++Y+ P    L +DG  + +Y+  L+  +       L     +++F +N
Sbjct: 65  TFVFSRPGKFTWRYTKPYDQLLQADGQTLYIYDKDLNQVTERKLDGALGSSPAAILFGSN 124

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFMGN---MISVTFDRLSYRLLNWKIMDSSRRYSII 177
                  ++   + +    +             I + F   +   +   + D+    +++
Sbjct: 125 DLEKNFVVKNGPTRDGVEWLELTPKAKDTQFERIGIGFKAGNLEAME--LRDAFGNTTLL 182

Query: 178 KILKYKENTVLDPKVFEIPYDKIHNI 203
                ++N  L    F     K  ++
Sbjct: 183 TFTGMQKNPPLAADAFRFTVPKGADV 208


>gi|241663737|ref|YP_002982097.1| outer-membrane lipoprotein carrier protein [Ralstonia pickettii
           12D]
 gi|240865764|gb|ACS63425.1| outer membrane lipoprotein carrier protein LolA [Ralstonia
           pickettii 12D]
          Length = 215

 Score = 81.1 bits (199), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 34/205 (16%), Positives = 77/205 (37%), Gaps = 22/205 (10%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-----EDAGY------VMKGEF 66
            + +    A        +V++      ++ T +G F+Q        G          G+F
Sbjct: 11  AAGLVSLAAWSAGAYAGAVEQLNAFVSNVSTARGEFVQRQVKGGTNGSPLRVAGTSNGDF 70

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQH 122
             +RP +F ++Y  P    L +DG  + +++  L+  +       L     +++F +N  
Sbjct: 71  VFSRPGRFVWRYVKPYEQQLSADGQTLYIFDKDLNQITERKLDASLGSSPAAILFGSNDL 130

Query: 123 VIQESIQRVESNNSF----ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
               +++   + +      +T   KD      I++ F   S  L   ++ D+    +++ 
Sbjct: 131 AKNFTLKEGGTKDGIDWAELTPKAKDTQFE-RIAIGF--RSGELQGMELRDAFGNTTLLT 187

Query: 179 ILKYKENTVLDPKVFEIPYDKIHNI 203
               ++N  L   VF     K  ++
Sbjct: 188 FSNIQKNPQLPANVFRFTPPKGADV 212


>gi|153208619|ref|ZP_01946876.1| outer membrane lipoprotein carrier protein LolA [Coxiella burnetii
           'MSU Goat Q177']
 gi|212218616|ref|YP_002305403.1| outer-membrane lipoproteins carrier protein [Coxiella burnetii
           CbuK_Q154]
 gi|229485824|sp|B6J7K9|LOLA_COXB1 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|120575880|gb|EAX32504.1| outer membrane lipoprotein carrier protein LolA [Coxiella burnetii
           'MSU Goat Q177']
 gi|212012878|gb|ACJ20258.1| outer-membrane lipoproteins carrier protein [Coxiella burnetii
           CbuK_Q154]
          Length = 211

 Score = 81.1 bits (199), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 36/200 (18%), Positives = 77/200 (38%), Gaps = 21/200 (10%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGY-----VM 62
           +IG++ +F +S      +     +  +  +  +   + +T Q  F Q    G        
Sbjct: 7   LIGLLGIFLFSL-----SGIVSAQSDATTQLSQLLSNFRTYQAKFNQITFDGQDRVIQQS 61

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFS 118
            G   + RP +F ++  SP+   +I++G  + VY+  L   +  PL         S++  
Sbjct: 62  HGRVMIMRPGRFRWETDSPTKQIIITNGKTLWVYDVDLSQATQQPLAQKTNINPASLLSG 121

Query: 119 NNQHVIQESIQRVESNNSFITIF----FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           + + + Q+    +   +   T             N I + F +   +L    ++++    
Sbjct: 122 SVKDLKQKFTITISPTSDAATFQLVPRLGKSLNFNWIRLKFSKK--QLTEMTVLNNLDER 179

Query: 175 SIIKILKYKENTVLDPKVFE 194
           SI +  + K N  L   +FE
Sbjct: 180 SIFQFSQIKVNAPLSSTLFE 199


>gi|34581074|ref|ZP_00142554.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262459|gb|EAA25963.1| unknown [Rickettsia sibirica 246]
          Length = 212

 Score = 81.1 bits (199), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 35/198 (17%), Positives = 80/198 (40%), Gaps = 7/198 (3%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMK 63
           + K    ++I  F ++   F A        ++ +   +   I+++   F QED+ G ++K
Sbjct: 1   MKKIFFLIIIYLFVNSSLTFGA----DDKTAISELKTYLRKIKSVAIDFTQEDSYGKIVK 56

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHV 123
           G+  + +P  F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N+H 
Sbjct: 57  GKLLIHKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENTFNFLLEDNEHF 116

Query: 124 IQESIQRVESNNSFIT-IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
            ++ +     N   I+ I            +TF+  + ++   KI +       I   K 
Sbjct: 117 DKDFVFEAVINARNISKITIYHTLTEKRSEITFNNATQQIEALKIFED-NNIVTITFDKI 175

Query: 183 KENTVLDPKVFEIPYDKI 200
            +       +F+I   +I
Sbjct: 176 AKVQKFSDDLFKIKNPEI 193


>gi|187929628|ref|YP_001900115.1| outer-membrane lipoprotein carrier protein [Ralstonia pickettii
           12J]
 gi|309781606|ref|ZP_07676340.1| outer membrane lipoprotein carrier protein LolA [Ralstonia sp.
           5_7_47FAA]
 gi|229485836|sp|B2U9Y9|LOLA_RALPJ RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|187726518|gb|ACD27683.1| outer membrane lipoprotein carrier protein LolA [Ralstonia
           pickettii 12J]
 gi|308919581|gb|EFP65244.1| outer membrane lipoprotein carrier protein LolA [Ralstonia sp.
           5_7_47FAA]
          Length = 215

 Score = 81.1 bits (199), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 31/204 (15%), Positives = 74/204 (36%), Gaps = 20/204 (9%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-----EDAGY------VMKGEF 66
            + +    A        +V++      ++ T +G F+Q        G          G+F
Sbjct: 11  AAGLVSLAAWSAGAYAGAVEQLNAFVSNVSTARGEFVQRQVKGGTNGSPLRVAGTSNGDF 70

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQH 122
             +RP +F ++Y  P    L +DG  + +++  L+  +       L     +++F +N  
Sbjct: 71  VFSRPGRFVWRYVKPYEQQLSADGQMLYIFDKDLNQITERKLDASLGSSPAAILFGSNDL 130

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGN---MISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
               +++   + +    +             I++ F   S  L   ++ D+    +++  
Sbjct: 131 AKNFTLKEGGTKDGIDWVELTPKAKDTQFQRIAIGF--RSGELQGMELRDAFGNTTLLTF 188

Query: 180 LKYKENTVLDPKVFEIPYDKIHNI 203
              ++N  L   VF     K  ++
Sbjct: 189 SNIQKNPQLPANVFRFTPPKGADV 212


>gi|330503297|ref|YP_004380166.1| outer-membrane lipoprotein carrier protein [Pseudomonas mendocina
           NK-01]
 gi|328917583|gb|AEB58414.1| outer-membrane lipoprotein carrier protein [Pseudomonas mendocina
           NK-01]
          Length = 208

 Score = 81.1 bits (199), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 38/211 (18%), Positives = 79/211 (37%), Gaps = 20/211 (9%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV-- 61
             VI +++L   S       A    ++ + K+  E     QT+   F Q   + +G    
Sbjct: 1   MRVIRLLMLAALSFTLLTAQA---DEEAATKRLTELLNQAQTINARFSQLTLDASGTQLQ 57

Query: 62  -MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVI 116
              GE  + RP  F +    P    L+S+G  + +Y+  L+  ++  L         +++
Sbjct: 58  ETAGELVLKRPGLFRWHTDQPMEQLLVSNGEKVWLYDPDLEQVTIQTLDQRLTHTP-ALL 116

Query: 117 FSNNQHVIQESIQ-RVESNNSFITIFFKDDFMGN---MISVTFDRLSYRLLNWKIMDSSR 172
            S +   I+E+ +   +   S +    K     +    + ++F       +   ++DS  
Sbjct: 117 LSGDVSQIRENFEIDYKEGGSVVDFILKPKAKDSLFDSLRLSFRNRMLNDMQ--LIDSIG 174

Query: 173 RYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           + + I  L  K N  +D   F        ++
Sbjct: 175 QRTNILFLNVKMNEPVDDGQFTFDIPDGADV 205


>gi|84624060|ref|YP_451432.1| outer-membrane lipoprotein carrier protein [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|161898987|ref|YP_201183.2| outer-membrane lipoprotein carrier protein [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|123521882|sp|Q2P2R9|LOLA_XANOM RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|84368000|dbj|BAE69158.1| Probable outer-membrane lipoproteins carrier protein precursor
           [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 209

 Score = 81.1 bits (199), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 70/190 (36%), Gaps = 18/190 (9%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHF-LSIQTMQGTFLQE---DAGYV---MKGEFFMARPSK 73
                A +  T   + ++ ++ F   ++ + G F Q      G V     G   +A P +
Sbjct: 8   AVLATALFASTAFAAARQELDTFTRGLKGLDGQFSQRVTDANGKVKENSSGRVALATPRQ 67

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY---------PLRYMAFSVIFSNNQHVI 124
           F ++Y+ P    +++DG  + V++  L+  +V          PL  +    +      V 
Sbjct: 68  FRWEYAKPYRQLIVADGKKVWVFDPDLEQVTVRAQGSEEQNSPLVALINPALLDKKYDVS 127

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           +E+  R       +T     D    M S+ F +     +   ++D+  + + I    +K 
Sbjct: 128 EEAAPRDGLQWLSLTPKVDTDASFQMASLGFGKDGLAKME--VVDAVGQRTTISFSGWKR 185

Query: 185 NTVLDPKVFE 194
           N       F 
Sbjct: 186 NPAFAADTFR 195


>gi|330810443|ref|YP_004354905.1| hypothetical protein PSEBR_a3562 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327378551|gb|AEA69901.1| Conserved hypothetical protein; putative exported protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 207

 Score = 80.7 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/216 (16%), Positives = 74/216 (34%), Gaps = 28/216 (12%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAG 59
            L+   ++ V+ L   SA            ++ V +  +     QT+   F Q   + +G
Sbjct: 2   RLIRMLLLPVLALSTLSAH---------AGEKDVARLTQLLGGSQTLTARFSQLTLDGSG 52

Query: 60  YV---MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMA 112
                  G+  + RP  FY+   +P+   ++SDG  +++++  L+  ++  L        
Sbjct: 53  TQLQETAGDMALQRPGLFYWHTDAPAEQLMVSDGKKVSLWDPDLEQVTIKTLDQRLTQTP 112

Query: 113 FSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS- 171
             ++  +   + Q      +     I    K     +     FD L     N  + D   
Sbjct: 113 ALLLSGDISEISQSFEITSKEAGGVIDFTLKPKTKDS----LFDSLRLSFRNGLVNDMQL 168

Query: 172 ----RRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
                + + I     K N  +    F+    K  ++
Sbjct: 169 IDSVGQRTNILFTGVKANEPIAASKFKFDIPKGADV 204


>gi|330994810|ref|ZP_08318732.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           sp. SXCC-1]
 gi|329758071|gb|EGG74593.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           sp. SXCC-1]
          Length = 207

 Score = 80.7 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/186 (12%), Positives = 66/186 (35%), Gaps = 11/186 (5%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFY 75
              A  P        +   + +   +  + + +Q  F+Q    G   +G      P +  
Sbjct: 22  AACAGVPGQTP---DQRGDIARVETYLNTSRGLQAGFVQTWPDGGKGEGVLHYD-PGRLR 77

Query: 76  FKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVES-- 133
             Y++P ++ L++   ++   + + ++ +   L +    +I     H+  + +       
Sbjct: 78  LDYTTPGAMKLVAANGHLLFVDHRRESVTRMSLGHQPLGLILEQPVHLSGQIVVTAVQHG 137

Query: 134 -NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKI--MDSSRRYSIIKILKYKENTVLDP 190
            N+  +++   D     ++++ F  +   L    I   D  R++  + +          P
Sbjct: 138 TNSLQVSLARSDSPSQGILTLGFSDIGGTLSLLVIEMTDVERQHIRLDLTDATATGQPWP 197

Query: 191 K-VFEI 195
             +F +
Sbjct: 198 DAMFTL 203


>gi|225077422|ref|ZP_03720621.1| hypothetical protein NEIFLAOT_02483 [Neisseria flavescens
           NRL30031/H210]
 gi|224951240|gb|EEG32449.1| hypothetical protein NEIFLAOT_02483 [Neisseria flavescens
           NRL30031/H210]
          Length = 206

 Score = 80.3 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/200 (16%), Positives = 64/200 (32%), Gaps = 13/200 (6%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE----DAGYVMKGEFFMAR 70
           LF  +A    ++A    +  +V    +       + G F Q            G F + R
Sbjct: 6   LFTLTAAALLSSAIGFAQAGAVDALKKFNNDADGISGNFSQTVHSKKKTQTTHGTFKILR 65

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS---VIFSNNQHVIQES 127
           P  F ++Y+ P   +++ DG  I +Y+  L   +              I SN   +    
Sbjct: 66  PGLFKWEYTKPYKQTIVGDGKTIWLYDVDLAQVTKSSQDQTIGDSPAAILSNKTALDSSY 125

Query: 128 IQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
             + + + + I          N     I + F   +   +   + DS    + I      
Sbjct: 126 TLKEDGSANGIDYVLATPKKNNAGYQYIRIGFKGDNLAAMQ--LKDSFGNQTSISFSGLN 183

Query: 184 ENTVLDPKVFEIPYDKIHNI 203
               L   +F+    K  ++
Sbjct: 184 TKPNLSSGMFKFTPPKGVDV 203


>gi|241759859|ref|ZP_04757959.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           flavescens SK114]
 gi|241319867|gb|EER56263.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           flavescens SK114]
          Length = 206

 Score = 80.3 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/200 (16%), Positives = 64/200 (32%), Gaps = 13/200 (6%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE----DAGYVMKGEFFMAR 70
           LF  +A    ++A    +  +V    +       + G F Q            G F + R
Sbjct: 6   LFTLTAATLLSSAIGFAQAGAVDALKKFNNDADGISGNFSQTVHSKKKTQTTHGTFKILR 65

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS---VIFSNNQHVIQES 127
           P  F ++Y+ P   +++ DG  I +Y+  L   +              I SN   +    
Sbjct: 66  PGLFKWEYTKPYKQTIVGDGKTIWLYDVDLAQVTKSSQDQTIGDSPAAILSNKTALDSSY 125

Query: 128 IQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
             + + + + I          N     I + F   +   +   + DS    + I      
Sbjct: 126 TLKEDGSANGIDYVLATPKKNNAGYQYIRIGFKGDNLAAMQ--LKDSFGNQTSISFSGLN 183

Query: 184 ENTVLDPKVFEIPYDKIHNI 203
               L   +F+    K  ++
Sbjct: 184 TKPNLSSGMFKFTPPKGVDV 203


>gi|169794924|ref|YP_001712717.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii AYE]
 gi|213157671|ref|YP_002320469.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii AB0057]
 gi|215482470|ref|YP_002324656.1| outer membrane lipocarrier protein LolA [Acinetobacter baumannii
           AB307-0294]
 gi|239502307|ref|ZP_04661617.1| outer membrane lipocarrier protein LolA [Acinetobacter baumannii
           AB900]
 gi|301344902|ref|ZP_07225643.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii AB056]
 gi|301511073|ref|ZP_07236310.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii AB058]
 gi|301595148|ref|ZP_07240156.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii AB059]
 gi|332854212|ref|ZP_08435232.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii 6013150]
 gi|332866346|ref|ZP_08436951.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii 6013113]
 gi|332872561|ref|ZP_08440530.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii 6014059]
 gi|169147851|emb|CAM85714.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii AYE]
 gi|193078191|gb|ABO13142.2| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii ATCC 17978]
 gi|213056831|gb|ACJ41733.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii AB0057]
 gi|213986802|gb|ACJ57101.1| outer membrane lipocarrier protein LolA [Acinetobacter baumannii
           AB307-0294]
 gi|322509212|gb|ADX04666.1| Outer membrane lipoproteins carrier protein [Acinetobacter
           baumannii 1656-2]
 gi|323519241|gb|ADX93622.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii TCDC-AB0715]
 gi|332728137|gb|EGJ59525.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii 6013150]
 gi|332734694|gb|EGJ65798.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii 6013113]
 gi|332739247|gb|EGJ70105.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii 6014059]
          Length = 231

 Score = 80.0 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 78/218 (35%), Gaps = 26/218 (11%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------ 63
           +   +L    +   F A     + Q++   +     +Q +   F Q              
Sbjct: 13  LSASVLAPVMSTTAFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKANTKTVAQKKG 72

Query: 64  -----------GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR--- 109
                      G   + RP KFY++  SPS  ++++ G  + +Y+  L       L    
Sbjct: 73  LSAQHMNQTFKGSMKVERPGKFYWETVSPSKQTIVTSGKTVWIYDPDLQQAVRQSLDDQV 132

Query: 110 -YMAFSVIFSN-NQHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDR-LSYRLLNW 165
                 ++  N NQ +    + + + +  + T+F  K+D     ++++F    +  L+  
Sbjct: 133 ADTPALLLSGNTNQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFGANKAPTLM-- 190

Query: 166 KIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            + DS  + + ++    K N  +    F     K  +I
Sbjct: 191 VLQDSLGQTTYVRFKNVKVNASIPASTFNFTPPKGTDI 228


>gi|261380991|ref|ZP_05985564.1| outer membrane lipoprotein carrier protein LolA [Neisseria subflava
           NJ9703]
 gi|284796021|gb|EFC51368.1| outer membrane lipoprotein carrier protein LolA [Neisseria subflava
           NJ9703]
          Length = 206

 Score = 80.0 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/200 (16%), Positives = 64/200 (32%), Gaps = 13/200 (6%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE----DAGYVMKGEFFMAR 70
           LF  +A    ++A    +  +V    +       + G F Q            G F + R
Sbjct: 6   LFTLTAAALLSSAIGFAQADAVDALKKFNNDADGISGNFSQTVHSKKKTQTTHGTFKILR 65

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS---VIFSNNQHVIQES 127
           P  F ++Y+ P   +++ DG  I +Y+  L   +              I SN   +    
Sbjct: 66  PGLFKWEYTKPYKQTIVGDGKTIWLYDVDLAQVTKSSQDQTIGDSPAAILSNKTALDSSY 125

Query: 128 IQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
             + + + + I          N     I + F   +   +   + DS    + I      
Sbjct: 126 TLKEDGSANGIDYVLATPKKNNAGYQYIRIGFKGDNLAAMQ--LKDSFGNQTSISFSGLN 183

Query: 184 ENTVLDPKVFEIPYDKIHNI 203
               L   +F+    K  ++
Sbjct: 184 TKPNLSSGMFKFTPPKGVDV 203


>gi|169632600|ref|YP_001706336.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii SDF]
 gi|169151392|emb|CAP00117.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii]
          Length = 231

 Score = 80.0 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 78/218 (35%), Gaps = 26/218 (11%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------ 63
           +   +L    +   F A     + Q++   +     +Q +   F Q              
Sbjct: 13  LSASVLAPVMSTTAFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKANTKTVVQKKG 72

Query: 64  -----------GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR--- 109
                      G   + RP KFY++  SPS  ++++ G  + +Y+  L       L    
Sbjct: 73  LSAQHMNQTFKGSMKVERPGKFYWETVSPSKQTIVTSGKTVWIYDPDLQQAVRQSLDDQV 132

Query: 110 -YMAFSVIFSN-NQHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDR-LSYRLLNW 165
                 ++  N NQ +    + + + +  + T+F  K+D     ++++F    +  L+  
Sbjct: 133 ADTPALLLSGNTNQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFGANKAPTLM-- 190

Query: 166 KIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            + DS  + + ++    K N  +    F     K  +I
Sbjct: 191 VLQDSLGQTTYVRFKNVKVNASIPASTFNFTPPKGTDI 228


>gi|184159301|ref|YP_001847640.1| outer membrane lipoprotein-sorting protein [Acinetobacter baumannii
           ACICU]
 gi|183210895|gb|ACC58293.1| Outer membrane lipoprotein-sorting protein [Acinetobacter baumannii
           ACICU]
          Length = 229

 Score = 80.0 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 78/218 (35%), Gaps = 26/218 (11%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------ 63
           +   +L    +   F A     + Q++   +     +Q +   F Q              
Sbjct: 11  LSASVLAPVMSTTAFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKANTKTVAQKKG 70

Query: 64  -----------GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR--- 109
                      G   + RP KFY++  SPS  ++++ G  + +Y+  L       L    
Sbjct: 71  LSAQHMNQTFKGSMKVERPGKFYWETVSPSKQTIVTSGKTVWIYDPDLQQAVRQSLDDQV 130

Query: 110 -YMAFSVIFSN-NQHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDR-LSYRLLNW 165
                 ++  N NQ +    + + + +  + T+F  K+D     ++++F    +  L+  
Sbjct: 131 ADTPALLLSGNTNQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFGANKAPTLM-- 188

Query: 166 KIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            + DS  + + ++    K N  +    F     K  +I
Sbjct: 189 VLQDSLGQTTYVRFKNVKVNASIPASTFNFTPPKGTDI 226


>gi|260548982|ref|ZP_05823204.1| outer-membrane lipoproteins carrier protein [Acinetobacter sp.
           RUH2624]
 gi|260408150|gb|EEX01621.1| outer-membrane lipoproteins carrier protein [Acinetobacter sp.
           RUH2624]
          Length = 231

 Score = 80.0 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 80/219 (36%), Gaps = 28/219 (12%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM------- 62
           +   +L    +   F A     + Q++   +     +Q +   F Q              
Sbjct: 13  LSASVLAPVMSTTAFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKANTKAVAQKKG 72

Query: 63  ----------KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY-- 110
                     KG   + RP KFY++  SPS  ++++ G  + +Y+  L       L    
Sbjct: 73  LGAQHMNQTFKGSMKVERPGKFYWETVSPSKQTIVTSGKTVWIYDPDLQQAVRQSLDSQV 132

Query: 111 --MAFSVIFSNN--QHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDR-LSYRLLN 164
                +++ S N  Q +    + + + +  + T+F  K+D     ++++F    +  L+ 
Sbjct: 133 ADTP-ALLLSGNTSQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFGANKAPTLM- 190

Query: 165 WKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
             + DS  + + +K    K N  +    F     K  +I
Sbjct: 191 -VLQDSLGQTTYVKFNNVKVNASIPASTFNFTPPKGTDI 228


>gi|73542284|ref|YP_296804.1| outer-membrane lipoprotein carrier protein [Ralstonia eutropha
           JMP134]
 gi|123624308|sp|Q46Y23|LOLA_RALEJ RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|72119697|gb|AAZ61960.1| Outer membrane lipoprotein carrier protein LolA [Ralstonia eutropha
           JMP134]
          Length = 212

 Score = 80.0 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/192 (14%), Positives = 66/192 (34%), Gaps = 18/192 (9%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQE---DAGYV------MKGEFFMARPSKFYFKY 78
            P     +  +       +++ +G F Q      G          G F  +RP KF ++Y
Sbjct: 20  MPTALAAATDQLQSFVTGVKSAKGEFTQRQVKGQGDSLKVTGTSSGSFVFSRPGKFTWRY 79

Query: 79  SSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESIQRVESN 134
           + P    L +DG  + +Y+  L+  +       L     +++F +N      +++   + 
Sbjct: 80  AKPYEQLLQADGQTLYIYDKDLNQVTERKLDGALGSSPAAILFGSNDLEKNFTVKNGPTR 139

Query: 135 NSFITIFFKDDFMGN---MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPK 191
           +    +             I + F   +   +   + D+    +++     ++N  L   
Sbjct: 140 DGVEWLELTPKSKDTQFERIGIGFKGGNLEAME--LRDAFGNTTLLTFSAMQKNPQLPAN 197

Query: 192 VFEIPYDKIHNI 203
            F     K  ++
Sbjct: 198 AFRFTVPKGADV 209


>gi|194288877|ref|YP_002004784.1| outer-membrane lipoprotein carrier protein [Cupriavidus taiwanensis
           LMG 19424]
 gi|229485826|sp|B3R334|LOLA_CUPTR RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|193222712|emb|CAQ68715.1| putative periplasmic outer membrane lipoprotein carrier protein
           [Cupriavidus taiwanensis LMG 19424]
          Length = 211

 Score = 80.0 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/206 (15%), Positives = 68/206 (33%), Gaps = 18/206 (8%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGY--------VMKG 64
           IL    A     A        +  +       +++ +G F Q    G            G
Sbjct: 5   ILVSACAALAMFAMQAPAHAAATDQLQSFVTGVKSARGEFTQRQVKGQGANVKVTGTSSG 64

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNN 120
            F  +RP KF ++Y+ P    L +DG  + +Y+  L+  +       L     +++F +N
Sbjct: 65  TFVFSRPGKFTWRYTKPYEQLLQADGQTLYIYDKDLNQVTERKLDGALGSSPAAILFGSN 124

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFMGN---MISVTFDRLSYRLLNWKIMDSSRRYSII 177
                  ++   + +    +             I + F   +   +   + D+    +++
Sbjct: 125 DLDKNFVVRNGPTRDGVEWLELTPKAKDTQFERIGIGFKAGNLEAME--LRDAFGNTTLL 182

Query: 178 KILKYKENTVLDPKVFEIPYDKIHNI 203
                ++N  L    F     K  ++
Sbjct: 183 TFTGMQKNPPLAADAFRFTVPKGADV 208


>gi|15604694|ref|NP_221212.1| hypothetical protein RP864 [Rickettsia prowazekii str. Madrid E]
 gi|7388445|sp|Q9ZCA2|Y864_RICPR RecName: Full=Uncharacterized protein RP864; Flags: Precursor
 gi|3861389|emb|CAA15288.1| unknown [Rickettsia prowazekii]
 gi|292572528|gb|ADE30443.1| Outer membrane lipoprotein-sorting protein LolA [Rickettsia
           prowazekii Rp22]
          Length = 213

 Score = 79.6 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/164 (17%), Positives = 68/164 (41%), Gaps = 7/164 (4%)

Query: 41  EHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
            +  +I+++   F QED+ G ++KG+  + +P  F   Y  P  + +I   + +++Y+  
Sbjct: 32  NYLRTIKSVAIDFTQEDSYGKIVKGKLLIQKPYNFRCNYYPPFPLVIIGTKNFVSMYDYD 91

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESI---QRVESNNSFITIFFKDDFMGNMISVTFD 156
           ++  S        F+ +  +N    ++ +      + N   ITI+       + I+  F+
Sbjct: 92  MEQVSRISPSENIFNFLLEDNVDFDKDFVFESVINKGNIFNITIYHTRTEKRSEIT--FN 149

Query: 157 RLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
           +   ++   KI +       I   K  +       +F+    +I
Sbjct: 150 KNIKQIEKLKIFED-HNIVTITFDKITKVQKFSDDLFKFKNPEI 192


>gi|319638686|ref|ZP_07993446.1| outer-membrane lipoprotein carrier protein [Neisseria mucosa C102]
 gi|317400070|gb|EFV80731.1| outer-membrane lipoprotein carrier protein [Neisseria mucosa C102]
          Length = 206

 Score = 79.6 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/200 (16%), Positives = 64/200 (32%), Gaps = 13/200 (6%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE----DAGYVMKGEFFMAR 70
           LF  +A    ++A    +  +V    +       + G F Q            G F + R
Sbjct: 6   LFTLTAAALLSSAIGFAQAGAVDALKKFNNDADGISGNFSQTVHSKKKTQTTYGTFKILR 65

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS---VIFSNNQHVIQES 127
           P  F ++Y+ P   +++ DG  I +Y+  L   +              I SN   +    
Sbjct: 66  PGLFKWEYTKPYKQTIVGDGKTIWLYDVDLAQVTKSSQDQTIGDSPAAILSNKTALDSSY 125

Query: 128 IQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
             + + + + I          N     I + F   +   +   + DS    + I      
Sbjct: 126 TLKEDGSANGIDYVLATPKKNNAGYQYIRIGFKGDNLAAMQ--LKDSFGNQTSISFSGLN 183

Query: 184 ENTVLDPKVFEIPYDKIHNI 203
               L   +F+    K  ++
Sbjct: 184 TKPNLSSGMFKFTPPKGVDV 203


>gi|124266313|ref|YP_001020317.1| outer membrane lipoprotein carrier protein LolA [Methylibium
           petroleiphilum PM1]
 gi|189028554|sp|A2SEU3|LOLA_METPP RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|124259088|gb|ABM94082.1| outer membrane lipoprotein carrier protein LolA [Methylibium
           petroleiphilum PM1]
          Length = 203

 Score = 79.6 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 61/160 (38%), Gaps = 14/160 (8%)

Query: 46  IQTMQGTFLQE---DAG---YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           ++T +  F Q      G       G F  +RP++F F Y+ P    ++SDG  + +++  
Sbjct: 33  VKTGRAAFTQTVTSPDGAKKKSSSGSFEFSRPNRFRFAYTKPYEQLIVSDGQKVWLHDPD 92

Query: 100 LDTWSVYP----LRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGN--MISV 153
           L+  +V P    L     +++   +     E     +               G+   + V
Sbjct: 93  LNQVTVRPVGQALGATPAALLAGASLEKDFELKALPDDGGLQWAQALPRVKEGSFQSLKV 152

Query: 154 TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
            F   +   +   I+D+  + S ++  +++ +  L    F
Sbjct: 153 GFRGKTLAAVE--IVDAFGQRSRLEFSQFEADAKLPADRF 190


>gi|300703419|ref|YP_003745021.1| outer-membrane lipoprotein carrier protein [Ralstonia solanacearum
           CFBP2957]
 gi|299071082|emb|CBJ42391.1| Outer-membrane lipoprotein carrier protein precursor [Ralstonia
           solanacearum CFBP2957]
          Length = 215

 Score = 79.6 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/195 (14%), Positives = 69/195 (35%), Gaps = 20/195 (10%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-----EDAGY------VMKGEF 66
            + +    A     +  ++++      ++ T +G F+Q        G          G+F
Sbjct: 11  AAGLVSLAAWSAGAQAGAIEQLNAFVNNVTTARGEFVQRQVKGGANGSPLRVAGASSGDF 70

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQH 122
             +RP +F ++Y  P    L +DG  + +Y+  L   +       L     +++F +N  
Sbjct: 71  IFSRPGRFVWRYLKPYEQQLSADGQMLYIYDKDLSQVTERKLDASLGSSPAAILFGSNDL 130

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGN---MISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
               S++   + +    +             +++ F      L   ++ D+    +++  
Sbjct: 131 AKNFSLKEGGTKDGIDWVELTPKAKDTQFERVAIGFRAG--ELEGMELRDAFGNTTLLTF 188

Query: 180 LKYKENTVLDPKVFE 194
              ++N  L    F 
Sbjct: 189 SHLQKNPQLPASAFR 203


>gi|297538758|ref|YP_003674527.1| outer membrane lipoprotein carrier protein LolA [Methylotenera sp.
           301]
 gi|297258105|gb|ADI29950.1| outer membrane lipoprotein carrier protein LolA [Methylotenera sp.
           301]
          Length = 205

 Score = 79.6 bits (195), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 36/177 (20%), Positives = 65/177 (36%), Gaps = 15/177 (8%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------GEFFMARPSKFYFKYSSPSS 83
                 V    + +     ++  F Q       +      GE  + RP+KF + Y  P  
Sbjct: 18  AANADGVSSLKKFYDETHAVKADFHQIVTDKQGQKIQEVYGEMQLKRPNKFRWDYHKPFE 77

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSF-- 137
             +ISDG  + +Y+ +L   SV  L         +++  ++       +      +    
Sbjct: 78  QQIISDGKQVWLYDTELAQVSVRELSKALGSSPAALLAGDDSLDKNFKLVNAFRKDGLDW 137

Query: 138 ITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
           ++   KD   G N IS+ F   +  L    ++DS    + I       N V++PK F
Sbjct: 138 VSTNPKDSDTGFNKISLAF--KNDVLQEMDMIDSFGHQTKILFSNVVHNPVIEPKSF 192


>gi|260557289|ref|ZP_05829505.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii ATCC 19606]
 gi|260409395|gb|EEX02697.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii ATCC 19606]
          Length = 231

 Score = 79.2 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 78/218 (35%), Gaps = 26/218 (11%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------ 63
           +   +L    +   F A     + Q++   +     +Q +   F Q              
Sbjct: 13  LSASVLAPVMSTTAFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQITKANTKTVAQKKG 72

Query: 64  -----------GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR--- 109
                      G   + RP KFY++  SPS  ++++ G  + +Y+  L       L    
Sbjct: 73  LSAQHMNQTFKGSMKVERPGKFYWETVSPSKQTIVTSGKTVWIYDPDLQQAVRQSLDDQV 132

Query: 110 -YMAFSVIFSN-NQHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDR-LSYRLLNW 165
                 ++  N NQ +    + + + +  + T+F  K+D     ++++F    +  L+  
Sbjct: 133 ADTPALLLSGNTNQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFGANKAPTLM-- 190

Query: 166 KIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            + DS  + + ++    K N  +    F     K  +I
Sbjct: 191 VLQDSLGQTTYVRFKNVKVNASIPASTFNFTPPKGTDI 228


>gi|170722572|ref|YP_001750260.1| outer-membrane lipoprotein carrier protein [Pseudomonas putida
           W619]
 gi|229485835|sp|B1JBE3|LOLA_PSEPW RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|169760575|gb|ACA73891.1| outer membrane lipoprotein carrier protein LolA [Pseudomonas putida
           W619]
          Length = 211

 Score = 79.2 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 39/211 (18%), Positives = 73/211 (34%), Gaps = 22/211 (10%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE--DAG----YV 61
            ++ V  L   S     +A      +Q V++  +     QT++  F Q   DAG      
Sbjct: 5   RMLLVSALTLGSLSATLSA---HAGEQDVQRLTQLLEKSQTIEANFSQLTLDAGGTSLQE 61

Query: 62  MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIF 117
             G+  + RP  FY+   +P    ++SDG N+ +++  L+  ++      L     +++ 
Sbjct: 62  TTGKMTVKRPGLFYWHTDAPQEQVVVSDGKNVTLWDPDLEQATIKKLDVRLNQTP-ALLL 120

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----R 172
           S +   I +S          +  F             FD L        I D        
Sbjct: 121 SGDVSKISQSFDITSKEQGEVMDF---TLKPTTKDTLFDSLRVSFRRGLINDMQLIDSVG 177

Query: 173 RYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           + + I     K N  +    F+    K  ++
Sbjct: 178 QRTNILFNGVKANQAVPDSTFKFDIPKGADV 208


>gi|83749191|ref|ZP_00946193.1| Outer-membrane lipoproteins carrier protein [Ralstonia solanacearum
           UW551]
 gi|207742681|ref|YP_002259073.1| outer-membrane lipoprotein carrier protein precursor [Ralstonia
           solanacearum IPO1609]
 gi|83724132|gb|EAP71308.1| Outer-membrane lipoproteins carrier protein [Ralstonia solanacearum
           UW551]
 gi|206594075|emb|CAQ61002.1| outer-membrane lipoprotein carrier protein precursor [Ralstonia
           solanacearum IPO1609]
          Length = 215

 Score = 79.2 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 69/194 (35%), Gaps = 20/194 (10%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-----EDAGY------VMKGEFF 67
           + +    A     +  ++++      ++ T +G F+Q        G          G+F 
Sbjct: 12  AGLVSLAAWSAGAQAGAIEQLNAFVNNVTTARGEFVQRQVKGGANGSPLRVAGASSGDFI 71

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHV 123
            +RP +F ++Y  P    L +DG  + +Y+  L   +       L     +++F +N   
Sbjct: 72  FSRPGRFVWRYLKPYEQQLSADGQMLYIYDKDLSQVTERKLDASLGSSPAAILFGSNDLA 131

Query: 124 IQESIQRVESNNSFITIFFKDDFMGN---MISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
              S++   + +    +             +++ F      L   ++ D+    +++   
Sbjct: 132 KNFSLKEGGTKDGIDWVELTPKAKDTQFERVAIGFRAG--ELEGMELRDAFGNTTLLTFS 189

Query: 181 KYKENTVLDPKVFE 194
             ++N  L    F 
Sbjct: 190 HLQKNPQLPASAFR 203


>gi|51474032|ref|YP_067789.1| hypothetical protein RT0853 [Rickettsia typhi str. Wilmington]
 gi|51460344|gb|AAU04307.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 213

 Score = 79.2 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/196 (14%), Positives = 81/196 (41%), Gaps = 7/196 (3%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGE 65
           K ++ ++I+ F  +     +      +  + +   +  +I+++   F QED+ G ++KG+
Sbjct: 2   KKILFLIIICFCLSSIKAYS----NNNIHLSEFKNYLRTIKSVAIDFTQEDSYGKIVKGK 57

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQ 125
             + +P  F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N+   +
Sbjct: 58  LLIQKPYNFRCNYYPPFPLVIIGTKNFVSIYDYDMEQVSRINRSENIFNFLLEDNEDYDK 117

Query: 126 ESIQ-RVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           + +   + +  + + I            +TF++   ++   KI +     + I   K  +
Sbjct: 118 DFVLESIINKGNIVNITIYHSKTEKRSEITFNKNIKQIEKLKIFEDHNMVT-ITFDKITK 176

Query: 185 NTVLDPKVFEIPYDKI 200
                  +F+    +I
Sbjct: 177 VRKFSDDLFKFKNPEI 192


>gi|307825886|ref|ZP_07656101.1| outer membrane lipoprotein carrier protein LolA [Methylobacter
           tundripaludum SV96]
 gi|307733005|gb|EFO03867.1| outer membrane lipoprotein carrier protein LolA [Methylobacter
           tundripaludum SV96]
          Length = 196

 Score = 78.8 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 33/199 (16%), Positives = 67/199 (33%), Gaps = 41/199 (20%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQ------EDAGYVMKGEFFMARPSKFYFKYSSPSSV 84
            +D+ VK+      + +++   F Q       +      G F++ RP KF + Y  P   
Sbjct: 10  AEDKPVKQLRAFLKNTKSLTADFKQVLINEAGNPTQTSYGIFYLQRPGKFRWDYLKPFQQ 69

Query: 85  SLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVI-----FSNNQHVIQESI------- 128
            ++S    +  Y+  L+  +V  L          ++        N  + Q+ +       
Sbjct: 70  QIVSTSGKVWFYDTDLEQVTVKKLDESVGSTPALLLSGEISLDENFTMEQQGVDGNLMWI 129

Query: 129 ----QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
               +  ES+  ++ I   +D +G             L      D+  + + I       
Sbjct: 130 KLLPKNQESSFKYVLIGLNNDSLGG----------MELS-----DNFGQLTRIYFSNVIL 174

Query: 185 NTVLDPKVFEIPYDKIHNI 203
           N  L   +FE    K  ++
Sbjct: 175 NPPLKQTLFEFKAPKGVDV 193


>gi|119897657|ref|YP_932870.1| putative outer membrane lipoprotein carrier protein [Azoarcus sp.
           BH72]
 gi|119670070|emb|CAL93983.1| putative outer membrane lipoprotein carrier protein [Azoarcus sp.
           BH72]
          Length = 225

 Score = 78.8 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 35/205 (17%), Positives = 74/205 (36%), Gaps = 13/205 (6%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY 60
           M  +L  +      L   +A+  F     +  D  V +  +   + ++ +G+F Q     
Sbjct: 1   MKRVLGMNAGHWGALVVCAALV-FGTRCAVAADG-VDQLRQFVTATRSAEGSFEQVVTAK 58

Query: 61  ------VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRY 110
                   +G F  +RP KF ++Y  P    L+ DG  +  ++  L+  +V      L  
Sbjct: 59  SGRKPQQSEGSFAFSRPGKFRWQYELPYQQLLVGDGEKLWSWDKDLNQVAVKRLGDALGA 118

Query: 111 MAFSVIFSNNQHVIQESIQRVESNNSFITIFFK-DDFMGNMISVTFDRLSYRLLNWKIMD 169
              +++F  +       +    S      +  +         ++     + +L   ++ D
Sbjct: 119 TPAAILFGGSDLEQNFELSDGGSAEGLAWVEARPRKPESGFENLRLGLYAGQLRRMEMRD 178

Query: 170 SSRRYSIIKILKYKENTVLDPKVFE 194
           S  + ++I   +   N  LDP  F 
Sbjct: 179 SFGQATVIVFTRLVANPALDPARFR 203


>gi|332526023|ref|ZP_08402161.1| outer membrane lipoprotein carrier protein LolA [Rubrivivax
           benzoatilyticus JA2]
 gi|332109866|gb|EGJ10494.1| outer membrane lipoprotein carrier protein LolA [Rubrivivax
           benzoatilyticus JA2]
          Length = 202

 Score = 78.8 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 58/182 (31%), Gaps = 18/182 (9%)

Query: 36  VKKAIEHFLSIQTMQGTFLQE---DAGYV---MKGEFFMARPSKFYFKYSSPSSVSLISD 89
           V+        ++T +  F Q      G       G F  ARP +F F Y  P   ++++D
Sbjct: 22  VQTLRAFVRDVKTGRAEFTQTVTSPDGARKKTSSGRFEFARPDRFRFGYEKPFQQTIVAD 81

Query: 90  GSNIAVYNAKLDTWSVYPLRY----MAFSVI----FSNNQHVIQESIQRVESNNSFITIF 141
           G  + +++  L+  S   L         +++      ++  +                  
Sbjct: 82  GQKVWIHDPDLNQVSSRRLSQALGATPAALLAGGSLESDFVLSNGGSLGGLEWAQAT--- 138

Query: 142 FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIH 201
                 G   S+        L   +I+DS  + S +    ++    L  + F        
Sbjct: 139 -PRTPDGPFKSMKVGFRGAELAAVEIVDSFGQRSRLDFKGFEAGVALPAERFRFTVPAGA 197

Query: 202 NI 203
           ++
Sbjct: 198 DL 199


>gi|262281250|ref|ZP_06059032.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           calcoaceticus RUH2202]
 gi|262257481|gb|EEY76217.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           calcoaceticus RUH2202]
          Length = 231

 Score = 78.8 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 79/218 (36%), Gaps = 26/218 (11%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------ 63
           +   +L    +   F A     + Q++   +     +Q +   F Q              
Sbjct: 13  LSASVLAPVMSTTVFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKANTKTVAQKKS 72

Query: 64  -----------GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR--- 109
                      G   + RP KFY++  SPS  ++++ G  + +Y+  L       L    
Sbjct: 73  LSAQHMNQTFKGSMKVERPGKFYWETVSPSKQTIVTSGKTVWIYDPDLQQAVRQSLDDQV 132

Query: 110 -YMAFSVIFSN-NQHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDR-LSYRLLNW 165
                 ++  N NQ +    + + + +  + T+F  K+D     ++++F    +  L+  
Sbjct: 133 ADTPALLLSGNTNQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFGANKAPTLM-- 190

Query: 166 KIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            + DS  + + ++    K N  +   VF     K  ++
Sbjct: 191 VLQDSLGQTTYVRFKNVKVNASIPASVFNFTPPKGTDV 228


>gi|207723625|ref|YP_002254023.1| outer-membrane lipoprotein carrier protein precursor [Ralstonia
           solanacearum MolK2]
 gi|206588828|emb|CAQ35790.1| outer-membrane lipoprotein carrier protein precursor [Ralstonia
           solanacearum MolK2]
          Length = 215

 Score = 78.8 bits (193), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 69/194 (35%), Gaps = 20/194 (10%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-----EDAGY------VMKGEFF 67
           + +    A     +  ++++      ++ T +G F+Q        G          G+F 
Sbjct: 12  AGLVSLAAWSAGAQAGAIEQLNAFVNNVTTARGEFVQRQVKGGANGSPLRVAGASSGDFI 71

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHV 123
            +RP +F ++Y  P    L +DG  + +Y+  L   +       L     +++F +N   
Sbjct: 72  FSRPGRFVWRYLKPYEQQLSADGRMLYIYDKDLSQVTERKLDASLGSSPAAILFGSNDLA 131

Query: 124 IQESIQRVESNNSFITIFFKDDFMGN---MISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
              S++   + +    +             +++ F      L   ++ D+    +++   
Sbjct: 132 KNFSLKEGGTKDGIDWVELTPKAKDTQFERVAIGFRAG--ELEGMELRDAFGNTTLLTFS 189

Query: 181 KYKENTVLDPKVFE 194
             ++N  L    F 
Sbjct: 190 HLQKNPQLPASAFR 203


>gi|68171853|ref|ZP_00545185.1| similar to Outer membrane lipoprotein-sorting protein [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88658500|ref|YP_507838.1| hypothetical protein ECH_1053 [Ehrlichia chaffeensis str. Arkansas]
 gi|67998722|gb|EAM85442.1| similar to Outer membrane lipoprotein-sorting protein [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88599957|gb|ABD45426.1| conserved hypothetical protein [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 193

 Score = 78.4 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 75/184 (40%), Gaps = 5/184 (2%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED--AGYVMKGEFFMARP 71
           I + Y  I  F + +  + +   ++ + +F +I + +  F+Q       +  G  FM +P
Sbjct: 5   IAYIYFFIVYFVSIHAYSTETIKEELLSYFSAIHSFKAEFVQTSSANNDIQHGMVFMKKP 64

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI-QR 130
               + Y  P+  S+I  G  I+ Y+ +L+ +S Y +       + S++   I++ I   
Sbjct: 65  GLLKWDYYPPTPASIIMHGRTISYYDKELEEYS-YSIINNPIINLLSSDIKDIKDIIFLN 123

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
             + +S   I  +D     +  + F+     ++   I       + IK    + N  +  
Sbjct: 124 TSTTDSKKVITIQDQKTALLADIIFNTNPITIVGLNIASPD-SITYIKFYNIQNNITIKD 182

Query: 191 KVFE 194
             F+
Sbjct: 183 TEFK 186


>gi|121608725|ref|YP_996532.1| outer membrane lipoprotein carrier protein LolA [Verminephrobacter
           eiseniae EF01-2]
 gi|121553365|gb|ABM57514.1| outer membrane lipoprotein carrier protein LolA [Verminephrobacter
           eiseniae EF01-2]
          Length = 216

 Score = 78.4 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 34/211 (16%), Positives = 70/211 (33%), Gaps = 25/211 (11%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ----------EDAGYVMK 63
           I+     I    +A   + D  +K         QT +  F Q               +  
Sbjct: 7   IIASAITIVMAGSAMGASADG-LKSLEAFLQHTQTGRAEFSQSVTAPPKDGQTARAKLSG 65

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSN 119
           G F   RP +F F Y  P   ++++DG  + +Y+A L+  +       L       + ++
Sbjct: 66  GRFEFQRPGRFKFVYQKPFEQTIVADGQTLWLYDADLNQVTRRAQAQALGSTPA-ALLAS 124

Query: 120 NQHV----IQESIQRVESNNSFITIFFKDDFMGNMISVT---FDRLSYRLLNWKIMDSSR 172
              +     + ++Q +        +          I      F      +L+  I+D+  
Sbjct: 125 APDLPALQAEFTLQALPDQEGLQWVQASPKNRDGQIKSVRVGFAGEQLAVLD--ILDNFG 182

Query: 173 RYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           + S+I+    + N  L    F+       ++
Sbjct: 183 QRSVIRFTGLQTNVALPANTFQFNPPAGADV 213


>gi|94309631|ref|YP_582841.1| outer-membrane lipoprotein carrier protein [Cupriavidus
           metallidurans CH34]
 gi|123260347|sp|Q1LQK4|LOLA_RALME RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|93353483|gb|ABF07572.1| Outer membrane lipoprotein carrier protein LolA precursor;
           chaperone for lipoproteins [Cupriavidus metallidurans
           CH34]
          Length = 214

 Score = 78.4 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 30/183 (16%), Positives = 65/183 (35%), Gaps = 18/183 (9%)

Query: 37  KKAIEHFLSIQTMQGTFLQE---DAG------YVMKGEFFMARPSKFYFKYSSPSSVSLI 87
            +      S++T +G F Q+     G          G F  +RP KF ++Y+ P    L 
Sbjct: 31  DQLQSFVTSVKTARGEFTQQQMKGKGADLKVASTSSGTFVFSRPGKFAWRYTKPYEQLLQ 90

Query: 88  SDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFK 143
           +DG  + +Y+  L+  +       L     +++F +N       ++   + +    +   
Sbjct: 91  ADGQVLYIYDKDLNQVTERKLDGALGSSPAAILFGSNDLSKNFDVKNGATRDGVEWLELT 150

Query: 144 DDFMGN---MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
                     I + F   +   +   + D+    +I+     ++N  L    F     K 
Sbjct: 151 PKEKDTQFERIGIGFKGGNLEAME--LRDAFGNTTILTFSAIQKNPSLPADAFRFTVPKG 208

Query: 201 HNI 203
            ++
Sbjct: 209 ADV 211


>gi|299768959|ref|YP_003730985.1| outer-membrane lipoproteins carrier protein [Acinetobacter sp. DR1]
 gi|298699047|gb|ADI89612.1| outer-membrane lipoproteins carrier protein [Acinetobacter sp. DR1]
          Length = 231

 Score = 78.4 bits (192), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 79/218 (36%), Gaps = 26/218 (11%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------ 63
           +   +L    +   F A     + Q++   +     +Q +   F Q              
Sbjct: 13  LSASVLAPVMSTTVFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKANTKTVAQKKS 72

Query: 64  -----------GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR--- 109
                      G   + RP KFY++  SP+  ++++ G  + +Y+  L       L    
Sbjct: 73  LSAQHMNQTFKGSMKVERPGKFYWETVSPAKQTIVTSGKTVWIYDPDLQQAVRQSLDDQV 132

Query: 110 -YMAFSVIFSN-NQHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDR-LSYRLLNW 165
                 ++  N NQ +    + + + +  + T+F  K+D     ++++F    +  L+  
Sbjct: 133 ADTPALLLSGNTNQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFGANKAPTLM-- 190

Query: 166 KIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            + DS  + + ++    K N  +   VF     K  +I
Sbjct: 191 VLQDSLGQTTYVRFKNVKVNASIPASVFNFTPPKGTDI 228


>gi|17547059|ref|NP_520461.1| outer-membrane lipoprotein carrier protein [Ralstonia solanacearum
           GMI1000]
 gi|21759258|sp|Q8XWY0|LOLA_RALSO RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|17429360|emb|CAD16047.1| probable outer-membrane lipoprotein carrier precursor. signal
           peptide [Ralstonia solanacearum GMI1000]
          Length = 215

 Score = 78.0 bits (191), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 31/197 (15%), Positives = 71/197 (36%), Gaps = 24/197 (12%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-----EDAGY------VMKGEF 66
            + +    A     +  ++++      ++ T +G F+Q        G          G+F
Sbjct: 11  AAGLVSLAAWSAGAQAGAIEQLNAFVSNVTTARGEFVQRQVKGGANGSPLRVAGTSSGDF 70

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQH 122
             +RP +F ++Y  P    L +DG  + +Y+  L   +       L     +++F +N  
Sbjct: 71  TFSRPGRFVWRYLKPYEQQLSADGQMLYIYDKDLSQVTERKLDASLGSSPAAILFGSN-D 129

Query: 123 VIQESIQRVESNNSFI-----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
           + +  + +       I     T   KD      +++ F      L   ++ D+    +++
Sbjct: 130 LAKNFVLKEGGTKDGIDWVELTPKAKDTQFE-RVAIGFRAG--ELEGMELRDAFGNTTLL 186

Query: 178 KILKYKENTVLDPKVFE 194
                ++N  L    F 
Sbjct: 187 TFSHIQKNPQLPASAFR 203


>gi|332978340|gb|EGK15065.1| outer-membrane lipoprotein carrier protein [Psychrobacter sp.
           1501(2011)]
          Length = 237

 Score = 78.0 bits (191), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 37/224 (16%), Positives = 82/224 (36%), Gaps = 24/224 (10%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKD--QSVKKAIEHFLSIQTMQGTFLQEDA 58
           M  ++  ++ G +I           A      D   + K+      + ++M   F Q   
Sbjct: 14  MKKVMGTALSGALIFGMPVMAVSQAAQAATAADNLTAAKRLNTLLSNTKSMTANFTQTTK 73

Query: 59  G------------YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV- 105
           G                G   + RP+ F +  +SPS   +++DGS + VY+  L+  +  
Sbjct: 74  GANGGKSGLSAKNGTFSGNVSLQRPNNFRWNITSPSEQLIVTDGSALWVYDKDLEQVTRQ 133

Query: 106 ---YPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKDDFMG-NMISVTF-DRLS 159
                +      ++  +   + +   I +  +  ++  ++ K+     N ++V+F     
Sbjct: 134 STDQQVGNTPALLLSGDPSKIAKNFKITQPNATKNYYVLYPKNSGSNFNSLAVSFNGGKP 193

Query: 160 YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
             +    + DS  + + IK    K NT +    F+    K  ++
Sbjct: 194 VMM---VLNDSLGQVTSIKFSNVKTNTSIPSSQFKFTPPKGVDV 234


>gi|299066063|emb|CBJ37244.1| Outer-membrane lipoprotein carrier protein precursor [Ralstonia
           solanacearum CMR15]
          Length = 206

 Score = 78.0 bits (191), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 31/197 (15%), Positives = 71/197 (36%), Gaps = 24/197 (12%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-----EDAGY------VMKGEF 66
            + +    A     +  ++++      ++ T +G F+Q        G          G+F
Sbjct: 2   AAGLVSLAAWSAGAQAGAIEQLNAFVNNVTTARGEFVQRQVKGGANGSPLRVAGTSSGDF 61

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQH 122
             +RP +F ++Y  P    L +DG  + +Y+  L   +       L     +++F +N  
Sbjct: 62  AFSRPGRFIWRYVKPYEQQLSADGQMLYIYDKDLSQVTERKLDASLGSSPAAILFGSN-D 120

Query: 123 VIQESIQRVESNNSFI-----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
           + +  + +       I     T   KD      +++ F      L   ++ D+    +++
Sbjct: 121 LAKNFVLKEGGTKDGIDWVELTPKAKDTQFE-RVAIGFRAG--ELEGMELRDAFGSTTLL 177

Query: 178 KILKYKENTVLDPKVFE 194
                ++N  L    F 
Sbjct: 178 TFSHIQKNPQLPASAFR 194


>gi|289666016|ref|ZP_06487597.1| outer-membrane lipoprotein carrier protein [Xanthomonas campestris
           pv. vasculorum NCPPB702]
 gi|289670477|ref|ZP_06491552.1| outer-membrane lipoprotein carrier protein [Xanthomonas campestris
           pv. musacearum NCPPB4381]
          Length = 209

 Score = 77.6 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 68/190 (35%), Gaps = 18/190 (9%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHF-LSIQTMQGTFLQE---DAGYV---MKGEFFMARPSK 73
                A    T     ++ ++ F   ++ + G F Q      G V     G   +A P +
Sbjct: 8   AVLATALLASTAIAGARQELDTFTRGLKGLDGQFSQRVTDANGKVKENSSGRVALATPRQ 67

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY---------PLRYMAFSVIFSNNQHVI 124
           F ++Y+ P    +++DG  + V++  L+  +V          PL  +    +      V 
Sbjct: 68  FRWEYAKPYKQLIVADGKKVWVFDPDLEQVTVRAQGSEEQNSPLVALINPALLDKKYDVS 127

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           +E+  R       +T     D    M S+ F +     +   ++D+  + + I    +K 
Sbjct: 128 EEAAPRDGLQWLSLTPKVDTDASFQMASLGFGKDGLAKME--VVDAVGQRTAISFSGWKR 185

Query: 185 NTVLDPKVFE 194
           N       F 
Sbjct: 186 NPAFAADTFR 195


>gi|330958180|gb|EGH58440.1| lipoprotein chaperone [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 207

 Score = 77.6 bits (190), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 35/205 (17%), Positives = 68/205 (33%), Gaps = 21/205 (10%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEFF 67
           +L   +  F   +A+  +KD  V +  +     QT+   F Q   +  G       GE  
Sbjct: 6   MLLATALTFSVISAHADSKD--VARLTQLLEKSQTLTARFSQLTLDGGGTQLQETAGEMA 63

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHV 123
           + RP  F +   +P    ++SDG  +++++  L+  ++  L          ++  +   +
Sbjct: 64  LQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTPALLLSGDVSKI 123

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSIIK 178
            +      +     I    K           FD L     N  I D        + + I 
Sbjct: 124 SESFDITAKEAGGVIDFVLKPKTKDT----LFDSLRLSFRNGVINDMQLIDSVGQRTNIL 179

Query: 179 ILKYKENTVLDPKVFEIPYDKIHNI 203
               K N  +    F     K  ++
Sbjct: 180 FTGVKANEPIPASKFRFDVPKGADV 204


>gi|161869555|ref|YP_001598722.1| periplasmic carrier protein [Neisseria meningitidis 053442]
 gi|161595108|gb|ABX72768.1| periplasmic carrier protein [Neisseria meningitidis 053442]
          Length = 256

 Score = 77.6 bits (190), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 34/201 (16%), Positives = 67/201 (33%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 56  LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 115

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+SP   +++ DG  + +Y+  L   +             + I SN   +   
Sbjct: 116 PGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSP-AAILSNKTALESS 174

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 175 YTLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 232

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             N  L    F+    K  ++
Sbjct: 233 NTNPQLSRGAFKFTPPKGVDV 253


>gi|296314994|ref|ZP_06864935.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           polysaccharea ATCC 43768]
 gi|296838194|gb|EFH22132.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           polysaccharea ATCC 43768]
          Length = 207

 Score = 77.6 bits (190), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 34/201 (16%), Positives = 67/201 (33%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     +    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCSLTVSVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+SP   +++ DG  + +Y+  L   +               I SN   +   
Sbjct: 67  PGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPA-AILSNKTALESS 125

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 126 YTLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 183

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             N  L   VF+    K  ++
Sbjct: 184 NTNPQLSRGVFKFTPPKGVDV 204


>gi|126642760|ref|YP_001085744.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii ATCC 17978]
          Length = 210

 Score = 77.6 bits (190), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/208 (16%), Positives = 75/208 (36%), Gaps = 26/208 (12%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK---------------- 63
           +   F A     + Q++   +     +Q +   F Q                        
Sbjct: 2   STTAFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKANTKTVAQKKGLSAQHMNQTF 61

Query: 64  -GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFS 118
            G   + RP KFY++  SPS  ++++ G  + +Y+  L       L          ++  
Sbjct: 62  KGSMKVERPGKFYWETVSPSKQTIVTSGKTVWIYDPDLQQAVRQSLDDQVADTPALLLSG 121

Query: 119 N-NQHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDR-LSYRLLNWKIMDSSRRYS 175
           N NQ +    + + + +  + T+F  K+D     ++++F    +  L+   + DS  + +
Sbjct: 122 NTNQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFGANKAPTLM--VLQDSLGQTT 179

Query: 176 IIKILKYKENTVLDPKVFEIPYDKIHNI 203
            ++    K N  +    F     K  +I
Sbjct: 180 YVRFKNVKVNASIPASTFNFTPPKGTDI 207


>gi|325273412|ref|ZP_08139667.1| lipoprotein chaperone [Pseudomonas sp. TJI-51]
 gi|324101457|gb|EGB99048.1| lipoprotein chaperone [Pseudomonas sp. TJI-51]
          Length = 207

 Score = 77.3 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/199 (16%), Positives = 68/199 (34%), Gaps = 19/199 (9%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEFFMARPSK 73
           +     +      +Q V++  +     QT++  F Q      G       G+  + RP  
Sbjct: 10  SALTLGSVTAYAGEQDVQRLTQLLEKSQTIEANFSQLTLGADGTSLQETSGKMTVKRPGL 69

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQESIQ 129
           FY+   +P    ++SDG N+ +++  L+  ++      L     +++ S +   I +S  
Sbjct: 70  FYWHTDAPQEQVVVSDGKNVTLWDPDLEQATIKKLDVRLNQTP-ALLLSGDVSKISQSFD 128

Query: 130 RVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSIIKILKYKE 184
                   +  F       + +   FD L        I D        + + I     K 
Sbjct: 129 ITSKEQGEVMDFTLKPKTKDTL---FDSLRVSFRKGLINDMQLIDSVGQRTNILFNGVKA 185

Query: 185 NTVLDPKVFEIPYDKIHNI 203
           N  +    F+    K  ++
Sbjct: 186 NQAVPDSRFKFDIPKGADV 204


>gi|309378974|emb|CBX22427.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 206

 Score = 77.3 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 34/201 (16%), Positives = 67/201 (33%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     +    +  +V    +       + G+F Q            G F + R
Sbjct: 6   LFQFLAVCSLTVSVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 65

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+SP   +++ DG  + +Y+  L   +               I SN   +   
Sbjct: 66  PGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPA-AILSNKTALESS 124

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 125 YTLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 182

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             N  L   VF+    K  ++
Sbjct: 183 NTNPQLSRGVFKFTPPKGVDV 203


>gi|262371906|ref|ZP_06065185.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           junii SH205]
 gi|262311931|gb|EEY93016.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           junii SH205]
          Length = 231

 Score = 77.3 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 83/227 (36%), Gaps = 26/227 (11%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-- 58
           +  + Y + IG + L    +     A    +  Q+    ++    +Q +   F Q     
Sbjct: 4   VKKMAYAATIGAMTLAPVVSTQLSAAPTAASAQQATSSLVKQLSGLQRLTADFEQTTKVT 63

Query: 59  ---------------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW 103
                              KG   + RP KFY++ +SP+  ++++ G  + +Y+  L   
Sbjct: 64  NSKPSKNKSLTAQHMNQTFKGTMKVERPGKFYWETTSPAKQTIVTTGKLVWIYDPDLQQA 123

Query: 104 SVYPLR----YMAFSVIFSN-NQHVIQESIQRVESNNSFITIFFKD-DFMGNMISVTFDR 157
               L          ++  N NQ +    + + +    + T++ K  D     ++++F  
Sbjct: 124 VRQSLDDQIANTPALLLSGNTNQIMQSYRVTQPDRTKLYYTLYPKQEDSAFQSMTISFGA 183

Query: 158 -LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
             +  L+   + DS  + + ++    K N  +   VF     K  +I
Sbjct: 184 NKAPNLM--ILQDSLGQTTYVRFSNIKVNPKIPASVFNFAPPKGTDI 228


>gi|325982388|ref|YP_004294790.1| outer membrane lipoprotein carrier protein LolA [Nitrosomonas sp.
           AL212]
 gi|325531907|gb|ADZ26628.1| outer membrane lipoprotein carrier protein LolA [Nitrosomonas sp.
           AL212]
          Length = 207

 Score = 77.3 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/180 (14%), Positives = 63/180 (35%), Gaps = 18/180 (10%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQE--DAGYV----MKGEFFMARPSKFYFKYSSPSS 83
           + +  ++          +T++  F Q   D          G     RP KF + Y  P  
Sbjct: 19  LAEATAINSLKTFIHETRTVRAKFSQTLYDKNSRAIQESTGTMQFERPEKFRWTYEEPYE 78

Query: 84  VSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVI-----FSNNQHVIQESIQRVESN 134
             ++ +G+ +  Y+  L+  ++      +     +++       +N  +++  +Q     
Sbjct: 79  QLIVGNGTQVWFYDPDLNQVTIRQFSIAIGSSPAALLAGSSTIEDNFELVELGMQNEMEW 138

Query: 135 NSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
              I    +  F    I + F      L    + DS  + + +   +  +N  L  ++F+
Sbjct: 139 LEAIPKSKESAFE--FIQMGFSPEG-ELKIMALRDSFGQTTFLSFSELDKNPTLPTELFK 195


>gi|298369429|ref|ZP_06980747.1| outer membrane lipoprotein carrier protein LolA [Neisseria sp. oral
           taxon 014 str. F0314]
 gi|298283432|gb|EFI24919.1| outer membrane lipoprotein carrier protein LolA [Neisseria sp. oral
           taxon 014 str. F0314]
          Length = 206

 Score = 77.3 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 30/200 (15%), Positives = 62/200 (31%), Gaps = 13/200 (6%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV----MKGEFFMAR 70
           L  + A    +    + +  +V    +       + G+F Q            G F + R
Sbjct: 6   LLKFLAAAGLSITVGLAQAGAVDALKKFNNDSDGISGSFSQTVKSKKKTQTTNGTFQILR 65

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS---VIFSNNQHVIQES 127
           P  F ++Y+ P   +++ DG  I +Y+  L   +              I SN   +    
Sbjct: 66  PGLFKWEYTKPYKQTIVGDGKTIWLYDVDLAQVTKSAQDQTIGDSPAAILSNKTALDSSY 125

Query: 128 IQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
             + +  ++ I+         N     I + F   +   +   + D     + I      
Sbjct: 126 ALKEDGASNGISYVLATPKKNNAGYQYIRIGFKGDNLAAMQ--LKDGFGNETTISFSNLN 183

Query: 184 ENTVLDPKVFEIPYDKIHNI 203
               L    F+    K  ++
Sbjct: 184 TKPNLSRNAFKFTPPKGVDV 203


>gi|126667376|ref|ZP_01738348.1| outer-membrane lipoprotein carrier protein precursor [Marinobacter
           sp. ELB17]
 gi|126628132|gb|EAZ98757.1| outer-membrane lipoprotein carrier protein precursor [Marinobacter
           sp. ELB17]
          Length = 228

 Score = 77.3 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 37/214 (17%), Positives = 79/214 (36%), Gaps = 18/214 (8%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV 61
           L  ++  +++    +A    +      +  +  +        QT Q  F+Q    + G  
Sbjct: 13  LATALFAMILTSAATAAVSDDLQKEGLQKDAATQLAALLRGYQTYQADFIQIVVGNGGER 72

Query: 62  MK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFS 114
           ++   G     RP  FY++  +P +  ++S+G  ++VY+  L+  +V+ L          
Sbjct: 73  VQESHGSMKAKRPGFFYWESKAPMAQHIVSNGDEVSVYDPDLEQVTVHKLNSDVQATPAL 132

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISV-----TFDRLSYRLLNWKIMD 169
           ++     ++ Q            I  F       + + V      FD    +L   ++ D
Sbjct: 133 LLSGEVDNLAQTYDVSTRRVGDNIREFTLTPKSPDSLFVALRMSFFDG---QLQEMRMED 189

Query: 170 SSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           S  + SI+       N  +   VF++ Y    +I
Sbjct: 190 SLSQISILSFDDIVLNADIAASVFKLDYPAGVDI 223


>gi|285018236|ref|YP_003375947.1| outer-membrane lipoprotein carrier protein precursor [Xanthomonas
           albilineans GPE PC73]
 gi|283473454|emb|CBA15959.1| probable outer-membrane lipoprotein carrier protein precursor
           [Xanthomonas albilineans]
          Length = 208

 Score = 77.3 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/165 (16%), Positives = 57/165 (34%), Gaps = 17/165 (10%)

Query: 45  SIQTMQGTFLQ---EDAGY---VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNA 98
            ++ + G F Q   +  G       G   ++ P  F ++Y  P S  +++DGS + VY+ 
Sbjct: 33  GLKGLDGQFAQKVYDGKGTLKESSSGRLALSAPRLFRWEYRKPYSQLIVADGSKVWVYDP 92

Query: 99  KLDTWSVYPLR----YMAFSVI-----FSNNQHVIQESIQRVESNNSFITIFFKDDFMGN 149
            L   +V            + +           V +E++ R       +T     +    
Sbjct: 93  DLKQATVRTQGAEEQNSPLTALIDPGKLDRQYDVSEEAVARDGLQWLTMTPKVGTEANFQ 152

Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
           +  + FD      +   ++D   + + I    ++ N       F 
Sbjct: 153 LAKLGFDGKGLARME--VVDPVGQRTEISFSGWERNPRFTAGTFR 195


>gi|261364217|ref|ZP_05977100.1| outer membrane lipoprotein carrier protein LolA [Neisseria mucosa
           ATCC 25996]
 gi|288567830|gb|EFC89390.1| outer membrane lipoprotein carrier protein LolA [Neisseria mucosa
           ATCC 25996]
          Length = 207

 Score = 77.3 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 34/200 (17%), Positives = 63/200 (31%), Gaps = 13/200 (6%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF   A     A     +  +V    +       + G+F Q   G        G F + R
Sbjct: 7   LFKLLAASALTATIGFAQAGAVDALKKFNNDADGISGSFTQTVQGKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS---VIFSNNQHVIQES 127
           P  F ++Y+ P   +++ DG  I +Y+  L   +              I SN   +    
Sbjct: 67  PGLFKWEYTKPYKQTIVGDGQTIWLYDVDLAQVTKSAQDQTIGDSPAAILSNKTALDSSY 126

Query: 128 IQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
             + + +++ I          N     I + F   +   +   + DS    + I      
Sbjct: 127 SLKEDGSSNGIDYVLATPKKNNAGYQYIRIGFKGDNLAAMQ--LKDSFGNQTSITFGSLN 184

Query: 184 ENTVLDPKVFEIPYDKIHNI 203
               L    F+    K  ++
Sbjct: 185 TKPNLSRGAFKFTPPKGVDV 204


>gi|325203715|gb|ADY99168.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis M01-240355]
          Length = 207

 Score = 77.3 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 34/201 (16%), Positives = 66/201 (32%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+SP   +++ DG  + +Y+  L   +               I SN   +   
Sbjct: 67  PGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPA-AILSNKTALESS 125

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 126 YTLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 183

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             N  L    F+    K  ++
Sbjct: 184 NTNPQLSRGAFKFTPPKGVDV 204


>gi|316985278|gb|EFV64229.1| outer membrane lipocarrier protein LolA [Neisseria meningitidis
           H44/76]
          Length = 235

 Score = 77.3 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 65/201 (32%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 35  LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 94

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+ P   +++ DG  + +Y+  L   +               I SN   +   
Sbjct: 95  PGLFKWEYTKPYRQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPA-AILSNKTALESS 153

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 154 YTLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 211

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             N  L    F+    K  ++
Sbjct: 212 NTNPQLSRGAFKFTPPKGVDV 232


>gi|15676525|ref|NP_273666.1| outer membrane lipoprotein carrier protein [Neisseria meningitidis
           MC58]
 gi|9977680|sp|P57068|LOLA_NEIMB RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|7225852|gb|AAF41048.1| outer membrane lipoprotein carrier protein [Neisseria meningitidis
           MC58]
 gi|325133862|gb|EGC56518.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis M13399]
 gi|325139826|gb|EGC62358.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis CU385]
 gi|325200691|gb|ADY96146.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis H44/76]
          Length = 207

 Score = 77.3 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 65/201 (32%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+ P   +++ DG  + +Y+  L   +               I SN   +   
Sbjct: 67  PGLFKWEYTKPYRQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPA-AILSNKTALESS 125

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 126 YTLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 183

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             N  L    F+    K  ++
Sbjct: 184 NTNPQLSRGAFKFTPPKGVDV 204


>gi|171463820|ref|YP_001797933.1| outer membrane lipoprotein carrier protein LolA [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|171193358|gb|ACB44319.1| outer membrane lipoprotein carrier protein LolA [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 227

 Score = 77.3 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 77/223 (34%), Gaps = 40/223 (17%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---- 56
           M+  L  +++ +  + F               +   ++  +   + +T +G F+Q+    
Sbjct: 1   MSRFLISAILAIANILFSGTAL-------SQSESGAEQLRQFVRNSKTAEGDFIQQQLRA 53

Query: 57  -------DAG----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV 105
                  D G       +G F   RP +F +    P    L++DG  + +++  L+  ++
Sbjct: 54  PKANEPQDKGLKVVRQTQGHFVFQRPGRFIWDTQKPYEQKLVADGKQLILWDKDLNQATL 113

Query: 106 YP----LRYMAFSVI-----FSNNQHVIQESIQRVESNNSFITIFF-----KDDFMGNMI 151
            P    L     +++        +  +++   +      S I         K+D     +
Sbjct: 114 RPAGQALASTPAAILFGETSLEQHFDLVEGEERLGMKWVSLIPKRDPGAKNKNDLPYTKV 173

Query: 152 SV-TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
           S+   + L   L    + D      ++ + K + N  L    F
Sbjct: 174 SIGMANGLPKALE---LTDGLGSVVLVALDKIQLNVNLPANRF 213


>gi|148547065|ref|YP_001267167.1| outer-membrane lipoprotein carrier protein [Pseudomonas putida F1]
 gi|47117215|sp|Q88FS9|LOLA_PSEPK RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|166230496|sp|A5W1H3|LOLA_PSEP1 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|148511123|gb|ABQ77983.1| outer membrane lipoprotein carrier protein LolA [Pseudomonas putida
           F1]
          Length = 207

 Score = 77.3 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/199 (16%), Positives = 68/199 (34%), Gaps = 19/199 (9%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEFFMARPSK 73
           +     +      +Q V++  +     QT++  F Q      G       G+  + RP  
Sbjct: 10  SALTLGSVTAYAGEQDVQRLTQLLEKSQTIEANFSQLTLGADGTSLQETSGKMTVKRPGL 69

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQESIQ 129
           FY+   +P    ++SDG N+ +++  L+  ++      L     +++ S +   I +S  
Sbjct: 70  FYWHTDAPQEQVVVSDGKNVTLWDPDLEQATIKKLDVRLNQTP-ALLLSGDVSKISQSFD 128

Query: 130 RVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSIIKILKYKE 184
                   +  F       + +   FD L        I D        + + I     K 
Sbjct: 129 IASKEQGEVMDFTLKPKTKDTL---FDSLRVSFRKGLINDMQLIDSVGQRTNILFNGVKA 185

Query: 185 NTVLDPKVFEIPYDKIHNI 203
           N  +    F+    K  ++
Sbjct: 186 NQAVPDSKFKFDIPKGADV 204


>gi|26990708|ref|NP_746133.1| outer-membrane lipoprotein carrier protein [Pseudomonas putida
           KT2440]
 gi|24985701|gb|AAN69597.1|AE016593_5 outer membrane lipoprotein carrier protein [Pseudomonas putida
           KT2440]
          Length = 228

 Score = 77.3 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/199 (16%), Positives = 68/199 (34%), Gaps = 19/199 (9%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEFFMARPSK 73
           +     +      +Q V++  +     QT++  F Q      G       G+  + RP  
Sbjct: 31  SALTLGSVTAYAGEQDVQRLTQLLEKSQTIEANFSQLTLGADGTSLQETSGKMTVKRPGL 90

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQESIQ 129
           FY+   +P    ++SDG N+ +++  L+  ++      L     +++ S +   I +S  
Sbjct: 91  FYWHTDAPQEQVVVSDGKNVTLWDPDLEQATIKKLDVRLNQTP-ALLLSGDVSKISQSFD 149

Query: 130 RVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSIIKILKYKE 184
                   +  F       + +   FD L        I D        + + I     K 
Sbjct: 150 IASKEQGEVMDFTLKPKTKDTL---FDSLRVSFRKGLINDMQLIDSVGQRTNILFNGVKA 206

Query: 185 NTVLDPKVFEIPYDKIHNI 203
           N  +    F+    K  ++
Sbjct: 207 NQAVPDSKFKFDIPKGADV 225


>gi|330815818|ref|YP_004359523.1| Outer membrane lipoprotein carrier protein LolA [Burkholderia
           gladioli BSR3]
 gi|327368211|gb|AEA59567.1| Outer membrane lipoprotein carrier protein LolA [Burkholderia
           gladioli BSR3]
          Length = 227

 Score = 76.9 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/225 (13%), Positives = 72/225 (32%), Gaps = 28/225 (12%)

Query: 2   AFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------ 55
           +F+ + +V   V     +++    +           +       ++T +G F Q      
Sbjct: 5   SFVQFPAVRRFVAALAGASLMAVASQAFAGG---TDQLKAFIAQVKTAKGGFTQQIVKAP 61

Query: 56  --EDAGYV--------MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV 105
               +G +          G F  +RP +F + Y  P    L +DG  + VY+  L+  + 
Sbjct: 62  SKGASGAMPTVKPTDNSSGTFVFSRPGRFVWSYEKPYQQLLQADGDTLYVYDKDLNQVTE 121

Query: 106 YPLR----YMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGN---MISVTFDRL 158
             L         +++F +N      +++          +  +          I + F   
Sbjct: 122 RKLSGALGASPAAILFGSNDIEKNYTLRDAGEKGGIDWVEMQPKSQDTQFQRIGIGFKGG 181

Query: 159 SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           +   +   + D     +++     + N  L    F     K  ++
Sbjct: 182 TLAAME--LHDVFGNVTLLTFTNMQTNPALPADTFRFAVPKGADV 224


>gi|313498108|gb|ADR59474.1| LolA [Pseudomonas putida BIRD-1]
          Length = 207

 Score = 76.9 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/199 (16%), Positives = 68/199 (34%), Gaps = 19/199 (9%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEFFMARPSK 73
           +     +      +Q V++  +     QT++  F Q      G       G+  + RP  
Sbjct: 10  SALTLGSVTAFAGEQDVQRLTQLLEKSQTIEANFSQLTLGADGTSLQETSGKMTVKRPGL 69

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQESIQ 129
           FY+   +P    ++SDG N+ +++  L+  ++      L     +++ S +   I +S  
Sbjct: 70  FYWHTDAPQEQVVVSDGKNVTLWDPDLEQATIKKLDVRLNQTP-ALLLSGDVSKISQSFD 128

Query: 130 RVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSIIKILKYKE 184
                   +  F       + +   FD L        I D        + + I     K 
Sbjct: 129 IASKEQGEVMDFTLKPKTKDTL---FDSLRVSFRKGLINDMQLIDSVGQRTNILFNGVKA 185

Query: 185 NTVLDPKVFEIPYDKIHNI 203
           N  +    F+    K  ++
Sbjct: 186 NQAVPDSKFKFDIPKGADV 204


>gi|264677022|ref|YP_003276928.1| outer membrane lipoprotein carrier protein LolA [Comamonas
           testosteroni CNB-2]
 gi|262207534|gb|ACY31632.1| outer membrane lipoprotein carrier protein LolA [Comamonas
           testosteroni CNB-2]
          Length = 211

 Score = 76.9 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 34/204 (16%), Positives = 67/204 (32%), Gaps = 22/204 (10%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE----------DAGYVMKGEFFMA 69
           AI    +A     D  +K       + Q  +  F Q               V  G F   
Sbjct: 7   AILIAGSASAAMADG-LKSLESFMKNAQAGKADFTQSVTSPPKSGQEARTKVSSGSFEFQ 65

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFS--NNQHV 123
           RP KF F Y+ P    +++DG  + +Y+A L+  +       L     +++ S  + + +
Sbjct: 66  RPGKFRFNYTKPFEQLIVADGKTLWLYDADLNQVTERAQAQVLGSTPAAILTSATDLKAL 125

Query: 124 IQESIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
             +     + +   +                + + F     +L    I DS  + S+++ 
Sbjct: 126 KADFELGNQPDADGLEWVLASPRQKGGQLKSVRIGFTPEG-KLAALDIEDSFGQRSLMQF 184

Query: 180 LKYKENTVLDPKVFEIPYDKIHNI 203
              +    L    F     K  ++
Sbjct: 185 KGLQTQASLPASTFHFTVPKGADV 208


>gi|293610925|ref|ZP_06693224.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826577|gb|EFF84943.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 231

 Score = 76.9 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/218 (16%), Positives = 79/218 (36%), Gaps = 26/218 (11%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------ 63
           +   +L    +   F A     + Q++   +     +Q +   F Q              
Sbjct: 13  LSASVLAPVMSTTVFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKANTKTVAQKKS 72

Query: 64  -----------GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR--- 109
                      G   + RP KFY++  SP+  ++++ G  + +Y+  L       L    
Sbjct: 73  LSAQHMNQTFKGSMKVERPGKFYWETVSPAKQTIVTSGKTVWIYDPDLQQAVRQNLDDQV 132

Query: 110 -YMAFSVIFSN-NQHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDR-LSYRLLNW 165
                 ++  N NQ +    + + + +  + T+F  K+D     ++++F    +  L+  
Sbjct: 133 ADTPALLLSGNTNQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFGANKAPTLM-- 190

Query: 166 KIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            + DS  + + ++    K N  +   VF     K  ++
Sbjct: 191 VLQDSLGQTTYVRFKNVKVNASIPASVFNFTPPKGTDV 228


>gi|78485110|ref|YP_391035.1| outer membrane lipoprotein carrier protein LolA [Thiomicrospira
           crunogena XCL-2]
 gi|78363396|gb|ABB41361.1| outer membrane lipoprotein carrier protein LolA [Thiomicrospira
           crunogena XCL-2]
          Length = 217

 Score = 76.5 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 32/203 (15%), Positives = 68/203 (33%), Gaps = 21/203 (10%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY---- 60
             K ++  +++    A    ++A   +    +        ++ T    F Q         
Sbjct: 6   PIKKIMSGLVMVCVLASPVLSSA---SDRAKLSDLNAFVANLNTFSAKFEQTQPDESLFA 62

Query: 61  --VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFS 114
                G F M RP +  + Y  P    +ISDG N+ VY+  LD  +V  L  +      S
Sbjct: 63  MNRSTGYFSMKRPGQLLWVYEKPEPQKIISDGRNVWVYDVDLDQATVRALANVEADFPLS 122

Query: 115 VIFSNNQHVIQESIQRVESNNSF----ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
            +        + +I      +      +T      F    +++  D    ++  W   ++
Sbjct: 123 WLLYKEPLSERFNIIPGSIKDGVSWYNLTPKEGTFFQSLEVAIA-DGKMVQI--WMYQNA 179

Query: 171 SRRYSIIKILKYKENTVLDPKVF 193
               + +     ++N  +  + F
Sbjct: 180 DNV-TKVVFNDIRQNQPVRDQQF 201


>gi|77459807|ref|YP_349314.1| outer-membrane lipoprotein carrier protein [Pseudomonas fluorescens
           Pf0-1]
 gi|123744678|sp|Q3KA81|LOLA_PSEPF RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|77383810|gb|ABA75323.1| outer-membrane lipoprotein carrier protein [Pseudomonas fluorescens
           Pf0-1]
          Length = 206

 Score = 76.5 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/188 (15%), Positives = 66/188 (35%), Gaps = 19/188 (10%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEFFMARPSKFYFKYSSPSSV 84
             D+ V +  +   + +T+   F Q   + +G       G+  + RP  FY+  ++P+  
Sbjct: 20  ADDKDVARLTQLLETSKTLTANFSQLTLDGSGTQLQETTGDMTLQRPGLFYWHTNAPAEQ 79

Query: 85  SLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQESIQRVESNNSFITI 140
           +++SDG  + +++  L+  ++  L          ++  +   + Q      +     I  
Sbjct: 80  TMVSDGKKVTLWDPDLEQATIKKLDERLTQTPALLLSGDVSKISQSFDITAKEAGGVIDF 139

Query: 141 FFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSIIKILKYKENTVLDPKVFEI 195
             K           FD L     N  + D        + + I     K N  +    F+ 
Sbjct: 140 TLKPKTKDT----LFDSLRLSFRNGLVNDMQLIDSVGQRTNILFTGVKANEAVPASKFKF 195

Query: 196 PYDKIHNI 203
              K  ++
Sbjct: 196 DIPKGADV 203


>gi|313668892|ref|YP_004049176.1| outer-membrane lipoprotein carrier protein [Neisseria lactamica
           ST-640]
 gi|313006354|emb|CBN87817.1| outer-membrane lipoprotein carrier protein [Neisseria lactamica
           020-06]
          Length = 207

 Score = 76.5 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 34/201 (16%), Positives = 67/201 (33%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     +    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCFLTVSVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+SP   +++ DG  + +Y+  L   +               I SN   +   
Sbjct: 67  PGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPA-AILSNKTALESS 125

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 126 YTLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 183

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             N  L   VF+    K  ++
Sbjct: 184 NTNPQLSRGVFKFTPPKGVDV 204


>gi|157965024|ref|YP_001499848.1| Outer membrane lipoprotein-sorting protein LolA [Rickettsia
           massiliae MTU5]
 gi|157844800|gb|ABV85301.1| Outer membrane lipoprotein-sorting protein LolA [Rickettsia
           massiliae MTU5]
          Length = 226

 Score = 76.5 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/196 (15%), Positives = 85/196 (43%), Gaps = 6/196 (3%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGE 65
           K +  ++I++ +      + A+ +    ++ +   +  +I+++   F QED+   ++KG+
Sbjct: 16  KKIFFLIIIYLF---VNSSLAFGVDDKTAISELKTYLRTIKSVAIDFTQEDSYSKIVKGK 72

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQ 125
             + +P  F + Y  P  + +I   + +++Y+  ++  S        F+ +  +N+H  +
Sbjct: 73  LLIHKPYNFRYNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENTFNFLLEDNEHFDK 132

Query: 126 ESI-QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           + I + V +  +   I            +TF++ + ++   KI +       I   K  +
Sbjct: 133 DFIFESVINERNISKITIYHTLTEKRSEITFNKATQQIEALKIFED-NNIVTITFDKIAK 191

Query: 185 NTVLDPKVFEIPYDKI 200
                  +F++   +I
Sbjct: 192 VQKFSDDLFKLKNPEI 207


>gi|258546041|ref|ZP_05706275.1| outer membrane lipoprotein carrier protein LolA [Cardiobacterium
           hominis ATCC 15826]
 gi|258518698|gb|EEV87557.1| outer membrane lipoprotein carrier protein LolA [Cardiobacterium
           hominis ATCC 15826]
          Length = 286

 Score = 76.5 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/190 (18%), Positives = 73/190 (38%), Gaps = 28/190 (14%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV----MKGEFFMARPSKFYFKYSSPS 82
           A P   + +   A       + +Q  F Q           +G+ ++A+P KFY+ Y  P+
Sbjct: 91  AAPAAPEGNALDA--FMRGTKDLQANFTQTIYNKRGTETSEGKMWVAKPGKFYWDYQRPN 148

Query: 83  SVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSV---IFSNNQHVIQESIQRVESNNSFIT 139
              +IS+G  +  Y+  L+  SV     +   V   + +   +V +    +VE     + 
Sbjct: 149 PQKIISNGKKVYHYDIDLEQISVRSRSELVGDVAVELLNGEDNVSRN--YKVERTVKNLA 206

Query: 140 IFFKDDFMGNMISVTFDRLSYR-----LLNWKIMDSS----------RRYSIIKILKYKE 184
                 ++G+ +S      +++     L  W ++D +             +I+     K 
Sbjct: 207 PARLQKYIGSGVSYRLKPKTHQEEYDAL--WVVLDGNAITAVMIDGGGTQTILTFSDMKR 264

Query: 185 NTVLDPKVFE 194
           N+ +  K FE
Sbjct: 265 NSGIPAKQFE 274


>gi|209520406|ref|ZP_03269168.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           H160]
 gi|209499143|gb|EDZ99236.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           H160]
          Length = 240

 Score = 76.5 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 37/228 (16%), Positives = 76/228 (33%), Gaps = 39/228 (17%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ--------- 55
           L + + G V +     +     A    + ++          + + +GTF+Q         
Sbjct: 20  LARKIAGSVAVGASLLVASHAFASGTEQLKA------FVAQVHSARGTFVQQEVRAPNKA 73

Query: 56  -----------EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS 104
                              G F  ARP KF ++Y  P +  L +DG  + VY+  L+  +
Sbjct: 74  QGASDALSTANVGKPTTSSGTFMFARPGKFIWQYEKPYAQLLQADGDKLYVYDKDLNQVT 133

Query: 105 VYPLRY----MAFSVI-----FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTF 155
           V  L         +++        N  +    ++    +   +T   KD      + + F
Sbjct: 134 VRALGNALGASPAAILFGSNDLDKNFTLRDAGVKAG-IDWLELTPKAKDTQFE-RVGIGF 191

Query: 156 DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
                 L   ++ D     +++     ++N  L P  F+    K  ++
Sbjct: 192 --KDGNLEAMELHDVFGNVTLLTFSNIQKNPQLPPDAFKFTVPKGADV 237


>gi|148652700|ref|YP_001279793.1| outer membrane lipoprotein carrier protein LolA [Psychrobacter sp.
           PRwf-1]
 gi|148571784|gb|ABQ93843.1| outer membrane lipoprotein carrier protein LolA [Psychrobacter sp.
           PRwf-1]
          Length = 238

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 80/224 (35%), Gaps = 24/224 (10%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKD--QSVKKAIEHFLSIQTMQGTFLQEDA 58
           M  ++  ++ G +I           A      D   + K+      + ++M   F Q   
Sbjct: 15  MKNIMGTALSGALIFGMPMMAVSQAAQAATAADNLTAAKRLNALLANTKSMTANFTQTTK 74

Query: 59  G------------YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV- 105
           G                G   + RP+KF +  +SP    +++DGS + VY+  L   +  
Sbjct: 75  GANGGKSGLSAKNGTFSGNMSLQRPNKFRWNITSPFEQQIVTDGSAMWVYDKDLQQATRQ 134

Query: 106 ---YPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKDDFMG-NMISVTF-DRLS 159
                L      ++  +   +     I + ++  ++  ++ K      N ++V+F     
Sbjct: 135 NADQQLGNTPALLLSGDPSKIASNFKITQPDAKKNYYVLYPKASGSNFNSLAVSFNGGKP 194

Query: 160 YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
             +    + DS  + + IK    K N  ++   F+    K  +I
Sbjct: 195 IMM---VLNDSLGQVTSIKFSNVKVNPSINSSQFKFTPPKGVDI 235


>gi|166712094|ref|ZP_02243301.1| outer-membrane lipoprotein carrier protein [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 209

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 32/190 (16%), Positives = 66/190 (34%), Gaps = 18/190 (9%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHF-LSIQTMQGTFLQE---DAGYV---MKGEFFMARPSK 73
                A +  T     ++ ++ F   ++ + G F Q      G V     G   +A P +
Sbjct: 8   AVLATALFASTAFAGARQELDTFTRGLKGLDGQFSQRVTDANGKVKENSSGRVALATPRQ 67

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAF-----SVIFSNNQHVI 124
           F ++Y+ P    +++DG  + V++  L+  +V                   +      V 
Sbjct: 68  FRWEYAKPYRQLIVADGKKVWVFDPDLEQVTVRAQGSEEQNSPLVPLINPALLDKKYDVS 127

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           +E+  R       +T     D    M S+ F +     +   ++D+  + + I    +K 
Sbjct: 128 EEAAPRDGLQWLSLTPKVDTDASFQMASLGFGKDGLAKME--VVDAVGQRTAISFSGWKR 185

Query: 185 NTVLDPKVFE 194
           N       F 
Sbjct: 186 NPTFAADTFR 195


>gi|319942657|ref|ZP_08016964.1| hypothetical protein HMPREF9464_02183 [Sutterella wadsworthensis
           3_1_45B]
 gi|319803740|gb|EFW00675.1| hypothetical protein HMPREF9464_02183 [Sutterella wadsworthensis
           3_1_45B]
          Length = 219

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 39/210 (18%), Positives = 70/210 (33%), Gaps = 27/210 (12%)

Query: 4   LLYKSVIGVVILFFY-SAIFPFNAAYPITKDQSVK---KAIEHFLSIQTMQGTFLQEDAG 59
              +    ++       A  P   +    K  SV    +       +   +G F Q    
Sbjct: 5   FPRRRFFVLMGAALCACAFSPLGVSAEAVKTVSVDGSAQLEAFLSHVSAAEGAFRQRVVD 64

Query: 60  YV------MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLR 109
                    +G F   RP  F + Y  P    ++SDG  + +Y+  L   +V      L 
Sbjct: 65  RSGKLVNEAEGIFAFRRPGAFLWNYEKPWKQQVVSDGQTLWLYDEDLMQVTVKKVSDALG 124

Query: 110 YMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG-NMISVTFD----RLSYRLLN 164
               +V+F +          +  S    +T+  K+   G   + V FD      S  L  
Sbjct: 125 ATPAAVLFGSG---TLPKDWQTSSEAGAVTLTPKEPQAGFESVKVFFDASGNPDSMSLR- 180

Query: 165 WKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
               D+  + + +K L++K    ++P  F 
Sbjct: 181 ----DTFGQTTEVKFLRFKALEQMNPDRFR 206


>gi|70731238|ref|YP_260979.1| outer-membrane lipoprotein carrier protein [Pseudomonas fluorescens
           Pf-5]
 gi|123654456|sp|Q4K9V4|LOLA_PSEF5 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|68345537|gb|AAY93143.1| outer membrane lipoprotein carrier protein LolA [Pseudomonas
           fluorescens Pf-5]
          Length = 207

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 38/205 (18%), Positives = 72/205 (35%), Gaps = 21/205 (10%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEFF 67
           +L          +A+   KD  V +  +     QT+   F Q   + +G       GE  
Sbjct: 6   MLLLPVLAVTTLSAHADPKD--VARLTQLLEKSQTLTARFSQLTLDGSGTQLQETAGEMS 63

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHV 123
           + RP  FY+   +P    ++SDG  +++++  L+  ++  L         +++ S +   
Sbjct: 64  LQRPGLFYWHTDAPQEQLMVSDGQKVSLWDPDLEQVTIKKLDQRLTQTP-ALLLSGDVSK 122

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSIIK 178
           I ES          +  F       + +   FD L     N  I D        + + I 
Sbjct: 123 ISESFDITSKEAGGVMDFTLKPKTRDTL---FDSLRLSFRNGMINDMQLIDSVGQRTNIL 179

Query: 179 ILKYKENTVLDPKVFEIPYDKIHNI 203
               K N  +    F+    K  ++
Sbjct: 180 FTGVKANEAIPASKFKFDIPKGADV 204


>gi|121634415|ref|YP_974660.1| putative periplasmic carrier protein [Neisseria meningitidis FAM18]
 gi|218767756|ref|YP_002342268.1| putative periplasmic carrier protein [Neisseria meningitidis Z2491]
 gi|254804505|ref|YP_003082726.1| outer membrane lipoprotein carrier protein [Neisseria meningitidis
           alpha14]
 gi|9977677|sp|P57067|LOLA_NEIMA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|166230493|sp|A1KSN0|LOLA_NEIMF RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|120866121|emb|CAM09860.1| putative periplasmic carrier protein [Neisseria meningitidis FAM18]
 gi|121051764|emb|CAM08070.1| putative periplasmic carrier protein [Neisseria meningitidis Z2491]
 gi|254668047|emb|CBA04479.1| outer membrane lipoprotein carrier protein [Neisseria meningitidis
           alpha14]
 gi|254670792|emb|CBA07125.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis alpha153]
 gi|261393009|emb|CAX50598.1| outer-membrane lipoprotein carrier protein [Neisseria meningitidis
           8013]
 gi|308388808|gb|ADO31128.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis alpha710]
 gi|319410009|emb|CBY90340.1| outer-membrane lipoprotein carrier protein [Neisseria meningitidis
           WUE 2594]
 gi|325129744|gb|EGC52553.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis OX99.30304]
 gi|325131926|gb|EGC54626.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis M6190]
 gi|325135783|gb|EGC58395.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis M0579]
 gi|325141870|gb|EGC64314.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis 961-5945]
 gi|325143992|gb|EGC66302.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis M01-240013]
 gi|325197836|gb|ADY93292.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis G2136]
 gi|325207666|gb|ADZ03118.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis NZ-05/33]
          Length = 207

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 66/201 (32%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     +    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCSLTVSVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+SP   +++ DG  + +Y+  L   +               I SN   +   
Sbjct: 67  PGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPA-AILSNKTALESS 125

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 126 YTLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 183

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             N  L    F+    K  ++
Sbjct: 184 NTNPQLSRGAFKFTPPKGVDV 204


>gi|325915379|ref|ZP_08177696.1| periplasmic chaperone LolA [Xanthomonas vesicatoria ATCC 35937]
 gi|325538426|gb|EGD10105.1| periplasmic chaperone LolA [Xanthomonas vesicatoria ATCC 35937]
          Length = 223

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/166 (17%), Positives = 61/166 (36%), Gaps = 17/166 (10%)

Query: 44  LSIQTMQGTFLQ--EDAG----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
             ++ + G F Q   DA         G   +++P +F ++Y+ P    +++DG  + V++
Sbjct: 46  RGLKGLDGQFNQQVTDANGRIKERSSGRVAVSQPRQFRWEYAKPYKQLIVADGKKVWVFD 105

Query: 98  AKLDTWSVYPLR----YMAFSVI-----FSNNQHVIQESIQRVESNNSFITIFFKDDFMG 148
             L+  +V              +           V +E+  R       +T     +   
Sbjct: 106 PDLEQVTVRAQGNEEQNSPLVALIDPARLDKQYDVSEEAAPRDGLQWLSLTPKVDTEASF 165

Query: 149 NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
            M S+ F +    L   +++D+  + + I    +K N    P  F 
Sbjct: 166 QMASLGFGKDG--LTKMEVVDAVGQRTAISFSGWKRNPAFAPDTFR 209


>gi|300690795|ref|YP_003751790.1| outer-membrane lipoprotein carrier protein precursor [Ralstonia
           solanacearum PSI07]
 gi|299077855|emb|CBJ50493.1| Outer-membrane lipoprotein carrier protein precursor [Ralstonia
           solanacearum PSI07]
          Length = 215

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/197 (15%), Positives = 71/197 (36%), Gaps = 24/197 (12%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-----EDAGY------VMKGEF 66
            + +    A     +  ++++      ++ T +G F+Q        G          G+F
Sbjct: 11  AAGLVSLAAWSAGAQAGAIEQLNAFVSNVSTARGEFVQRQVKGGANGSPLRVAGTSSGDF 70

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQH 122
             +RP +F ++Y  P    L +DG  + +Y+  L   +       L     +++F +N  
Sbjct: 71  VFSRPGRFVWRYMKPYEQQLSADGQVLYIYDKDLSQVTERKLDASLGSSPAAILFGSN-D 129

Query: 123 VIQESIQRVESNNSFI-----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
           + +  + +       I     T   KD      +++ F      L   ++ D+    +++
Sbjct: 130 LAKNFVLKEGGTKDGIDWVELTPKAKDTQFE-RVAIGFRAG--ELEGMELRDAFGNTTLL 186

Query: 178 KILKYKENTVLDPKVFE 194
                ++N  L    F 
Sbjct: 187 TFSHIQKNPQLPANAFR 203


>gi|71737139|ref|YP_275262.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|257485417|ref|ZP_05639458.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|298487531|ref|ZP_07005573.1| Outer-membrane lipoprotein carrier protein precursor [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|123635962|sp|Q48H71|LOLA_PSE14 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|71557692|gb|AAZ36903.1| outer membrane lipoprotein carrier protein LolA [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|298157915|gb|EFH98993.1| Outer-membrane lipoprotein carrier protein precursor [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|320323769|gb|EFW79853.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. glycinea str. B076]
 gi|320327910|gb|EFW83915.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. glycinea str. race 4]
 gi|330881212|gb|EGH15361.1| lipoprotein chaperone [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330889678|gb|EGH22339.1| lipoprotein chaperone [Pseudomonas syringae pv. mori str. 301020]
 gi|330987922|gb|EGH86025.1| lipoprotein chaperone [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331010746|gb|EGH90802.1| lipoprotein chaperone [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 207

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 38/205 (18%), Positives = 73/205 (35%), Gaps = 21/205 (10%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEFF 67
           +L   +  F   +A+  +KD  V +  +     QT+   F Q   +  G       GE  
Sbjct: 6   MLLATALTFSVMSAHADSKD--VARLTQLLEKSQTLTARFSQLTLDGGGTQLQETTGEMT 63

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHV 123
           + RP  F +   +P    ++SDG  +++++  L+  ++  L         +++ S +   
Sbjct: 64  LQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTP-ALLLSGDVSK 122

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSIIK 178
           I ES          +  F       + +   FD L     N  I D        + + I 
Sbjct: 123 ISESFDITAKEAGGVIDFVLKPKTKDTL---FDSLRLSFRNGIINDMQLIDSVGQRTNIL 179

Query: 179 ILKYKENTVLDPKVFEIPYDKIHNI 203
               K N  +    F+    K  ++
Sbjct: 180 FTGVKANEPVAASKFQFQIPKGADV 204


>gi|325127764|gb|EGC50673.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis N1568]
 gi|325137977|gb|EGC60552.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis ES14902]
          Length = 206

 Score = 76.1 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 66/201 (32%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     +    +  +V    +       + G+F Q            G F + R
Sbjct: 6   LFQFLAVCSLTVSVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 65

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+SP   +++ DG  + +Y+  L   +               I SN   +   
Sbjct: 66  PGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPA-AILSNKTALESS 124

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 125 YTLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 182

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             N  L    F+    K  ++
Sbjct: 183 NTNPQLSRGAFKFTPPKGVDV 203


>gi|289625406|ref|ZP_06458360.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. aesculi str. NCPPB3681]
 gi|289649311|ref|ZP_06480654.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. aesculi str. 2250]
 gi|330866857|gb|EGH01566.1| lipoprotein chaperone [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 207

 Score = 76.1 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/205 (17%), Positives = 69/205 (33%), Gaps = 21/205 (10%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEFF 67
           +L   +  F   +A+  +KD  V +  +     QT+   F Q   +  G       GE  
Sbjct: 6   MLLATALTFSVMSAHADSKD--VARLTQLLEKSQTLTARFSQLTLDGGGTQLQETTGEMT 63

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHV 123
           + RP  F +   +P    ++SDG  +++++  L+  ++  L          ++  +   +
Sbjct: 64  LQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTPALLLSGDVSKI 123

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSIIK 178
            +      +     I    K           FD L     N  I D        + + I 
Sbjct: 124 SESFDITAKEAGGVIDFVLKPKTRDT----LFDSLRLSFRNGIINDMQLIDSVGQRTNIL 179

Query: 179 ILKYKENTVLDPKVFEIPYDKIHNI 203
               K N  +    F+    K  ++
Sbjct: 180 FTGVKANEPVAASKFQFQIPKGADV 204


>gi|262369372|ref|ZP_06062700.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           johnsonii SH046]
 gi|262315440|gb|EEY96479.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           johnsonii SH046]
          Length = 232

 Score = 76.1 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 39/219 (17%), Positives = 83/219 (37%), Gaps = 27/219 (12%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA----------- 58
           +GVV L    +   F A    ++ Q+    ++    IQ++   F Q              
Sbjct: 13  VGVVTLGPVMSSTVFAAPVAASEQQATTSLVKQLSGIQSISSNFEQTTKVTNSSKAPKKQ 72

Query: 59  -------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-- 109
                      KG   + RP KFY++ +SP+  ++++ G  + +Y+  L       L   
Sbjct: 73  GLSAQHMNQTFKGVMKVERPGKFYWETTSPAKQTIVTSGKTVWIYDPDLQQAVRQTLDEQ 132

Query: 110 --YMAFSVIFSNNQHV-IQESIQRVESNNSFITIFFK-DDFMGNMISVTFDRLSY-RLLN 164
                  ++  N + +     I +   + ++ T++ K DD     ++++F   +   L+ 
Sbjct: 133 VANTPALLLSGNTEQIRKSYRITQPNQSKTYYTLYPKSDDGAFQSLTISFGAKNAPTLM- 191

Query: 165 WKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
             + DS  + + ++    K N  +    F     K  +I
Sbjct: 192 -ILEDSLGQTTYVRFNNTKVNINIPASTFNFTPPKGTDI 229


>gi|194097915|ref|YP_002000961.1| LolA [Neisseria gonorrhoeae NCCP11945]
 gi|193933205|gb|ACF29029.1| LolA [Neisseria gonorrhoeae NCCP11945]
 gi|317163676|gb|ADV07217.1| LolA [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 256

 Score = 76.1 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 66/201 (32%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 56  LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 115

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+ P   +++ DG  + +Y+  L   +             + I SN   +   
Sbjct: 116 PGLFKWEYTLPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSP-AAILSNKTALESS 174

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 175 YTLKEDGSSNGIDYVRATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 232

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             N  L    F+    K  ++
Sbjct: 233 NTNPQLSRGAFKFTPPKGVDV 253


>gi|325123241|gb|ADY82764.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 215

 Score = 76.1 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/214 (16%), Positives = 78/214 (36%), Gaps = 26/214 (12%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK---------- 63
           +L    +   F A     + Q++   +     +Q +   F Q                  
Sbjct: 1   MLAPVMSTTVFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKANTKTVAQKKSLSAQ 60

Query: 64  -------GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMA 112
                  G   + RP KFY++  SP+  ++++ G  + +Y+  L       L        
Sbjct: 61  HMNQTFKGSMKVERPGKFYWETVSPAKQTIVTSGKTVWIYDPDLQQAVRQSLDDQVADTP 120

Query: 113 FSVIFSN-NQHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDR-LSYRLLNWKIMD 169
             ++  N NQ +    + + + +  + T+F  K+D     ++++F    +  L+   + D
Sbjct: 121 ALLLSGNTNQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFGANKAPTLM--VLQD 178

Query: 170 SSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           S  + + ++    K N  +   VF     K  ++
Sbjct: 179 SLGQTTYVRFKNVKVNASIPASVFNFTPPKGTDV 212


>gi|255065089|ref|ZP_05316944.1| outer membrane lipoprotein carrier protein LolA [Neisseria sicca
           ATCC 29256]
 gi|255050510|gb|EET45974.1| outer membrane lipoprotein carrier protein LolA [Neisseria sicca
           ATCC 29256]
          Length = 207

 Score = 76.1 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 33/200 (16%), Positives = 63/200 (31%), Gaps = 13/200 (6%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF +       A     +  +V    +       + G+F Q   G        G F + R
Sbjct: 7   LFKFLTASALTATIGFAQAGAVDALKKFNNDADGISGSFTQTVQGKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS---VIFSNNQHVIQES 127
           P  F ++Y+ P   +++ DG  I +Y+  L   +              I SN   +    
Sbjct: 67  PGLFKWEYTKPYKQTIVGDGQTIWLYDVDLAQVTKSAQDQTIGDSPAAILSNKNALDSSY 126

Query: 128 IQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
             + + +++ I          N     I + F   +   +   + DS    + I      
Sbjct: 127 SLKEDGSSNGIDYVLATPKKNNAGYQYIRIGFKGDNLAAMQ--LKDSFGNQTSISFGGLN 184

Query: 184 ENTVLDPKVFEIPYDKIHNI 203
               L    F+    K  ++
Sbjct: 185 TKPNLSRGAFKFTPPKGVDV 204


>gi|261377960|ref|ZP_05982533.1| outer membrane lipoprotein carrier protein LolA [Neisseria cinerea
           ATCC 14685]
 gi|269145822|gb|EEZ72240.1| outer membrane lipoprotein carrier protein LolA [Neisseria cinerea
           ATCC 14685]
          Length = 207

 Score = 76.1 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 32/191 (16%), Positives = 60/191 (31%), Gaps = 13/191 (6%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A           +  +V    +       + G+F Q   G        G F + R
Sbjct: 7   LFKFLAASALTVTIGFAQAGAVDALKKFNNDADGISGSFTQTVQGKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS---VIFSNNQHVIQES 127
           P  F ++Y+ P   +++ DG  I +Y+  L   +              I SN   +    
Sbjct: 67  PGLFKWEYTKPYKQTIVGDGQTIWLYDVDLAQVTKSAQDQTIGDSPAAILSNKTALDSSY 126

Query: 128 IQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
             + + +++ I          N     I + F   +   +   + DS    + I      
Sbjct: 127 SLKEDGSSNGIDYVLATPKKNNAGYQYIRIGFKGDNLAAMQ--LKDSFGNQTSISFGSLN 184

Query: 184 ENTVLDPKVFE 194
               L    F+
Sbjct: 185 TKPNLSRGAFK 195


>gi|320106588|ref|YP_004182178.1| outer membrane lipoprotein carrier protein LolA [Terriglobus
           saanensis SP1PR4]
 gi|319925109|gb|ADV82184.1| outer membrane lipoprotein carrier protein LolA [Terriglobus
           saanensis SP1PR4]
          Length = 218

 Score = 76.1 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 30/204 (14%), Positives = 72/204 (35%), Gaps = 16/204 (7%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----Y 60
           + + V  + +   + AI P   A      +   +   H+  + +++  + +  +G     
Sbjct: 1   MKEKVRSLWLFCAFLAISPLLCAQSPDLHEIAGRVDAHYNHLTSLKLDYTERYSGMGQTR 60

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY---NAKLDTWSVYPLR--YMAFSV 115
           V  G   + +P +  + Y+SP+    I +      Y   + +    +   L         
Sbjct: 61  VETGTLLLKKPGRMRWNYASPAGKVFILNSKYAWFYTPGDPQAQRVAAKQLDDLRSPLRF 120

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMG-----NMISVTFDRLSYRLLNWKIMDS 170
           +    +  I++ +  +   +S  +   K    G     N +++  +  +  L   KI D+
Sbjct: 121 LLGRLK--IEKELTNLTIESSQNSAKIKGVPKGMEQRINAMTLACNTPTGILTGLKIEDA 178

Query: 171 SRRYSIIKILKYKENTVLDPKVFE 194
               +       +EN  L+   FE
Sbjct: 179 DGSITEFSFTNLQENVPLNDADFE 202


>gi|237800566|ref|ZP_04589027.1| lipoprotein chaperone [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331023426|gb|EGI03483.1| lipoprotein chaperone [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 207

 Score = 75.7 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/205 (17%), Positives = 69/205 (33%), Gaps = 21/205 (10%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEFF 67
           +L   +  F   +A+  +KD  V +  +     QT+   F Q   +  G       GE  
Sbjct: 6   MLLATALTFSVISAHADSKD--VARLTQLLEKSQTLTARFSQLTLDGGGTQLQETTGEMA 63

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHV 123
           + RP  F +   +P    ++SDG  +++++  L+  ++  L          ++  +   +
Sbjct: 64  LQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTPALLLSGDVSKI 123

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSIIK 178
            +      +     I    K           FD L     N  I D        + + I 
Sbjct: 124 SESFDITAKEAGGVIDFVLKPKTKDT----LFDSLRLSFRNGIINDMQLIDSVGQRTNIL 179

Query: 179 ILKYKENTVLDPKVFEIPYDKIHNI 203
               K N  +    F+    K  ++
Sbjct: 180 FTGVKANEPIAASKFQFQIPKGADV 204


>gi|261401110|ref|ZP_05987235.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           lactamica ATCC 23970]
 gi|269209011|gb|EEZ75466.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           lactamica ATCC 23970]
          Length = 207

 Score = 75.7 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 66/201 (32%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+SP   +++ DG  + +Y+  L   +               I SN   +   
Sbjct: 67  PGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPA-AILSNKTALESS 125

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 126 YTLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 183

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             +  L    F+    K  ++
Sbjct: 184 NTDPQLSRGAFKFTPPKGVDV 204


>gi|294625251|ref|ZP_06703890.1| outer-membrane lipoprotein carrier protein precursor [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|292600425|gb|EFF44523.1| outer-membrane lipoprotein carrier protein precursor [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
          Length = 223

 Score = 75.7 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 69/190 (36%), Gaps = 18/190 (9%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHF-LSIQTMQGTFLQE---DAGYV---MKGEFFMARPSK 73
                A +  T     ++ ++ F   ++ + G F Q      G V     G   +A P +
Sbjct: 22  AVLATALFASTAFAGARQELDTFTRGLKGLDGQFSQRVTDANGRVKETSSGRVALATPRQ 81

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY---------PLRYMAFSVIFSNNQHVI 124
           F ++Y+ P    +++DG  + V++  L+  +V          PL  +    +      V 
Sbjct: 82  FRWEYAKPYKQLIVADGKKVWVFDPDLEQVTVRAQGSEEQNSPLVALIDPALLDKKYDVS 141

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           +E+  R       +T     D    + S+ F R     +   ++D+  + + I    +K 
Sbjct: 142 EEAAPRDGLQWLSLTPKVDTDASFQIASLGFGREGLARME--VVDAVGQRTAIGFSGWKR 199

Query: 185 NTVLDPKVFE 194
           N       F 
Sbjct: 200 NPAFAADTFR 209


>gi|58617571|ref|YP_196770.1| hypothetical protein ERGA_CDS_08440 [Ehrlichia ruminantium str.
           Gardel]
 gi|58417183|emb|CAI28296.1| Hypothetical protein ERGA_CDS_08440 [Ehrlichia ruminantium str.
           Gardel]
          Length = 204

 Score = 75.7 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 30/189 (15%), Positives = 77/189 (40%), Gaps = 5/189 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK--GEF 66
           +  + +L     I    +    T +     ++ +F +I++ +  F+Q  +   +   G  
Sbjct: 9   IFCLAVLLNSYYICNAYSINTKTDNTVKTNSLTYFDAIRSFKADFMQISSSEDIPRYGYV 68

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQ-HVIQ 125
            M +P    + Y  P+ VS++  G+ I+ Y+ +L+ +S Y +       + S++  ++  
Sbjct: 69  LMKKPGLLKWDYYPPTPVSIVIKGTTISYYDRELEEYS-YTIVNNPIIGLLSSDIKNIST 127

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
                +++ N+   +   D        V F+     ++   I++     + I+      N
Sbjct: 128 IDFINIDTVNNQKIVTLHDKKSDLYAEVIFNTDPITIVGLNILNPD-SKTSIQFYNISSN 186

Query: 186 TVLDPKVFE 194
             +D + F+
Sbjct: 187 IPIDKREFK 195


>gi|221068785|ref|ZP_03544890.1| outer membrane lipoprotein carrier protein LolA [Comamonas
           testosteroni KF-1]
 gi|220713808|gb|EED69176.1| outer membrane lipoprotein carrier protein LolA [Comamonas
           testosteroni KF-1]
          Length = 211

 Score = 75.7 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/204 (16%), Positives = 67/204 (32%), Gaps = 22/204 (10%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE----------DAGYVMKGEFFMA 69
           AI    +A     D  +K       + Q  +  F Q               V  G F   
Sbjct: 7   AILIVGSASAAMADG-LKSLESFMKNAQAGKADFTQSVTSPPKSGQEARTKVSSGSFEFQ 65

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFS--NNQHV 123
           RP KF F Y+ P    +++DG  + +Y+A L+  +       L     +++ S  + + +
Sbjct: 66  RPGKFRFNYTKPFEQLIVADGKTLWLYDADLNQVTERAQAQVLGSTPAAILTSATDLKAL 125

Query: 124 IQESIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
             +     + +   +                + + F     +L    I DS  + S+++ 
Sbjct: 126 KADFELGNQPDAEGLEWVLASPRQKGGQLKSVRIGFTPEG-KLAALDIEDSFGQRSLMQF 184

Query: 180 LKYKENTVLDPKVFEIPYDKIHNI 203
              +    L    F     K  ++
Sbjct: 185 KGLQTQASLPASTFHFTVPKGADV 208


>gi|157804255|ref|YP_001492804.1| transcription elongation factor GreA [Rickettsia canadensis str.
           McKiel]
 gi|157785518|gb|ABV74019.1| transcription elongation factor GreA [Rickettsia canadensis str.
           McKiel]
          Length = 213

 Score = 75.7 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 31/190 (16%), Positives = 75/190 (39%), Gaps = 4/190 (2%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSV-KKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARP 71
           ILF        N+      D +V  +   +  +I+++   F QED    + KG+  + +P
Sbjct: 4   ILFLAVIFVFVNSITVYANDHTVILELKTYLRTIKSVAIDFTQEDSKNNIAKGKLLIRKP 63

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI-QR 130
             F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N++  +  + + 
Sbjct: 64  YNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENIFNFLLEDNENFDRYFVFES 123

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
           V +  +   I            + F++ + ++   KI + +     I   K  +      
Sbjct: 124 VINEGNIFKITIYHTLTEKRSEIIFNKATKQIELLKIFE-NNNIVTITFDKIAKVQKFSD 182

Query: 191 KVFEIPYDKI 200
            +F++   +I
Sbjct: 183 DLFKLKNPEI 192


>gi|91782390|ref|YP_557596.1| outer-membrane lipoprotein carrier protein [Burkholderia xenovorans
           LB400]
 gi|91686344|gb|ABE29544.1| Putative outer membrane lipoprotein carrier protein [Burkholderia
           xenovorans LB400]
          Length = 244

 Score = 75.7 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 42/232 (18%), Positives = 82/232 (35%), Gaps = 40/232 (17%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ----- 55
           +A  L +SV  V I    +++   + A+    +Q           + + +GTF+Q     
Sbjct: 21  LARTLVRSVGSVAI---GASVLFASQAFASGTEQL----KAFVAQVHSARGTFVQQEVRA 73

Query: 56  -------------EDAGYV--MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL 100
                          AG      G F  ARP KF ++Y  P +  L +DG  + VY+  L
Sbjct: 74  PSKAQGASGTLSTTGAGKTGTSSGTFTFARPGKFIWQYEKPYAQLLQADGDKLFVYDKDL 133

Query: 101 DTWSVYP----LRYMAFSVI-----FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMI 151
           +  +V      L     +++        N  +    ++    +   +T   KD      +
Sbjct: 134 NQVTVRSLGGALGASPAAILFGSNDLDKNFTLRDAGVKAG-IDWLELTPKAKDTQFQ-RV 191

Query: 152 SVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            + F      L   ++ D     +++     ++N  L    F+    K  ++
Sbjct: 192 GIGF--KDGNLEAMELHDVFGNVTLLTFSNIQKNPPLPADAFKFTVPKGADV 241


>gi|78036044|emb|CAJ23735.1| outer membrane lipoprotein-sorting protein LolA [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
          Length = 223

 Score = 75.7 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 68/190 (35%), Gaps = 18/190 (9%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHF-LSIQTMQGTFLQE---DAGYV---MKGEFFMARPSK 73
                A +  T     ++ ++ F   ++ + G F Q      G V     G   +A P +
Sbjct: 22  AVLATALFASTAFAGARQELDTFTRGLKGLDGQFSQRVTDAKGRVKETSSGRVALATPRQ 81

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY---------PLRYMAFSVIFSNNQHVI 124
           F ++Y+ P    +++DG  + V +  L+  +V          PL  +    +      V 
Sbjct: 82  FRWEYAKPYKQLIVADGKKVWVLDPDLEQVTVRAQGSEEQNSPLVALIDPALLDKKYDVS 141

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           +E+  R       +T     D    + S+ F +     +   ++D+  + + I    +K 
Sbjct: 142 EEAAPRDGLQWLSLTPKVDTDASFQIASLGFSKDGLARME--VVDAVGQRTAISFSGWKR 199

Query: 185 NTVLDPKVFE 194
           N       F 
Sbjct: 200 NPAFAADTFR 209


>gi|325202584|gb|ADY98038.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis M01-240149]
          Length = 207

 Score = 75.7 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 35/201 (17%), Positives = 67/201 (33%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+SP   +++ DG  + +Y+  L   +               I SN   +   
Sbjct: 67  PDLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPA-AILSNKTALESS 125

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 126 YTLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 183

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             N  L   VF+    K  ++
Sbjct: 184 NTNPQLSRGVFKFTPPKGVDV 204


>gi|296162239|ref|ZP_06845034.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           Ch1-1]
 gi|295887506|gb|EFG67329.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           Ch1-1]
          Length = 244

 Score = 75.7 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 81/231 (35%), Gaps = 40/231 (17%)

Query: 2   AFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------ 55
           A  L +SV  V I    +++   + A+    +Q           + + +GTF+Q      
Sbjct: 22  ARTLVRSVGSVAI---GASVLFASQAFASGTEQL----KAFVAQVHSARGTFVQQEVRAP 74

Query: 56  ------------EDAGYV--MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD 101
                         AG      G F  ARP KF ++Y  P +  L +DG  + VY+  L+
Sbjct: 75  SKAQGASGTLSTTGAGKTGTSSGTFTFARPGKFIWQYEKPYAQLLQADGDKLFVYDKDLN 134

Query: 102 TWSVYP----LRYMAFSVI-----FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMIS 152
             +V      L     +++        N  +    ++    +   +T   KD      + 
Sbjct: 135 QVTVRSLGGALGASPAAILFGSNDLDRNFTLRDAGVKAG-IDWLELTPKAKDTQFQ-RVG 192

Query: 153 VTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           + F      L   ++ D     +++     ++N  L    F+    K  ++
Sbjct: 193 IGF--KDGNLEAMELHDVFGNVTLLTFSNIQKNPPLPADAFKFTVPKGADV 241


>gi|57239533|ref|YP_180669.1| hypothetical protein Erum8060 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579517|ref|YP_197729.1| hypothetical protein ERWE_CDS_08530 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161612|emb|CAH58540.1| putative exported protein [Ehrlichia ruminantium str. Welgevonden]
 gi|58418143|emb|CAI27347.1| Hypothetical protein ERWE_CDS_08530 [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 204

 Score = 75.7 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 29/189 (15%), Positives = 77/189 (40%), Gaps = 5/189 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK--GEF 66
           +  + +L     I    +    T +     ++ +F ++++ +  F+Q  +   +   G  
Sbjct: 9   IFCLAVLLNSYYICNAYSINTKTDNTVKTNSLTYFDAVRSFKADFMQISSSEDIPRYGYV 68

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQ-HVIQ 125
            M +P    + Y  P+ VS++  G+ I+ Y+ +L+ +S Y +       + S++  ++  
Sbjct: 69  LMKKPGLLKWDYYPPTPVSIVIKGTTISYYDRELEEYS-YTIVNNPIIGLLSSDIKNIST 127

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
                +++ N+   +   D        V F+     ++   I++     + I+      N
Sbjct: 128 IDFINIDTVNNQKIVTLHDKKSDLYAEVIFNTDPITIVGLNILNPD-SKTSIQFYNISSN 186

Query: 186 TVLDPKVFE 194
             +D + F+
Sbjct: 187 IPIDKREFK 195


>gi|88812896|ref|ZP_01128140.1| outer membrane lipoprotein carrier protein LolA [Nitrococcus
           mobilis Nb-231]
 gi|88789818|gb|EAR20941.1| outer membrane lipoprotein carrier protein LolA [Nitrococcus
           mobilis Nb-231]
          Length = 199

 Score = 75.7 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 30/185 (16%), Positives = 67/185 (36%), Gaps = 28/185 (15%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEFFMARPSKFYFKYSSP 81
            P     +++   +++ S+ T+ G F+Q    + G       G F +ARP++F + Y  P
Sbjct: 5   EPGAAIDAIQALQQYYDSVHTLTGRFVQETRAEDGSRIDASSGAFALARPNRFDWLYEKP 64

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIF 141
               +++DG  + VY+ +L   +   L              V    +     ++   +  
Sbjct: 65  YRQRIVADGKRLWVYDVELRQATARSL---------DEVLGVGPALLLSGRFSDLQRSFE 115

Query: 142 FKDDFMGNMISVTFDRLSYRLLNWKIMDSSR------------RYSIIKILKYKENTVLD 189
            KD      I +      +     ++  +              + + + +   + N  LD
Sbjct: 116 LKD-LGAGWIRLRPKTGQWDFQRLRLHMAQGVPDVIELDNGLDQKTRLGLRDLQRNPRLD 174

Query: 190 PKVFE 194
           P+ F+
Sbjct: 175 PQRFQ 179


>gi|262376676|ref|ZP_06069904.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           lwoffii SH145]
 gi|262308386|gb|EEY89521.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           lwoffii SH145]
          Length = 231

 Score = 75.3 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 39/219 (17%), Positives = 83/219 (37%), Gaps = 26/219 (11%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-----EDAGYVMK 63
            +G V L    +   F A    ++ Q+    ++    +++M   F Q            K
Sbjct: 12  ALGAVTLAPVMSTTVFAAPVAASEQQATASLVKQLNHVRSMTANFEQSTKVTNPRATQKK 71

Query: 64  G------------EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-- 109
           G               +ARP KFY++ ++PS   + + G  + +Y+  L       L   
Sbjct: 72  GLTAQHMNQTFKGVMKVARPGKFYWETTAPSKQVIATTGKTVWIYDPDLQQAVRQSLDEQ 131

Query: 110 --YMAFSVIFSNNQHVIQ-ESIQRVESNNSFITIFFKD-DFMGNMISVTFDR-LSYRLLN 164
                  ++  N   ++Q   + +     ++ T++ K+ D +   ++++F    +  L+ 
Sbjct: 132 VANTPALLLSGNTSQIMQSYRVTQPNKGKTYYTLYPKNTDGVFESLTISFGANKAPSLM- 190

Query: 165 WKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
             + DS  + + IK    K N+ +    F     K  +I
Sbjct: 191 -ILQDSLGQTTNIKFSNVKVNSSIPASTFNFTPPKGTDI 228


>gi|268594248|ref|ZP_06128415.1| periplasmic carrier protein [Neisseria gonorrhoeae 35/02]
 gi|268596246|ref|ZP_06130413.1| periplasmic carrier protein [Neisseria gonorrhoeae FA19]
 gi|291044468|ref|ZP_06570177.1| outer-membrane lipoprotein carrier protein [Neisseria gonorrhoeae
           DGI2]
 gi|293397602|ref|ZP_06641808.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           gonorrhoeae F62]
 gi|268547637|gb|EEZ43055.1| periplasmic carrier protein [Neisseria gonorrhoeae 35/02]
 gi|268550034|gb|EEZ45053.1| periplasmic carrier protein [Neisseria gonorrhoeae FA19]
 gi|291011362|gb|EFE03358.1| outer-membrane lipoprotein carrier protein [Neisseria gonorrhoeae
           DGI2]
 gi|291611548|gb|EFF40617.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           gonorrhoeae F62]
          Length = 235

 Score = 75.3 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 65/201 (32%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 35  LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 94

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+ P   +++ DG  + +Y+  L   +               I SN   +   
Sbjct: 95  PGLFKWEYTLPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPA-AILSNKTALESS 153

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 154 YTLKEDGSSNGIDYVRATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 211

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             N  L    F+    K  ++
Sbjct: 212 NTNPQLSRGAFKFTPPKGVDV 232


>gi|254493108|ref|ZP_05106279.1| periplasmic carrier protein [Neisseria gonorrhoeae 1291]
 gi|260441138|ref|ZP_05794954.1| LolA [Neisseria gonorrhoeae DGI2]
 gi|268598366|ref|ZP_06132533.1| periplasmic carrier protein [Neisseria gonorrhoeae MS11]
 gi|268600722|ref|ZP_06134889.1| periplasmic carrier protein [Neisseria gonorrhoeae PID18]
 gi|268603028|ref|ZP_06137195.1| periplasmic carrier protein [Neisseria gonorrhoeae PID1]
 gi|268681503|ref|ZP_06148365.1| periplasmic carrier protein [Neisseria gonorrhoeae PID332]
 gi|268683733|ref|ZP_06150595.1| periplasmic carrier protein [Neisseria gonorrhoeae SK-92-679]
 gi|226512148|gb|EEH61493.1| periplasmic carrier protein [Neisseria gonorrhoeae 1291]
 gi|268582497|gb|EEZ47173.1| periplasmic carrier protein [Neisseria gonorrhoeae MS11]
 gi|268584853|gb|EEZ49529.1| periplasmic carrier protein [Neisseria gonorrhoeae PID18]
 gi|268587159|gb|EEZ51835.1| periplasmic carrier protein [Neisseria gonorrhoeae PID1]
 gi|268621787|gb|EEZ54187.1| periplasmic carrier protein [Neisseria gonorrhoeae PID332]
 gi|268624017|gb|EEZ56417.1| periplasmic carrier protein [Neisseria gonorrhoeae SK-92-679]
          Length = 207

 Score = 75.3 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 65/201 (32%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+ P   +++ DG  + +Y+  L   +               I SN   +   
Sbjct: 67  PGLFKWEYTLPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPA-AILSNKTALESS 125

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 126 YTLKEDGSSNGIDYVRATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 183

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             N  L    F+    K  ++
Sbjct: 184 NTNPQLSRGAFKFTPPKGVDV 204


>gi|21242752|ref|NP_642334.1| outer-membrane lipoprotein carrier protein [Xanthomonas axonopodis
           pv. citri str. 306]
 gi|23821825|sp|Q8PKZ8|LOLA_XANAC RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|21108231|gb|AAM36870.1| outer-membrane lipoproteins carrier protein precursor [Xanthomonas
           axonopodis pv. citri str. 306]
          Length = 209

 Score = 75.3 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 69/190 (36%), Gaps = 18/190 (9%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHF-LSIQTMQGTFLQE---DAGYV---MKGEFFMARPSK 73
                A +  T     ++ ++ F   ++ + G F Q      G V     G   +A P +
Sbjct: 8   AVLATALFASTAFAGARQELDTFTRGLKGLDGQFSQRVTDANGRVKETSSGRVALATPRQ 67

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY---------PLRYMAFSVIFSNNQHVI 124
           F ++Y+ P    +++DG  + V++  L+  +V          PL  +    +      V 
Sbjct: 68  FRWEYAKPYKQLIVADGKKVWVFDPDLEQVTVRAQGSEEQNSPLVALIDPALLDKKYDVS 127

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           +E+  R       +T     D    + S+ F R     +   ++D+  + + I    +K 
Sbjct: 128 EEAAPRDGLQWLSLTPKVDTDASFQIASLGFGREGLARME--VVDAVGQRTAIGFSGWKR 185

Query: 185 NTVLDPKVFE 194
           N       F 
Sbjct: 186 NPAFAADTFR 195


>gi|239814293|ref|YP_002943203.1| outer membrane lipoprotein carrier protein LolA [Variovorax
           paradoxus S110]
 gi|239800870|gb|ACS17937.1| outer membrane lipoprotein carrier protein LolA [Variovorax
           paradoxus S110]
          Length = 210

 Score = 75.3 bits (184), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 32/188 (17%), Positives = 69/188 (36%), Gaps = 22/188 (11%)

Query: 36  VKKAIEHFLSIQTMQGTFLQE----------DAGYVMKGEFFMARPSKFYFKYSSPSSVS 85
           ++       ++++ +  F Q                  G F   RP KF F Y  P + S
Sbjct: 22  LESLEAFVKTVKSGRAEFTQTVTAPPREGQPGRTKTSTGTFEFQRPGKFKFDYQKPFAQS 81

Query: 86  LISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFS--NNQHVIQE-SIQRVESNNSFI 138
           +++DG  + +Y+A L+  +       L     ++I +  + + +  + +++     +   
Sbjct: 82  IVADGKTLWLYDADLNQVTQRAQSQALGSTPAALIAAAPDLRALQADFTLEAAPERDGLQ 141

Query: 139 TIFFKDDFMGNMI---SVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
            +          +    V F   +   L   I+DS  + S++K  K + N  L    FE 
Sbjct: 142 WVKATPKNKDGQLQNVQVGFQGDALAALE--ILDSFGQRSVLKFSKVEVNPALPASAFEF 199

Query: 196 PYDKIHNI 203
                 ++
Sbjct: 200 KAPAGADV 207


>gi|239998388|ref|ZP_04718312.1| LolA [Neisseria gonorrhoeae 35/02]
 gi|240013514|ref|ZP_04720427.1| LolA [Neisseria gonorrhoeae DGI18]
 gi|240015952|ref|ZP_04722492.1| LolA [Neisseria gonorrhoeae FA6140]
 gi|240080093|ref|ZP_04724636.1| LolA [Neisseria gonorrhoeae FA19]
 gi|240112303|ref|ZP_04726793.1| LolA [Neisseria gonorrhoeae MS11]
 gi|240115046|ref|ZP_04729108.1| LolA [Neisseria gonorrhoeae PID18]
 gi|240117331|ref|ZP_04731393.1| LolA [Neisseria gonorrhoeae PID1]
 gi|240120586|ref|ZP_04733548.1| LolA [Neisseria gonorrhoeae PID24-1]
 gi|240122882|ref|ZP_04735838.1| LolA [Neisseria gonorrhoeae PID332]
 gi|240125138|ref|ZP_04738024.1| LolA [Neisseria gonorrhoeae SK-92-679]
          Length = 206

 Score = 75.3 bits (184), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 65/201 (32%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 6   LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 65

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+ P   +++ DG  + +Y+  L   +               I SN   +   
Sbjct: 66  PGLFKWEYTLPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPA-AILSNKTALESS 124

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 125 YTLKEDGSSNGIDYVRATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 182

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             N  L    F+    K  ++
Sbjct: 183 NTNPQLSRGAFKFTPPKGVDV 203


>gi|82701312|ref|YP_410878.1| outer membrane lipoprotein carrier protein LolA [Nitrosospira
           multiformis ATCC 25196]
 gi|123768325|sp|Q2YCN5|LOLA_NITMU RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|82409377|gb|ABB73486.1| outer membrane lipoprotein carrier protein LolA [Nitrosospira
           multiformis ATCC 25196]
          Length = 207

 Score = 75.3 bits (184), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 28/169 (16%), Positives = 59/169 (34%), Gaps = 18/169 (10%)

Query: 41  EHFLSIQTMQGTFLQEDAGYV------MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
               + +T++  F Q              G     RP KF + Y  P    ++ DG  I 
Sbjct: 30  SFMENARTVRADFAQTVLDKSRHIVQTASGAMQFERPGKFRWIYEKPYEQLIVGDGERIW 89

Query: 95  VYNAKLDTWSVYPL----RYMAFSVI-----FSNNQHVIQESIQRVESNNSFITIFFKDD 145
            Y+  L   +V  L         +++        N H+++  +Q             +  
Sbjct: 90  FYDHDLAQVTVRKLDAAIGSSPAALLAGNNDIEKNFHLLEIGLQGNIEWVEATPKTREST 149

Query: 146 FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
           F    + + F      L   ++ D+  + ++ +    ++N  L P++F+
Sbjct: 150 FE--RVLLGFTLEGI-LRVMELHDNFGQVTVFEFSGVEQNRKLPPELFK 195


>gi|217970179|ref|YP_002355413.1| outer membrane lipoprotein carrier protein LolA [Thauera sp. MZ1T]
 gi|217507506|gb|ACK54517.1| outer membrane lipoprotein carrier protein LolA [Thauera sp. MZ1T]
          Length = 219

 Score = 75.3 bits (184), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 28/173 (16%), Positives = 61/173 (35%), Gaps = 19/173 (10%)

Query: 37  KKAIEHFLSIQTMQGTFLQE---DAGYV---MKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           ++  +     ++ +G F Q     +G       G F  ARP +F+++Y  P    L+ DG
Sbjct: 34  QQLRDFVTGARSAEGEFEQVVTAQSGRRPQEASGSFAYARPGRFHWEYDRPYRQVLVGDG 93

Query: 91  SNIAVYNAKLDTWSVY----PLRYMAFSVI-----FSNNQHVIQESIQRVESNNSFITIF 141
             +  ++  L+  +V      L     +++       +N  +        E +       
Sbjct: 94  KTLWSWDPDLNQVTVRAIGEALGATPAAILFGSGALDDNFELADAG----ERDGLAWAEA 149

Query: 142 FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
                     S+       +L   ++ D   + ++I+  + + N VL    F 
Sbjct: 150 RPKRTESGFESLRIGLAEGQLRRMEMRDHFGQTTVIRFTRLRANPVLAEDRFR 202


>gi|89092933|ref|ZP_01165885.1| periplasmic chaperone LolA [Oceanospirillum sp. MED92]
 gi|89082958|gb|EAR62178.1| periplasmic chaperone LolA [Oceanospirillum sp. MED92]
          Length = 218

 Score = 75.3 bits (184), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 76/211 (36%), Gaps = 18/211 (8%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---DAGY 60
           +L+      V+    +A+   +++         +K  E     Q+    F+Q    + G 
Sbjct: 1   MLFNHFKKAVVRSSIAAMVLASSSLVNAASDGAEKLKEMLNGYQSFSTNFVQVTLAENGR 60

Query: 61  ---VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--- 114
                +G   +A+P+ F ++   P    ++SDG  I +++  L+  +         S   
Sbjct: 61  EAQKTEGSLKLAKPNLFRWETQQPFPQEIVSDGQYIWIHDPDLEQVTRRSADSSQGSAPA 120

Query: 115 VIFSNNQHVIQES-IQRVESNNSFITIFFKDDFMG----NMISVTFDRLSYRLLNWKIMD 169
           +I +     ++++   R+  ++    +F           + I + F           + D
Sbjct: 121 LILNGQIDTLRQTYNIRLVDDSGSEQLFDLQPVSDQHNFSRIRLAFANQIIS--EIMLED 178

Query: 170 SSRRYSIIKILKYKENTVLDPK--VFEIPYD 198
           +  + + +     + N   D    +F +P D
Sbjct: 179 ALGQRTSVVFNDQELNPDFDKTAFLFRVPAD 209


>gi|326318087|ref|YP_004235759.1| outer membrane lipoprotein carrier protein LolA [Acidovorax avenae
           subsp. avenae ATCC 19860]
 gi|323374923|gb|ADX47192.1| outer membrane lipoprotein carrier protein LolA [Acidovorax avenae
           subsp. avenae ATCC 19860]
          Length = 211

 Score = 74.9 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 31/206 (15%), Positives = 70/206 (33%), Gaps = 22/206 (10%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE----------DAGYVMKGEFF 67
           + AI              +          Q  +  F Q                  G F 
Sbjct: 5   WLAIAAIAVGAQSAWADGLGSLESFMKGAQAGRADFTQTVTSPPKDGQAPRTRTSSGTFE 64

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFS--NNQ 121
             RP +F F Y+ P + ++++DG ++ +Y+A L+  +       L     +++ S  + Q
Sbjct: 65  FQRPGRFKFTYTKPFAQTIVADGKSLWLYDADLNQVTQRAQAQALGTTPAALLASAPDLQ 124

Query: 122 HVIQE-SIQRVESNNSFITIFFKDDFMGNMISVT---FDRLSYRLLNWKIMDSSRRYSII 177
            + ++ +++     +    +          +      F     +L    I+DS  + S+I
Sbjct: 125 ALRKDFTLESAPDQDGLQWVLATPKTRDGQLKSVRVGFQGE--QLAALDILDSFGQRSVI 182

Query: 178 KILKYKENTVLDPKVFEIPYDKIHNI 203
           +    + +  L    FE    +  ++
Sbjct: 183 RFANVQSSASLPASTFEFKPPQGADV 208


>gi|162138537|ref|YP_363789.2| outer-membrane lipoprotein carrier protein [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
          Length = 209

 Score = 74.9 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 68/190 (35%), Gaps = 18/190 (9%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHF-LSIQTMQGTFLQE---DAGYV---MKGEFFMARPSK 73
                A +  T     ++ ++ F   ++ + G F Q      G V     G   +A P +
Sbjct: 8   AVLATALFASTAFAGARQELDTFTRGLKGLDGQFSQRVTDAKGRVKETSSGRVALATPRQ 67

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY---------PLRYMAFSVIFSNNQHVI 124
           F ++Y+ P    +++DG  + V +  L+  +V          PL  +    +      V 
Sbjct: 68  FRWEYAKPYKQLIVADGKKVWVLDPDLEQVTVRAQGSEEQNSPLVALIDPALLDKKYDVS 127

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           +E+  R       +T     D    + S+ F +     +   ++D+  + + I    +K 
Sbjct: 128 EEAAPRDGLQWLSLTPKVDTDASFQIASLGFSKDGLARME--VVDAVGQRTAISFSGWKR 185

Query: 185 NTVLDPKVFE 194
           N       F 
Sbjct: 186 NPAFAADTFR 195


>gi|325927612|ref|ZP_08188841.1| Outer membrane lipoprotein-sorting protein LolA [Xanthomonas
           perforans 91-118]
 gi|325541979|gb|EGD13492.1| Outer membrane lipoprotein-sorting protein LolA [Xanthomonas
           perforans 91-118]
          Length = 223

 Score = 74.9 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 68/190 (35%), Gaps = 18/190 (9%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHF-LSIQTMQGTFLQE---DAGYV---MKGEFFMARPSK 73
                A +  T     ++ ++ F   ++ + G F Q      G V     G   +A P +
Sbjct: 22  AVLATALFASTAFAGARQELDTFTRGLKGLDGQFSQRVTDANGRVKETSSGRVALATPRQ 81

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY---------PLRYMAFSVIFSNNQHVI 124
           F ++Y+ P    +++DG  + V +  L+  +V          PL  +    +      V 
Sbjct: 82  FRWEYAKPYKQLIVADGKKVWVLDPDLEQVTVRAQGSEEQNSPLVALIDPALLDKKYDVS 141

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           +E+  R       +T     D    + S+ F +     +   ++D+  + + I    +K 
Sbjct: 142 EEAAPRDGLQWLSLTPKVDTDASFQIASLGFGKEGLARME--VVDAVGQRTAISFSGWKR 199

Query: 185 NTVLDPKVFE 194
           N       F 
Sbjct: 200 NPAFAADTFR 209


>gi|326794637|ref|YP_004312457.1| Outer-membrane lipoprotein carrier protein [Marinomonas
           mediterranea MMB-1]
 gi|326545401|gb|ADZ90621.1| Outer-membrane lipoprotein carrier protein [Marinomonas
           mediterranea MMB-1]
          Length = 206

 Score = 74.9 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 28/209 (13%), Positives = 84/209 (40%), Gaps = 21/209 (10%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---M 62
           +   V + F        ++  + ++ + +  ++     + ++G F Q    + G      
Sbjct: 1   MFKKVAVVFCLWSLSCFSSLVLAQE-THQALVDLLEKNRNVEGEFRQITYTEEGKELQNS 59

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSVIFS 118
           +G F +A+P++F +   SP    ++S+G  + +++  L+  +  PL         +++  
Sbjct: 60  EGVFLLAQPNRFVWDSISPFPQRIVSNGETVTIWDVDLEQATQRPLAKTVGNSPAALLSQ 119

Query: 119 NNQHVI-QESIQRVESNNSFITIFFKDDFMGNMISVTFDRL---SYRLLNWKIMDSSRRY 174
               V+    +  +  N   +    +DD     ++++F      +  L      D+  + 
Sbjct: 120 PAVDVLPHYKVLTLAGNKYRLIPKDEDDLFQ-TLTLSFKGDLISAMSLK-----DALGQT 173

Query: 175 SIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           ++I+    + +  +  + F+I   +  ++
Sbjct: 174 TVIEFTNLEHHEGVSAENFKIDLPENVDL 202


>gi|59800658|ref|YP_207370.1| LolA [Neisseria gonorrhoeae FA 1090]
 gi|268685973|ref|ZP_06152835.1| outer-membrane lipoprotein carrier protein [Neisseria gonorrhoeae
           SK-93-1035]
 gi|75432580|sp|Q5FA29|LOLA_NEIG1 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|59717553|gb|AAW88958.1| putative lipoprotein carrier precursor, periplasmic binding
           [Neisseria gonorrhoeae FA 1090]
 gi|268626257|gb|EEZ58657.1| outer-membrane lipoprotein carrier protein [Neisseria gonorrhoeae
           SK-93-1035]
          Length = 207

 Score = 74.9 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 65/201 (32%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+ P   +++ DG  + +Y+  L   +               I SN   +   
Sbjct: 67  PGLFKWEYTLPYRQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPA-AILSNKTALESS 125

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 126 YTLKEDGSSNGIDYVRATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 183

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             N  L    F+    K  ++
Sbjct: 184 NTNPQLSRGAFKFTPPKGVDV 204


>gi|240127592|ref|ZP_04740253.1| LolA [Neisseria gonorrhoeae SK-93-1035]
          Length = 206

 Score = 74.6 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 65/201 (32%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 6   LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 65

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+ P   +++ DG  + +Y+  L   +               I SN   +   
Sbjct: 66  PGLFKWEYTLPYRQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPA-AILSNKTALESS 124

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 125 YTLKEDGSSNGIDYVRATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 182

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             N  L    F+    K  ++
Sbjct: 183 NTNPQLSRGAFKFTPPKGVDV 203


>gi|21231422|ref|NP_637339.1| outer-membrane lipoprotein carrier protein [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66768524|ref|YP_243286.1| outer-membrane lipoprotein carrier protein [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|188991667|ref|YP_001903677.1| outer-membrane lipoprotein carrier protein [Xanthomonas campestris
           pv. campestris str. B100]
 gi|23821822|sp|Q8P991|LOLA_XANCP RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|81305504|sp|Q4UUK7|LOLA_XANC8 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229485844|sp|B0RT42|LOLA_XANCB RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|21113091|gb|AAM41263.1| outer-membrane lipoproteins carrier protein precursor [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66573856|gb|AAY49266.1| outer-membrane lipoproteins carrier protein precursor [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|167733427|emb|CAP51628.1| Outer membrane lipoprotein-sorting protein LolA [Xanthomonas
           campestris pv. campestris]
          Length = 209

 Score = 74.6 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 32/190 (16%), Positives = 66/190 (34%), Gaps = 18/190 (9%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHF-LSIQTMQGTFLQE---DAGYV---MKGEFFMARPSK 73
                A +  T     ++ ++ F   ++ + G F Q      G V     G   +A P +
Sbjct: 8   AVLATALFASTAFAGARQELDTFTRGLKGLDGQFSQRVTDANGRVKENSSGRVALATPRQ 67

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVI-----FSNNQHVI 124
           F ++Y+ P    +++DG  + V++  L+  +V              +           V 
Sbjct: 68  FRWEYAKPYKQLIVADGKKVWVFDPDLEQVTVRAQGSEEQNSPLVALIDPTRLDKQYDVS 127

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           +E+  R       +T     D    M S+ F +     +   ++D+  + + I    +K 
Sbjct: 128 EEAAPRDGLQWLSLTPKVDTDASFQMASLGFGKDGLAKME--VVDAVGQRTAISFSGWKR 185

Query: 185 NTVLDPKVFE 194
           N       F 
Sbjct: 186 NPAFAADTFR 195


>gi|330719461|gb|EGG98090.1| Outer membrane lipoprotein carrier protein LolA [gamma
           proteobacterium IMCC2047]
          Length = 213

 Score = 74.6 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 38/205 (18%), Positives = 83/205 (40%), Gaps = 22/205 (10%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---DAG---Y 60
           ++V+ + ++F  S +             + ++  +   ++Q+ Q  F+Q      G    
Sbjct: 2   RNVLKIKVVFCLSLLMLAFVGKANADVDASQRLHDLLKNMQSFQADFIQNVLNTNGVLQQ 61

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVI 116
             +GE  + RP  FY++  +P   +L++DG  +  Y+  L+  +V      L     +++
Sbjct: 62  STQGEMAVKRPGLFYWQTFAPFEQTLVADGEQLWSYDPDLEQVTVQAVGQRLSDTP-ALL 120

Query: 117 FSNNQHVIQE----SIQRVESNNSFITIFFKDD---FMGNMISVTFDRLSYRLLNWKIMD 169
           FS     + +    S  +++  +    +  K     F    ++  FD     L    I+D
Sbjct: 121 FSGEIDGLTDSYAISAVQLKDESWQFRLLPKQPDSLFEELRLTFAFD----TLTQMHILD 176

Query: 170 SSRRYSIIKILKYKENTVLDPKVFE 194
           S    S ++    + N  LD  +F+
Sbjct: 177 SLGNRSSLEFRNVRVNGALDDALFQ 201


>gi|104781338|ref|YP_607836.1| outer-membrane lipoprotein carrier protein [Pseudomonas entomophila
           L48]
 gi|122403638|sp|Q1IBD3|LOLA_PSEE4 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|95110325|emb|CAK15032.1| Outer-membrane lipoprotein carrier protein precursor [Pseudomonas
           entomophila L48]
          Length = 207

 Score = 74.6 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 34/199 (17%), Positives = 69/199 (34%), Gaps = 19/199 (9%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVMK---GEFFMARPSK 73
           +     A      ++ V +  +     QT+   F Q   + +G  ++   GE  + RP  
Sbjct: 10  SALAMGAVSAHADEKDVARLTQLLEKSQTITARFSQLTLDASGTSLQEANGEMAVKRPGL 69

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQESIQ 129
           FY+   +P    ++SDG  + +++  L+  ++      L      ++ S +   I +S  
Sbjct: 70  FYWHTDAPQEQVVVSDGQKVTLWDPDLEQATIKKLDVRLSQTPA-LLLSGDVSKISQSFD 128

Query: 130 RVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSIIKILKYKE 184
                   +T F       + +   FD L        I D        + + I     K 
Sbjct: 129 ISSKEQGEVTDFTLKPKTKDTL---FDSLRVSFRKGLINDMQLVDSVGQRTNILFNGVKA 185

Query: 185 NTVLDPKVFEIPYDKIHNI 203
           N  +    F+    K  ++
Sbjct: 186 NEAIPASKFKFDVPKGADV 204


>gi|167034604|ref|YP_001669835.1| outer-membrane lipoprotein carrier protein [Pseudomonas putida
           GB-1]
 gi|189028555|sp|B0KLX1|LOLA_PSEPG RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|166861092|gb|ABY99499.1| outer membrane lipoprotein carrier protein LolA [Pseudomonas putida
           GB-1]
          Length = 207

 Score = 74.6 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 33/199 (16%), Positives = 66/199 (33%), Gaps = 19/199 (9%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEFFMARPSK 73
           +            +Q V++  +     QT++  F Q      G       G+  + RP  
Sbjct: 10  SALALGTVTAYAGEQDVQRLTQLLEKSQTIEANFSQLTLGADGTSLQETSGKMTVKRPGL 69

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQESIQ 129
           FY+   +P    ++SDG N+ +++  L+  ++      L     +++ S +   I +S  
Sbjct: 70  FYWHTDAPQEQVVVSDGKNVTLWDPDLEQATIKKLDVRLNQTP-ALLLSGDVSKISQSFD 128

Query: 130 RVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSIIKILKYKE 184
                   +  F       + +   FD L        I D        + + I     K 
Sbjct: 129 IASKEQGEVMDFTLKPKTKDTL---FDSLRVSFRKGLINDMQLIDSVGQRTNILFNGVKA 185

Query: 185 NTVLDPKVFEIPYDKIHNI 203
           N  +    F     K  ++
Sbjct: 186 NQAVPDSKFTFDIPKGADV 204


>gi|50085964|ref|YP_047474.1| outer-membrane lipoproteins carrier protein [Acinetobacter sp.
           ADP1]
 gi|49531940|emb|CAG69652.1| outer-membrane lipoproteins carrier protein [Acinetobacter sp.
           ADP1]
          Length = 230

 Score = 74.6 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 40/228 (17%), Positives = 89/228 (39%), Gaps = 29/228 (12%)

Query: 3   FLLYKSVIGVVILFFYSAIF---PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA- 58
            +L K+V  + +     A        AA P ++ Q+    ++    IQ++  +F Q    
Sbjct: 2   TMLRKTVCAIAMSAATLAPVMSTTVFAATPASEQQATSNLVKQLSGIQSLSASFEQTTKT 61

Query: 59  ----------------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT 102
                               KGE  +ARP KF+++ +SPS  ++ + G  + +Y+  L  
Sbjct: 62  TNAKAPQKKGLSAQHMNQTFKGEMKVARPGKFFWETTSPSKQTIATTGKTVWIYDPDLQQ 121

Query: 103 WSVYPLR----YMAFSVIFSNNQHVIQ-ESIQRVESNNSFITIFFKDDFMG-NMISVTFD 156
                L          ++  N   ++Q   + + + + ++ T++ K+       ++++F 
Sbjct: 122 AVRQNLDDQVANTPALLLSGNTSQIMQSYRVTQPDRSKTYYTLYPKNSEGAFQSLTISFG 181

Query: 157 R-LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
              +  L+   + DS  + + ++    K N  +    F     K  +I
Sbjct: 182 ANKAPSLM--ILQDSLGQTTYVRFNNVKLNPAIPASTFNFTPPKGTDI 227


>gi|187923040|ref|YP_001894682.1| outer-membrane lipoprotein carrier protein [Burkholderia
           phytofirmans PsJN]
 gi|187714234|gb|ACD15458.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           phytofirmans PsJN]
          Length = 244

 Score = 74.6 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 40/229 (17%), Positives = 80/229 (34%), Gaps = 37/229 (16%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------- 56
           L    V GV  +   +++   + A+    +Q           + + +GTF+Q+       
Sbjct: 21  LARTLVRGVGSVAIGASVLFASQAFASGTEQL----KAFVAQVHSARGTFVQQEVRAPSK 76

Query: 57  -----------DAGYV--MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW 103
                       AG      G F  ARP KF ++Y  P +  L +DG  + VY+  L+  
Sbjct: 77  AQGASGTLSTQGAGKTGTSSGTFTFARPGKFIWQYEKPYAQLLQADGDKLYVYDKDLNQV 136

Query: 104 SVYP----LRYMAFSVI-----FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVT 154
           +V      L     +++        N  +    ++    +   +T   KD      + + 
Sbjct: 137 TVRSLGGALGASPAAILFGSNDLDKNFTLRDAGVKAG-IDWLELTPKAKDTQFQ-RVGIG 194

Query: 155 FDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           F      L   ++ D     +++     ++N  L    F+    K  ++
Sbjct: 195 F--KDGNLEAMELHDVFGNVTLLTFSNIQKNPPLPADAFKFTVPKGADV 241


>gi|299532558|ref|ZP_07045948.1| outer membrane lipoprotein carrier protein LolA [Comamonas
           testosteroni S44]
 gi|298719505|gb|EFI60472.1| outer membrane lipoprotein carrier protein LolA [Comamonas
           testosteroni S44]
          Length = 194

 Score = 74.6 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 30/188 (15%), Positives = 62/188 (32%), Gaps = 21/188 (11%)

Query: 36  VKKAIEHFLSIQTMQGTFLQE----------DAGYVMKGEFFMARPSKFYFKYSSPSSVS 85
           +K       + Q  +  F Q               V  G F   RP KF F Y+ P    
Sbjct: 5   LKSLESFMKNAQAGKADFTQSVTSPPKSGQEARTKVSSGSFEFQRPGKFRFNYTKPFEQL 64

Query: 86  LISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFS--NNQHVIQESIQRVESNNSFIT 139
           +++DG  + +Y+A L+  +       L     +++ S  + + +  +     + +   + 
Sbjct: 65  IVADGKTLWLYDADLNQVTERAQAQVLGSTPAAILTSATDLKALKADFELGNQPDADGLE 124

Query: 140 IFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
                          + + F     +L    I DS  + S+++    +    L    F  
Sbjct: 125 WVLASPRQKGGQLKSVRIGFTPEG-KLAALDIEDSFGQRSLMQFKGLQTQASLPASTFHF 183

Query: 196 PYDKIHNI 203
              K  ++
Sbjct: 184 TVPKGADV 191


>gi|85858682|ref|YP_460884.1| outer membrane lipoprotein carrier protein [Syntrophus
           aciditrophicus SB]
 gi|85721773|gb|ABC76716.1| outer membrane lipoprotein carrier protein [Syntrophus
           aciditrophicus SB]
          Length = 237

 Score = 74.6 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 29/212 (13%), Positives = 77/212 (36%), Gaps = 20/212 (9%)

Query: 3   FLLYKSVIGVVILFFYSA--IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---- 56
           F   + ++ V++     +       AA P++    + +    +   + ++ +F+QE    
Sbjct: 13  FCRGRIILSVLVFLGILSWGSGSLQAAEPLSLSALISRMQVAYERTRDLKASFIQEVSLK 72

Query: 57  --DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK-----LDTWSVYPLR 109
                   +G  ++  P +  + Y  P    L+ +     +Y  +     +         
Sbjct: 73  SMGRAEREEGILYLKNPKRMLWDYHKPQMKKLVVNPQKAWLYVPEDHVVYVQNADQIFKS 132

Query: 110 YMAFSVI-----FSNNQHVIQESIQRVESNNSF-ITIFFKDDFMGN-MISVTFDRLSYRL 162
            MA   +        +  +   +   V+   ++ +T+  K   +G   +++T D+ SY++
Sbjct: 133 KMAVRFLSGMGKLQEDFSIRFAASGAVDKEGNYQLTLVPKRPGLGTDQLNLTVDKKSYQI 192

Query: 163 LNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
           +     D+    + I+    + N  L   +F 
Sbjct: 193 IEGSFTDTYGNETRIQFRNIRVNNRLSDSLFN 224


>gi|319792074|ref|YP_004153714.1| outer membrane lipoprotein carrier protein lola [Variovorax
           paradoxus EPS]
 gi|315594537|gb|ADU35603.1| outer membrane lipoprotein carrier protein LolA [Variovorax
           paradoxus EPS]
          Length = 210

 Score = 74.2 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 71/188 (37%), Gaps = 22/188 (11%)

Query: 36  VKKAIEHFLSIQTMQGTFLQE--------DAGYV--MKGEFFMARPSKFYFKYSSPSSVS 85
           ++       ++++ +  F Q           G V    G F   RP KF F Y  P + S
Sbjct: 22  LESLETFVKTVKSGRAEFTQTVTAPSREGQPGRVKTSTGTFEFQRPGKFKFDYRKPFAQS 81

Query: 86  LISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFS--NNQHVIQE-SIQRVESNNSFI 138
           +++DG  + +Y+A L+  +       L     ++I +  + + +  + +++     +   
Sbjct: 82  IVADGKTLWLYDADLNQVTQRAQAQALGSTPAALIAAAPDLRALQADFALEAAPERDGLE 141

Query: 139 TIFFKDDFMGNMISVT---FDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
            +          +      F   +   L   I+DS  + S++K  K + N  L   VF+ 
Sbjct: 142 WVKATPKNKDGQLQSVLVGFQGDALAALE--ILDSFGQRSVLKFSKVEVNPSLPASVFDF 199

Query: 196 PYDKIHNI 203
                 ++
Sbjct: 200 KAPAGADV 207


>gi|294666601|ref|ZP_06731840.1| outer-membrane lipoprotein carrier protein precursor [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
 gi|292603621|gb|EFF47033.1| outer-membrane lipoprotein carrier protein precursor [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
          Length = 223

 Score = 74.2 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 62/166 (37%), Gaps = 17/166 (10%)

Query: 44  LSIQTMQGTFLQE---DAGYV---MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
             ++ + G F Q      G V     G   +A P +F ++Y+ P    +++DG  + V++
Sbjct: 46  RGLKGLDGQFSQRVTDANGRVKETSSGRVALATPRQFRWEYAKPYKQLIVADGKKVWVFD 105

Query: 98  AKLDTWSVY---------PLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG 148
           + L+  +V          PL  +    +      V +E+  R       +T     D   
Sbjct: 106 SDLEQVTVRAQGSEEQNSPLVALIDPALLDKKYDVSEEAAPRDGLQWLSLTPKVDTDASF 165

Query: 149 NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
            + S+ F R     +   ++D+  + + I    +K N       F 
Sbjct: 166 QIASLGFGREGLARME--VVDAVGQRTAIGFSGWKRNPAFAADTFR 209


>gi|90415911|ref|ZP_01223844.1| periplasmic chaperone LolA [marine gamma proteobacterium HTCC2207]
 gi|90332285|gb|EAS47482.1| periplasmic chaperone LolA [marine gamma proteobacterium HTCC2207]
          Length = 225

 Score = 74.2 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 26/183 (14%), Positives = 74/183 (40%), Gaps = 18/183 (9%)

Query: 25  NAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKY 78
            A++     + +++  +    I ++   F Q+ +          +G F +++P++  +  
Sbjct: 34  TASWSGGAPEDIQQLRDLLQPITSLSARFEQKISDAEGFELQASEGLFQVSQPNRLRWIV 93

Query: 79  SSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQES--IQRVE 132
            +P    +I+DG  + VY+  L+   + P          +++FS +   + ++  + ++ 
Sbjct: 94  EAPMPQQIIADGLTLWVYDPDLEQVIIQPFNQDMAATP-AILFSGDLDRLDDAYFVTQLA 152

Query: 133 SNNSFITIFFKDDFMGNMISVTFDRL-SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPK 191
                +          +M ++ FD      +    + D+  + + I+  + + N VL   
Sbjct: 153 EGRFELKPEQGGSLFNSM-TIAFDGSTPTSIR---LTDTLGQTTTIRFSQLELNPVLSGD 208

Query: 192 VFE 194
           +F 
Sbjct: 209 LFV 211


>gi|329120328|ref|ZP_08248996.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327462669|gb|EGF08992.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 201

 Score = 74.2 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 26/196 (13%), Positives = 59/196 (30%), Gaps = 13/196 (6%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV----MKGEFFMARPSKF 74
           + I    AA+       +    +       + GTF Q            G F + RP  F
Sbjct: 5   ALILTLVAAFSAAYAGGIDALKKFNADTDGIAGTFSQTVKSKKKTQTSGGTFQILRPGLF 64

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQR 130
            ++Y+ P   +++ DG  I +Y+  L   +             +++   N      +++ 
Sbjct: 65  RWEYTKPYKQTIVGDGKIIWLYDIDLKQVTKSDQSKAIGDSPAAILSDKNALDTSYTLKE 124

Query: 131 VESNNSFITIFFKDDFMGN---MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
             + +    +             I + F   +   +   + D     + I+      +  
Sbjct: 125 DGTTDGIDYVLASPKKNNGGYQYIRIGFKGDTLAAME--LKDGFGNQTAIRFSNIDTHPN 182

Query: 188 LDPKVFEIPYDKIHNI 203
                F     K  ++
Sbjct: 183 PPRSAFAFTPPKGADV 198


>gi|302185004|ref|ZP_07261677.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. syringae 642]
 gi|330954582|gb|EGH54842.1| lipoprotein chaperone [Pseudomonas syringae Cit 7]
 gi|330981391|gb|EGH79494.1| lipoprotein chaperone [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 207

 Score = 74.2 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 32/206 (15%), Positives = 65/206 (31%), Gaps = 19/206 (9%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEF 66
           +I    +    F+        + V +  +     QT+   F Q   +  G       GE 
Sbjct: 3   LIRMLLATALTFSMIPAHADSKDVARLTQLLEKSQTLTARFSQLTLDGGGTQLQETTGEM 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQH 122
            + RP  F +   +P    ++SDG  +++++  L+  ++  L          ++  +   
Sbjct: 63  ALQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTPALLLSGDVSK 122

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSII 177
           + +      +     I    K           FD L     N  I D        + + I
Sbjct: 123 ISESFDITAKEAGGVIDFVLKPKTKDT----LFDSLRLSFRNGIINDMQLIDSVGQRTNI 178

Query: 178 KILKYKENTVLDPKVFEIPYDKIHNI 203
                K N  +    F+    K  ++
Sbjct: 179 LFTGVKANESIAASKFQFQIPKGADV 204


>gi|302877498|ref|YP_003846062.1| outer membrane lipoprotein carrier protein LolA [Gallionella
           capsiferriformans ES-2]
 gi|302580287|gb|ADL54298.1| outer membrane lipoprotein carrier protein LolA [Gallionella
           capsiferriformans ES-2]
          Length = 204

 Score = 74.2 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/190 (16%), Positives = 69/190 (36%), Gaps = 14/190 (7%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---DAGYVMK---GEFFMARP 71
           Y       A     +  +++K      +  + Q  F Q      G  M+   G     RP
Sbjct: 3   YILAILLAALSFSAQAGAIEKLKTFIAATHSAQANFTQVVQDQNGKRMQSASGVMQFQRP 62

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQES 127
            +F + Y  P    ++ DG+   +Y+  L+  SV      L     +++  +N+      
Sbjct: 63  GRFRWTYQKPYEQIIVGDGAKFWLYDKDLNQVSVKKLDAALGSSPAALLAGSNEIERGFV 122

Query: 128 IQRVESNNSFITIFF---KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           ++   S   F  +       D   + + + FD     L+  ++ D+    ++++    + 
Sbjct: 123 LKEAGSREGFEWLQATPKAQDSSFSAVLMGFDA-DASLVAMELNDTFGHKTVLRFSGMQR 181

Query: 185 NTVLDPKVFE 194
           N  +  + F+
Sbjct: 182 NPRVSAQQFQ 191


>gi|294341020|emb|CAZ89415.1| putative Outer-membrane lipoprotein carrier protein precursor lolA
           [Thiomonas sp. 3As]
          Length = 221

 Score = 74.2 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/198 (14%), Positives = 64/198 (32%), Gaps = 21/198 (10%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEF 66
           + L          AA+     Q +++        +     F Q        A     G+F
Sbjct: 16  LFLAGGLLGASLPAAFAANSVQLLEQ---WLQQTRGASAQFTQTVSNPKGPAQAPATGQF 72

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQH 122
              RP +F + Y+ P +  ++SDG  +  Y+  LD  ++ P+         ++       
Sbjct: 73  AFERPDRFRWDYTKPYAQVIVSDGKQLWTYDHDLDQVTITPVTQAFKGTPAAIF--AGTD 130

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGN------MISVTFDRLSYRLLNWKIMDSSRRYSI 176
           + +    + +++   +          +       I +        +   ++ D+  + S 
Sbjct: 131 LTRLFTLQAQADAGGLQWVQATPKAKDSNFDWIRIGLRSTAQGPEVAELQLRDAFGQIST 190

Query: 177 IKILKYKENTVLDPKVFE 194
           ++    K N    P  F 
Sbjct: 191 MRFTAIKHNPTFGPDSFR 208


>gi|56459775|ref|YP_155056.1| Outer membrane lipoprotein-sorting protein [Idiomarina loihiensis
           L2TR]
 gi|81600266|sp|Q5R0C0|LOLA_IDILO RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|56178785|gb|AAV81507.1| Outer membrane lipoprotein-sorting protein [Idiomarina loihiensis
           L2TR]
          Length = 200

 Score = 74.2 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/193 (13%), Positives = 68/193 (35%), Gaps = 19/193 (9%)

Query: 11  GVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------G 64
            VV     +  F   A+   +  Q+++         Q++   F Q+      +      G
Sbjct: 3   AVVFAMVMAVSFNVFASGDESDKQALQSL---LKQTQSLSAEFEQQVKDEQGEVLQTLSG 59

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNN 120
              + RP+  Y+    P    ++++G  +  YN  ++  ++Y     +      ++ ++N
Sbjct: 60  TLKLKRPANLYWHTKEPDESVMVANGKKVWYYNPFVEQVTIYAQQDMVDDSPLLLVLNSN 119

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
            +  Q        N  F+    +    G+ + + F     +L    ++ +    + + + 
Sbjct: 120 GNQWQNYNVSFRDNRYFV----EHQTNGSKLELRFTDE--KLTEITMVQAQGERTELMLN 173

Query: 181 KYKENTVLDPKVF 193
               N  +  + F
Sbjct: 174 NVALNETISDEQF 186


>gi|288817553|ref|YP_003431900.1| outer membrane lipoprotein carrier protein [Hydrogenobacter
           thermophilus TK-6]
 gi|288786952|dbj|BAI68699.1| outer membrane lipoprotein carrier protein [Hydrogenobacter
           thermophilus TK-6]
 gi|308751155|gb|ADO44638.1| outer membrane lipoprotein carrier protein LolA [Hydrogenobacter
           thermophilus TK-6]
          Length = 200

 Score = 73.8 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/175 (17%), Positives = 67/175 (38%), Gaps = 14/175 (8%)

Query: 34  QSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYFKYSSPSSVSLI 87
           Q+     +    I+T++  F+Q+          V KG F+  +  KF  +Y  P  + ++
Sbjct: 16  QAFSMLEKKLSEIKTLKVAFVQKVSYSWYPKADVSKGFFYAQKGGKFRIEYEQPERMLIV 75

Query: 88  SDGSNIAVYNAKLDT--WSVYPLRYMAFS---VIFSNNQHVIQESIQRVESNNSFITIFF 142
           SDG  I +Y  K  +           A      + S     + + +  ++ +N+  T+  
Sbjct: 76  SDGREILLYYPKEKSAIIDKVENNRSAVVEALFLLSKPISEVFDQVGEIKRDNN-TTLVL 134

Query: 143 KDDFMGNMISVTFDRLSYRL--LNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
           K   + +     +  L   L   + ++ D     + ++ L   +N     ++F I
Sbjct: 135 KPKVIDDNFYRVYVELDEELNIRSIRVEDKDGTTTTVEFLSLSKNFSPSEELFRI 189


>gi|78065551|ref|YP_368320.1| outer-membrane lipoprotein carrier protein [Burkholderia sp. 383]
 gi|77966296|gb|ABB07676.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           383]
          Length = 229

 Score = 73.8 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 35/227 (15%), Positives = 72/227 (31%), Gaps = 32/227 (14%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED--- 57
           M+    +  +G  +      +   +A    T+     +       +++ +G F Q+    
Sbjct: 8   MSLRSTRRWLGAALAGASLMLAATHAFAGGTE-----QLKAFVSQVRSAKGDFTQQIVKA 62

Query: 58  -------------AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS 104
                              G F  ARP KF + Y  P    L +DG  + VY+  L+  +
Sbjct: 63  PAKGASAVQAVPKPTDNSSGTFVFARPGKFIWTYQKPYQQVLQADGEKLYVYDRDLNQVT 122

Query: 105 VYPLR----YMAFSVIFSNNQHVIQESIQRVESNNSFI----TIFFKDDFMGNMISVTFD 156
              L         +++F +N  + +    R       I     +    D     I + F 
Sbjct: 123 ERKLNGALGASPAAILFGSN-DLDKNYTLRDAGEKGGIEWLEMLPKAQDTQFQRIGIGFK 181

Query: 157 RLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
             +   +   + D     +++     + N  L    F+    K  ++
Sbjct: 182 NGTLAAME--LHDVFGNVTLLTFTNIQTNPPLKGDTFKFVVPKGADV 226


>gi|307728948|ref|YP_003906172.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           CCGE1003]
 gi|307583483|gb|ADN56881.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           CCGE1003]
          Length = 245

 Score = 73.8 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 36/228 (15%), Positives = 74/228 (32%), Gaps = 43/228 (18%)

Query: 11  GVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ--------------- 55
           GV      +++   + A+    +Q           + + +GTF+Q               
Sbjct: 23  GVGAAALGASMLVASQAFASGTEQL----KTFVAQVHSARGTFVQQEVRAPGKAQAASSP 78

Query: 56  -----------EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS 104
                              G F  ARP KF ++Y  P +  L +DG  + VY+  L+  +
Sbjct: 79  SAGSGVLSTNGGGKNSTSSGTFTFARPGKFIWQYEKPYAQLLQADGDKLYVYDKDLNQVT 138

Query: 105 VYP----LRYMAFSVI-----FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTF 155
           V      L     +++        N  +    ++    +   +T   KD      + + F
Sbjct: 139 VRSLGGALGASPAAILFGSNDLDKNFTLRDAGVKAG-IDWLELTPKTKDTQFQ-RVGIGF 196

Query: 156 DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
                 L   ++ D     +++     ++N  L    F+    K  ++
Sbjct: 197 --KDGNLQAMELHDVFGNVTLLTFSNIQKNPPLPADAFKFTVPKGADV 242


>gi|330875795|gb|EGH09944.1| lipoprotein chaperone [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
 gi|330965614|gb|EGH65874.1| lipoprotein chaperone [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 207

 Score = 73.8 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 32/206 (15%), Positives = 65/206 (31%), Gaps = 19/206 (9%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEF 66
           +I    +    F+        + V +  +     QT+   F Q   +  G       GE 
Sbjct: 3   LIRMLLATALTFSVIPAHADGKDVARLTQLLEKSQTLTARFSQLTLDGGGTQLQETTGEM 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQH 122
            + RP  F +   +P    ++SDG  +++++  L+  ++  L          ++  +   
Sbjct: 63  ALQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTPALLLSGDVSK 122

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSII 177
           + +      +     I    K           FD L     N  I D        + + I
Sbjct: 123 ISESFDITAKEAGGVIDFVLKPKTKDT----LFDSLRLSFRNGIINDMQLIDSVGQRTNI 178

Query: 178 KILKYKENTVLDPKVFEIPYDKIHNI 203
                K N  +    F+    K  ++
Sbjct: 179 LFTGVKANESIAASKFQFQIPKGADV 204


>gi|28870512|ref|NP_793131.1| outer membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213970052|ref|ZP_03398184.1| outer membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. tomato T1]
 gi|301381408|ref|ZP_07229826.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. tomato Max13]
 gi|302058406|ref|ZP_07249947.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. tomato K40]
 gi|302130345|ref|ZP_07256335.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. tomato NCPPB 1108]
 gi|47117213|sp|Q87ZS6|LOLA_PSESM RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|28853760|gb|AAO56826.1| outer membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213925156|gb|EEB58719.1| outer membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. tomato T1]
 gi|331017253|gb|EGH97309.1| lipoprotein chaperone [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 207

 Score = 73.8 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 35/206 (16%), Positives = 69/206 (33%), Gaps = 19/206 (9%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEF 66
           +I    +    F+        + V +  +     QT+   F Q   +  G       GE 
Sbjct: 3   LIRMLLATALTFSVIPAHADGKDVARLTQLLEKSQTLTARFSQLTLDGGGTQLQETTGEM 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQH 122
            + RP  F +   +P    ++SDG  +++++  L+  ++  L         +++ S +  
Sbjct: 63  ALQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTP-ALLLSGDVS 121

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSII 177
            I ES          +  F       + +   FD L     N  I D        + + I
Sbjct: 122 KISESFDITAKEAGGVIDFMLKPKTKDTL---FDSLRLSFRNGIINDMQLIDSVGQRTNI 178

Query: 178 KILKYKENTVLDPKVFEIPYDKIHNI 203
                K N  +    F+    K  ++
Sbjct: 179 LFTGVKANESIAASKFQFQIPKGADV 204


>gi|296136851|ref|YP_003644093.1| outer membrane lipoprotein carrier protein LolA [Thiomonas
           intermedia K12]
 gi|295796973|gb|ADG31763.1| outer membrane lipoprotein carrier protein LolA [Thiomonas
           intermedia K12]
          Length = 220

 Score = 73.8 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 66/204 (32%), Gaps = 21/204 (10%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGY 60
           ++ +    L     +    AA+     Q +++        +     F Q        A  
Sbjct: 9   RTSLVRFFLAGGLLVTSLPAAFAANSVQLLEQ---WLQQTRGGSAQFTQTVSNPKGPAQA 65

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVI 116
              G+F   RP +F + Y+ P    ++SDG  +  Y+  LD  ++ P+         ++ 
Sbjct: 66  PATGQFAFERPDRFRWDYTKPYGQVIVSDGKQLWTYDHDLDQVTITPVTQAFKGTPAAIF 125

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGN------MISVTFDRLSYRLLNWKIMDS 170
                 + +    + +++   +          +       I +        +   ++ D+
Sbjct: 126 --AGTDLTRLFTLQAQADAGGLQWVQATPKAKDSNFDWIRIGLRSTAQGPEVAELQLRDA 183

Query: 171 SRRYSIIKILKYKENTVLDPKVFE 194
             + S ++    K N    P  F 
Sbjct: 184 FGQISTMRFTAIKHNPTFGPDSFR 207


>gi|295675836|ref|YP_003604360.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           CCGE1002]
 gi|295435679|gb|ADG14849.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           CCGE1002]
          Length = 243

 Score = 73.8 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 34/196 (17%), Positives = 68/196 (34%), Gaps = 33/196 (16%)

Query: 37  KKAIEHFLSIQTMQGTFLQ----------EDAG----------YVMKGEFFMARPSKFYF 76
           ++       + + +GTF+Q            +G              G F  ARP KF +
Sbjct: 49  EQLKAFVSQVHSARGTFVQQEVRAPSKAQGASGALSTANPTKPTTSSGTFMFARPGKFIW 108

Query: 77  KYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVI-----FSNNQHVIQES 127
           +Y  P S  L +DG  + VY+  L+  +V  L         +++        N  +    
Sbjct: 109 QYEKPYSQLLQADGDKLFVYDKDLNQVTVRALGNALGASPAAILFGSNDLDKNFTLRDAG 168

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
           ++    +   +T   KD      + + F      L   ++ D     +++     ++N  
Sbjct: 169 VKAG-IDWLELTPKAKDTQFE-RVGIGF--KDGNLEAMELHDVFGNVTLLTFSNIQKNPQ 224

Query: 188 LDPKVFEIPYDKIHNI 203
           L    F+    K  ++
Sbjct: 225 LPSDAFKFTVPKGADV 240


>gi|330826247|ref|YP_004389550.1| outer-membrane lipoprotein carrier protein [Alicycliphilus
           denitrificans K601]
 gi|329311619|gb|AEB86034.1| Outer-membrane lipoprotein carrier protein [Alicycliphilus
           denitrificans K601]
          Length = 210

 Score = 73.8 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 34/206 (16%), Positives = 70/206 (33%), Gaps = 25/206 (12%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-----DAG-----YVMKGEFFM 68
           +AI    +A   + D  +K   +   +  + +  F Q        G      +  G F  
Sbjct: 6   AAILIAVSAQWASADG-LKSLEQFMAAAHSGRADFTQTVTAPAKDGQAQRPKLSSGSFEF 64

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHV- 123
            RP +F F Y  P   ++++DG  + +Y+A L+  +  P    L     + + ++   + 
Sbjct: 65  QRPGRFKFVYKKPFEQTIVADGKTLWLYDADLNQVTERPQAQALGSTP-AALLTSAPDLA 123

Query: 124 ---IQESIQRVESNNSFITIFFKDDFMGNMISVT---FDRLSYRLLNWKIMDSSRRYSII 177
                  +Q     +    +          +      F+    RL    I+D   + S I
Sbjct: 124 ALRADYQLQSAPEQDGLQWVLATPKASEGQLKSVRVGFEGD--RLAALDIVDGFGQRSQI 181

Query: 178 KILKYKENTVLDPKVFEIPYDKIHNI 203
           +    + N  L    F+       ++
Sbjct: 182 RFSGMQINPALPAGTFQFKPPAGADV 207


>gi|66046407|ref|YP_236248.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. syringae B728a]
 gi|9910773|sp|Q9Z3U0|LOLA_PSEU2 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|4063381|gb|AAC98299.1| periplasmic chaperone protein [Pseudomonas syringae pv. syringae]
 gi|63257114|gb|AAY38210.1| Outer membrane lipoprotein carrier protein LolA [Pseudomonas
           syringae pv. syringae B728a]
 gi|330972889|gb|EGH72955.1| lipoprotein chaperone [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 207

 Score = 73.4 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 35/206 (16%), Positives = 69/206 (33%), Gaps = 19/206 (9%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEF 66
           +I    +    F+        + V +  +     QT+   F Q   +  G       GE 
Sbjct: 3   LIRMLLATALTFSMIPAHADSKDVARLTQLLEKSQTLTARFSQLTLDGGGTQLQETTGEM 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQH 122
            + RP  F +   +P    ++SDG  +++++  L+  ++  L         +++ S +  
Sbjct: 63  ALQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTP-ALLLSGDVS 121

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSII 177
            I ES          +  F       + +   FD L     N  I D        + + I
Sbjct: 122 KISESFDITAKEAGGVIDFTLKPKTKDTL---FDSLRLSFRNGIINDMQLIDSVGQRTNI 178

Query: 178 KILKYKENTVLDPKVFEIPYDKIHNI 203
                K N  +    F+    K  ++
Sbjct: 179 LFTGVKANESIAASKFQFQIPKGADV 204


>gi|304388134|ref|ZP_07370260.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis ATCC 13091]
 gi|304337904|gb|EFM04047.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis ATCC 13091]
          Length = 207

 Score = 73.4 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 66/201 (32%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     +    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFKFLAVCSLTVSVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+SP   +++ DG  + +Y+  L   +               I SN   +   
Sbjct: 67  PDLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPA-AILSNKTALESS 125

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 126 YTLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 183

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             N  L    F+    K  ++
Sbjct: 184 NTNPQLSRGAFKFTPPKGVDV 204


>gi|170698491|ref|ZP_02889562.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           ambifaria IOP40-10]
 gi|171315513|ref|ZP_02904749.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           ambifaria MEX-5]
 gi|172059903|ref|YP_001807555.1| outer-membrane lipoprotein carrier protein [Burkholderia ambifaria
           MC40-6]
 gi|170136575|gb|EDT04832.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           ambifaria IOP40-10]
 gi|171099350|gb|EDT44088.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           ambifaria MEX-5]
 gi|171992420|gb|ACB63339.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           ambifaria MC40-6]
          Length = 229

 Score = 73.4 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/227 (14%), Positives = 72/227 (31%), Gaps = 32/227 (14%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED--- 57
           ++    +  +G  +      +   +A    T+     +       +++ +G F Q+    
Sbjct: 8   LSLRSTRRWLGAALAGASLMLAATHAFASGTE-----QLKAFVSQVRSAKGEFTQQIVKA 62

Query: 58  -------------AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS 104
                              G F  +RP KF + Y  P    L +DG  + VY+  L+  +
Sbjct: 63  PSKGASAAQAAPKPNDNSSGTFVFSRPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVT 122

Query: 105 VYPLR----YMAFSVIFSNNQHVIQESIQRVESNNSFI----TIFFKDDFMGNMISVTFD 156
              L         +++F +N  + +    R       I     +    D     I + F 
Sbjct: 123 ERKLNGALGASPAAILFGSN-DLDKNYTLRDAGEKGGIDWLEMLPKAQDTQFQRIGIGFR 181

Query: 157 RLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
             +   +   + D     +++     + N  L    F+    K  ++
Sbjct: 182 NGTLAAME--LHDVFGNVTLLTFTNIQTNPPLKGDTFKFVVPKGADV 226


>gi|115350890|ref|YP_772729.1| outer-membrane lipoprotein carrier protein [Burkholderia ambifaria
           AMMD]
 gi|115280878|gb|ABI86395.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           ambifaria AMMD]
          Length = 229

 Score = 73.4 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/227 (14%), Positives = 72/227 (31%), Gaps = 32/227 (14%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED--- 57
           ++    +  +G  +      +   +A    T+     +       +++ +G F Q+    
Sbjct: 8   LSLRSTRRWLGAALAGASLMLAATHAFASGTE-----QLKAFVSQVRSAKGEFTQQIVKA 62

Query: 58  -------------AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS 104
                              G F  +RP KF + Y  P    L +DG  + VY+  L+  +
Sbjct: 63  PSKGASAAQAAPKPNDNSSGTFVFSRPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVT 122

Query: 105 VYPLR----YMAFSVIFSNNQHVIQESIQRVESNNSFI----TIFFKDDFMGNMISVTFD 156
              L         +++F +N  + +    R       I     +    D     I + F 
Sbjct: 123 ERKLNGALGASPAAILFGSN-DLDKNYTLRDAGEKGGIDWLEMLPKAQDTQFQRIGIGFR 181

Query: 157 RLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
             +   +   + D     +++     + N  L    F+    K  ++
Sbjct: 182 NGTLAAME--LHDVFGNVTLLTFTNIQTNPPLRGDTFKFVVPKGADV 226


>gi|120612078|ref|YP_971756.1| outer membrane lipoprotein carrier protein LolA [Acidovorax
           citrulli AAC00-1]
 gi|120590542|gb|ABM33982.1| outer membrane lipoprotein carrier protein LolA [Acidovorax
           citrulli AAC00-1]
          Length = 211

 Score = 73.4 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/206 (15%), Positives = 70/206 (33%), Gaps = 22/206 (10%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE----------DAGYVMKGEFF 67
           + AI              +          Q  +  F Q                  G F 
Sbjct: 5   WMAIAAIAVGAQSAWADGLASLESFMKGAQAGRADFTQTVTSPPKDGQASRTRTSSGTFE 64

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFS--NNQ 121
             RP +F F Y+ P + ++++DG ++ +Y+A L+  +       L     +++ S  + Q
Sbjct: 65  FQRPGRFKFTYTKPFAQTIVADGKSLWLYDADLNQVTQRAQAQALGTTPAALLASAPDLQ 124

Query: 122 HVIQE-SIQRVESNNSFITIFFKDDFMGNMISVT---FDRLSYRLLNWKIMDSSRRYSII 177
            + ++ +++     +    +          +      F     +L    I+DS  + S+I
Sbjct: 125 ALRKDFTLESAPDQDGLQWVLATPRTRDGQLKSVRVGFQGE--QLAALDILDSFGQRSVI 182

Query: 178 KILKYKENTVLDPKVFEIPYDKIHNI 203
           +    + +  L    FE    +  ++
Sbjct: 183 RFANVQSSASLPASTFEFKPPQGADV 208


>gi|237809055|ref|YP_002893495.1| outer membrane lipoprotein carrier protein LolA [Tolumonas auensis
           DSM 9187]
 gi|237501316|gb|ACQ93909.1| outer membrane lipoprotein carrier protein LolA [Tolumonas auensis
           DSM 9187]
          Length = 207

 Score = 73.4 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 74/184 (40%), Gaps = 12/184 (6%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHF-LSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYS 79
               ++A    K  S ++   HF   +   QG  LQ+ +G ++     + RP  F ++  
Sbjct: 23  ALADDSAALKKKLASFRQFSAHFEQEVLDAQGKPLQKGSGEMV-----LQRPDHFRWEAK 77

Query: 80  SPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNN 135
            P    ++SDG  + +Y+  ++  +V  L        F +I S +  +    +   + + 
Sbjct: 78  QPDDNLILSDGKAVWLYDPFVEQVTVMSLSKAVINTPFLLISSTDDKIWNNYLIDQDGSA 137

Query: 136 SFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
             IT   KD  + + + + FD  + R+   ++ ++  + S   +  +    V+    F  
Sbjct: 138 FTITSKKKDQRIES-LRMVFDSQN-RISRMEVNEAQGQRSEFTLSSFNTKPVIKSDTFNF 195

Query: 196 PYDK 199
              +
Sbjct: 196 KAPE 199


>gi|325528342|gb|EGD05495.1| lipoprotein chaperone [Burkholderia sp. TJI49]
          Length = 229

 Score = 73.4 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 34/227 (14%), Positives = 70/227 (30%), Gaps = 32/227 (14%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED--- 57
           M+    +   G  +      +   +A    T+     +       ++  +G F Q+    
Sbjct: 8   MSLRSTRRWFGAALAGASLMLAATHAFASGTE-----QLRAFVSQVRAAKGEFTQQIVKA 62

Query: 58  -------------AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS 104
                              G F  +RP KF + Y  P    L +DG  + VY+  L+  +
Sbjct: 63  PSKGASAAQAAPKPNDNSSGTFVFSRPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVT 122

Query: 105 VYPLR----YMAFSVIFSNNQHVIQESIQRVESNNSFI----TIFFKDDFMGNMISVTFD 156
              L         +++F +N  + +    R       I     +    D     I + F 
Sbjct: 123 ERKLNGALGASPAAILFGSN-DLDKNYTLRDAGEKGGIDWLEMLPKAQDTQFQRIGIGFR 181

Query: 157 RLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
             +   +   + D     +++     + N  L    F+    K  ++
Sbjct: 182 NGTLAAME--LHDVFGNVTLLTFTNIQTNPPLKADTFKFVVPKGADV 226


>gi|134094253|ref|YP_001099328.1| outer-membrane lipoprotein carrier protein [Herminiimonas
           arsenicoxydans]
 gi|133738156|emb|CAL61201.1| Outer-membrane lipoprotein carrier protein precursor [Herminiimonas
           arsenicoxydans]
          Length = 225

 Score = 73.0 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 40/223 (17%), Positives = 77/223 (34%), Gaps = 32/223 (14%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ----EDAG 59
           L  K++   + LF    +             ++ +      S Q+ +G F Q     D+G
Sbjct: 10  LTAKTIDLRIALFATVLVAGALLLTAQAHAAALDQFKSFVSSTQSARGEFTQQLVKVDSG 69

Query: 60  Y-----VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRY 110
                    G F  ARP KF + Y  P    L +DG  + +Y+  L+  ++      L  
Sbjct: 70  TTKVSNKSTGTFTFARPGKFIWTYQKPYEQLLQADGEKLYIYDKDLNQVTIKKLGDALGS 129

Query: 111 MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFD----------RLSY 160
              +++F +N      +++   + N    +              FD            + 
Sbjct: 130 SPAAILFGSNDLEKNFTLKEAGTKNGLEWLEATPKAKDTT----FDHIGIGLRNGAPEAM 185

Query: 161 RLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            L      DS  + S++   K+++N  L    F+    K  ++
Sbjct: 186 ELR-----DSFGQVSLLSFTKFEKNPPLPANQFKFAVPKGADV 223


>gi|312795384|ref|YP_004028306.1| outer-membrane lipoproteins carrier protein [Burkholderia
           rhizoxinica HKI 454]
 gi|312167159|emb|CBW74162.1| Outer-membrane lipoproteins carrier protein [Burkholderia
           rhizoxinica HKI 454]
          Length = 248

 Score = 73.0 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/203 (15%), Positives = 67/203 (33%), Gaps = 27/203 (13%)

Query: 26  AAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------EDAGYV------------MKGEFF 67
           AA P        +       +++  G F+Q        +                 G F 
Sbjct: 45  AAVPCAHASGTAQLKAFVAQVRSADGEFVQRQVKAAGGSASQAQGQAARTSMATSSGTFR 104

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHV 123
            ARP +F + Y  P    L SDG  + V++  L+  +   L         +++F +N   
Sbjct: 105 FARPGRFVWAYQKPYEQLLQSDGDKLYVWDKDLNQVTARALNGVLGASPAAILFGSNDLE 164

Query: 124 IQESIQ--RVESNNSFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
              +++   V+    ++ +  K        + + F   +   +   + D     +++   
Sbjct: 165 KNFTLRDAGVKQGIDWLELVPKSRDTQFERVGIGFRDGNLEAME--LHDVFGNVTLLTFS 222

Query: 181 KYKENTVLDPKVFEIPYDKIHNI 203
              +N  L    F+    K  ++
Sbjct: 223 NIHKNPALPANTFKFTVPKGADV 245


>gi|162147680|ref|YP_001602141.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786257|emb|CAP55839.1| putative outer membrane lipoprotein carrier protein LolA
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 182

 Score = 73.0 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/140 (12%), Positives = 49/140 (35%), Gaps = 3/140 (2%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARP 71
           ++L    A+    AA      + V +   +  + + +     Q    G V +G      P
Sbjct: 11  LVLTAPLALAACQAAPGPVGGRDVARIERYLNTTRGLSAHVAQTWPDGGVGEGTLSYD-P 69

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQR 130
                 Y +P  + L++ G ++   +A   + +   L      ++ +   H+  E ++  
Sbjct: 70  GYLRLDYDTPHRMRLVAAGGHLVFRDAVRQSVTRMNLSRQPLGLLLATPVHLGGEVTVTA 129

Query: 131 VESNNSFITIFFKDDFMGNM 150
           ++  +  + +        + 
Sbjct: 130 IQHGDHVLQVSLARTANPSQ 149


>gi|134295003|ref|YP_001118738.1| outer-membrane lipoprotein carrier protein [Burkholderia
           vietnamiensis G4]
 gi|134138160|gb|ABO53903.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           vietnamiensis G4]
          Length = 229

 Score = 73.0 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 34/213 (15%), Positives = 65/213 (30%), Gaps = 27/213 (12%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED----------------A 58
           L    A      A         ++       +++ +G F Q+                  
Sbjct: 17  LGAALAGASLMLAATHAFAGGTEQLKAFVSQVRSARGDFTQQIVKAPAKGASAAQVAPKP 76

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFS 114
                G F  ARP KF + Y  P    L +DG  + VY+  L+  +   L         +
Sbjct: 77  NDNSSGTFVFARPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLNGALGASPAA 136

Query: 115 VIFSNNQHVIQESIQRVESNNSFI----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
           ++F +N  + +    R       I     +    D     I + F   +   +   + D 
Sbjct: 137 ILFGSN-DLDKNYTLRDAGEKGGIDWLEMLPKAQDTQFQRIGIGFRNGTLAAME--LHDV 193

Query: 171 SRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
               +++     + N  L    F+    K  ++
Sbjct: 194 FGNVTLLTFTNIQTNPPLKSDTFKFVVPKGADV 226


>gi|325206530|gb|ADZ01983.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis M04-240196]
          Length = 207

 Score = 73.0 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 67/201 (33%), Gaps = 15/201 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK----GEFFMAR 70
           LF + A+     +    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCSLTVSVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P+ F ++Y+SP   +++ DG  + +Y+  L   +               I SN   +   
Sbjct: 67  PALFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPA-AILSNKTALESS 125

Query: 127 SIQRVESNNSFITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              + + +++ I          N     I + F   +   +   + DS    + I     
Sbjct: 126 YTLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQ--LKDSFGNQTSISFGGL 183

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
             N  L    F+    K  ++
Sbjct: 184 NTNPQLSRGAFKFTPPKGVDV 204


>gi|304311213|ref|YP_003810811.1| Outer-membrane lipoprotein carrier protein [gamma proteobacterium
           HdN1]
 gi|301796946|emb|CBL45159.1| Outer-membrane lipoprotein carrier protein [gamma proteobacterium
           HdN1]
          Length = 226

 Score = 72.6 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 32/189 (16%), Positives = 67/189 (35%), Gaps = 17/189 (8%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV------MKGEFFMARPSKFYFKYSSPSS 83
           +  +Q V   +     +++   TF Q  +         + G  ++ RP  F +  + P  
Sbjct: 36  LASEQGVTGLVRDLSMMKSFNATFHQWVSDAQNHVLQEVTGTMWVQRPGLFRWDTNDPYP 95

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFIT 139
             +ISDG  + +Y+  L+  +   L          ++  + + + +    R        T
Sbjct: 96  QQIISDGEVLWIYDLDLEQATKRKLDKQVGNTPALLLSGDPEKLAESFTVRASMYEE--T 153

Query: 140 IFFKDDFMGNMISVTFDRLSYRLLNWKIM-----DSSRRYSIIKILKYKENTVLDPKVFE 194
              + D +       F+ L     + KI      D+  + + I+      N  +D KVF 
Sbjct: 154 GEVRYDLIPKHKGALFELLRVHFRSGKIHDMFLRDNLGQTTRIEFETKAFNKPIDAKVFA 213

Query: 195 IPYDKIHNI 203
               K  ++
Sbjct: 214 FKPPKGVDV 222


>gi|183220783|ref|YP_001838779.1| outer membrane lipoprotein carrier protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
 gi|189910883|ref|YP_001962438.1| outer membrane lipoprotein-sorting protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167775559|gb|ABZ93860.1| Outer membrane lipoprotein-sorting protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167779205|gb|ABZ97503.1| Outer-membrane lipoprotein carrier protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
          Length = 233

 Score = 72.6 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 35/207 (16%), Positives = 70/207 (33%), Gaps = 24/207 (11%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFL----QEDAGYVMKGEFF 67
           +++L          A    +  + VKK  ++F  I +    FL           M+G+ F
Sbjct: 9   LLVLGVSLEAQTSPAHNWHSPSEVVKKIKKNFSEINSYSADFLIKTEDNKKEKQMRGKCF 68

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW-----------SVYPLRYM--AFS 114
             RP K  + +S P    ++SDG  + ++  +L              S  P+        
Sbjct: 69  YKRPGKIRYNFSEPDGDEIVSDGKTLHIFIKRLGAVGKQDLTLDRKNSSGPIFTTNSPDG 128

Query: 115 V-IFSNNQHVIQESIQRVESNNS----FITIFFKDDFMGN--MISVTFDRLSYRLLNWKI 167
           +       H   ++I++  S       F+    + + +G    + +  D  SY +     
Sbjct: 129 LNRLFRKYHYKFDTIEQPRSMGDSAKYFVLDLDQREKIGGFEKMKLFVDSESYLIKKAVA 188

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVFE 194
            D   + + I       +  +   VF 
Sbjct: 189 TDGRGKVTTISFSNINFSEEIQDGVFN 215


>gi|206890469|ref|YP_002248971.1| outer membrane lipoprotein carrier protein LolA
           [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206742407|gb|ACI21464.1| outer membrane lipoprotein carrier protein LolA
           [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 203

 Score = 72.6 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 35/192 (18%), Positives = 65/192 (33%), Gaps = 14/192 (7%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFF 67
           IL     IF F A     +D ++ K    + +I    GTF+Q       D     KG+FF
Sbjct: 3   ILLINLFIFLF-ANLVFAQDNAITKLNNAYKNINDASGTFIQTSYIKDLDKTQKFKGKFF 61

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAFSVIFSNNQH 122
           +    +  ++Y       +  +   + VY+                  +    + S    
Sbjct: 62  IK-ADRIRWQYEGQFPQIIYLNKETLIVYDKIRKQAIQSSFSEEKYGQLPL-ALLSRMAD 119

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
           + ++     +S N+ I I          I +      + + + KI D++     I     
Sbjct: 120 IEKDFEITEKSENTLILIPKTKMGNIKKIELIIHEEDFPIKSLKITDNASNTVKIDFYSV 179

Query: 183 KENTVLDPKVFE 194
           K N  L   +F+
Sbjct: 180 KININLKDSIFK 191


>gi|149928210|ref|ZP_01916455.1| outer-membrane lipoprotein carrier protein precursor [Limnobacter
           sp. MED105]
 gi|149823101|gb|EDM82341.1| outer-membrane lipoprotein carrier protein precursor [Limnobacter
           sp. MED105]
          Length = 211

 Score = 72.6 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 67/190 (35%), Gaps = 21/190 (11%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAG---YVMKGEFFMARPSK 73
           A+     A       +         +    +G F Q     +G       GEF  +RP K
Sbjct: 13  ALLISTGAVGSAWASAQDALNNFVKNRGFAEGQFSQVVISPSGAVKQRGTGEFTFSRPGK 72

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQ-----HVI 124
           F ++   P  + L+S+GS++  Y+  +   +  P+         +++F +       ++ 
Sbjct: 73  FRWEIKKPYPLLLLSNGSSVVSYDEDMGHATQKPIGNAMDSTPVALLFGSKDVDKLFNLK 132

Query: 125 QESIQRVESNNSFITIFFKDD-FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
            E ++  +     I    KD  F    I    D L   L    I D+  + + +++  + 
Sbjct: 133 DEGMKDGKEW-LVIRPKDKDSLFDYARIGWK-DGLPVNLE---IHDALGQVTQLELSNWD 187

Query: 184 ENTVLDPKVF 193
            +       F
Sbjct: 188 FSKQRPAGFF 197


>gi|294669469|ref|ZP_06734536.1| hypothetical protein NEIELOOT_01366 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308382|gb|EFE49625.1| hypothetical protein NEIELOOT_01366 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 208

 Score = 72.6 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 47/143 (32%), Gaps = 11/143 (7%)

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSV 115
               G F + RP  F ++YS P   +++ DG +I +Y+  L   +             S 
Sbjct: 57  QTSGGTFQIMRPGLFRWEYSKPYKQTIVGDGQHIWLYDVDLKQVTKSDQSQAIGDSPAS- 115

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNM----ISVTFDRLSYRLLNWKIMDSS 171
           I S+   +      + + +   I          N     I + F   +   +   + D  
Sbjct: 116 ILSDKNALDSSYSLKEDGSGDGIDYVLATPKKNNAGYQFIRIGFKGETLAAME--LKDGF 173

Query: 172 RRYSIIKILKYKENTVLDPKVFE 194
              + IK      +  L    F+
Sbjct: 174 GNQTSIKFSNVNTHPNLSRGNFK 196


>gi|325266750|ref|ZP_08133424.1| outer membrane lipoprotein carrier protein LolA [Kingella
           denitrificans ATCC 33394]
 gi|324981798|gb|EGC17436.1| outer membrane lipoprotein carrier protein LolA [Kingella
           denitrificans ATCC 33394]
          Length = 205

 Score = 72.6 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 62/190 (32%), Gaps = 15/190 (7%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE----DAGYVMKGEFFMARP 71
            F +AI    AA    +  ++    +       + G F Q     +      G F + RP
Sbjct: 8   AFGTAIVCLMAAQ--AQAGAIDALKQFNSDADGISGNFTQTVRARNKNQTASGTFQILRP 65

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS---VIFSNNQHVIQESI 128
             F + Y+ P    ++ DGS+I +Y+  L   +              I SN   +     
Sbjct: 66  GLFKWSYTRPYKQVIVGDGSHIWLYDMDLKQVTRSNQDQTIGDSPAAILSNKSALESSYT 125

Query: 129 QRVESNNSFITIFFKDDFMGNM----ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
            + + N + I          N     I + F   +   +   + DS    + I+  +   
Sbjct: 126 LKEDGNKNGIDYVLATPRKNNAGYQFIRIGFKGNALAAME--LKDSFGNQTTIQFNQLNT 183

Query: 185 NTVLDPKVFE 194
              L    F+
Sbjct: 184 KPNLSRSAFK 193


>gi|332306868|ref|YP_004434719.1| outer membrane lipoprotein carrier protein LolA [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332174197|gb|AEE23451.1| outer membrane lipoprotein carrier protein LolA [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 220

 Score = 72.3 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 79/214 (36%), Gaps = 15/214 (7%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ--EDA 58
           M  + Y S +G V      A+    +AY    D+   K      ++      F Q   DA
Sbjct: 8   MKKMKYSSALGKVSAILCLAMGLAFSAYAQQSDE--DKLKTRLETLNYFSADFTQKVTDA 65

Query: 59  G----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM--- 111
                    G   + +P+K Y++   P+   LI+DG+ +   +  ++  +          
Sbjct: 66  NHEVLQEATGVIKLKQPNKLYWELDPPNENILIADGTTLWNVDPFVEQVTAINQSQAVAN 125

Query: 112 -AFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
               ++   N     +      ++   I     D  + + + + FD    +L +  + DS
Sbjct: 126 NPLILLTQPNSDAWGDFTVTHTNDTFRIDAKSPDSAVHS-LVLVFDGE--QLSSMSMQDS 182

Query: 171 SRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
            ++ S +     ++N  L  +VF     + ++++
Sbjct: 183 QQQISDLYFDNIQQNKALSDEVFTFTLPEGYDLD 216


>gi|121595681|ref|YP_987577.1| outer membrane lipoprotein carrier protein LolA [Acidovorax sp.
           JS42]
 gi|120607761|gb|ABM43501.1| outer membrane lipoprotein carrier protein LolA [Acidovorax sp.
           JS42]
          Length = 210

 Score = 72.3 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 29/189 (15%), Positives = 60/189 (31%), Gaps = 24/189 (12%)

Query: 36  VKKAIEHFLSIQTMQGTFLQE----------DAGYVMKGEFFMARPSKFYFKYSSPSSVS 85
           +K       S Q+ +  F Q                  G F   RP +F F Y  P    
Sbjct: 22  LKSLETFMKSAQSGRSEFTQTVTSPPKDGQAGRTKTSSGSFEFQRPGRFKFHYRKPFEQL 81

Query: 86  LISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHV----IQESIQRVESNNSF 137
           +++DG  + +Y+A L+  +       L       + ++   +       +++     +  
Sbjct: 82  IVADGQTLWLYDADLNQVTQRTQSKALGSTPA-ALLASAPDLAALRADFALESAPEQDGL 140

Query: 138 ITIFFKDDFMGNMISVT---FDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
             +          +      F     +L    I+DS  + S+I+    + N  L    F+
Sbjct: 141 QWVLATPKAKDGQLKSVRVGFAGE--QLAALDILDSFGQRSLIRFTGMQLNPALPAGTFQ 198

Query: 195 IPYDKIHNI 203
                  ++
Sbjct: 199 FKPPAGADV 207


>gi|222111889|ref|YP_002554153.1| outer membrane lipoprotein carrier protein lola [Acidovorax ebreus
           TPSY]
 gi|221731333|gb|ACM34153.1| outer membrane lipoprotein carrier protein LolA [Acidovorax ebreus
           TPSY]
          Length = 212

 Score = 72.3 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 29/189 (15%), Positives = 60/189 (31%), Gaps = 24/189 (12%)

Query: 36  VKKAIEHFLSIQTMQGTFLQE----------DAGYVMKGEFFMARPSKFYFKYSSPSSVS 85
           +K       S Q+ +  F Q                  G F   RP +F F Y  P    
Sbjct: 24  LKSLETFMKSAQSGRSEFTQTVTSPPKDGQAGRTKTSSGSFEFQRPGRFKFHYRKPFEQL 83

Query: 86  LISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHV----IQESIQRVESNNSF 137
           +++DG  + +Y+A L+  +       L       + ++   +       +++     +  
Sbjct: 84  IVADGQTLWLYDADLNQVTQRTQSKALGSTPA-ALLASAPDLAALRADFALESAPEQDGL 142

Query: 138 ITIFFKDDFMGNMISVT---FDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
             +          +      F     +L    I+DS  + S+I+    + N  L    F+
Sbjct: 143 QWVLATPKAKDGQLKSVRVGFAGE--QLAALDILDSFGQRSLIRFTGMQLNPALPAGTFQ 200

Query: 195 IPYDKIHNI 203
                  ++
Sbjct: 201 FKPPAGADV 209


>gi|163855885|ref|YP_001630183.1| outer-membrane lipoprotein carrier protein [Bordetella petrii DSM
           12804]
 gi|163259613|emb|CAP41914.1| lolA [Bordetella petrii]
          Length = 208

 Score = 72.3 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 29/172 (16%), Positives = 60/172 (34%), Gaps = 19/172 (11%)

Query: 38  KAIEHFLSIQTMQGTFLQEDAGYV------MKGEFFMARPSKFYFKYSSPSSVSLISDGS 91
           +       I++  G+F Q   G          G F   RP KF +  S P    ++SDG 
Sbjct: 29  QLKSFVADIKSATGSFTQSTTGPQGRTQRPQSGTFAFQRPGKFKWAVSQPYEQLVVSDGQ 88

Query: 92  NIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFK---- 143
            +  Y+  L   +   +         +++F +        +  + + +    +  K    
Sbjct: 89  QLYQYDPDLAQVTSRKVDQAIGTSPAAILFGSGNLEQAFQVAPLPARDGLEWLRAKPRNA 148

Query: 144 -DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
              F    I +  D L  R+    ++D+  + + +++   + N  L    F 
Sbjct: 149 DAGFAQVDIGMK-DNLPVRVE---LLDAFGQTTRVELSNIQANPALPASEFR 196


>gi|330900605|gb|EGH32024.1| lipoprotein chaperone [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 207

 Score = 71.9 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 32/206 (15%), Positives = 65/206 (31%), Gaps = 19/206 (9%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEF 66
           +I    +    F+        + V +  +     QT+   F Q   +  G       GE 
Sbjct: 3   LIRMLLATALTFSMIPAHADSKDVARLTQLLEKSQTLTPRFSQLTLDGGGTQLQETTGEM 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQH 122
            + RP  F +   +P    ++SDG  +++++  L+  ++  L          ++  +   
Sbjct: 63  ALQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTPALLLSGDVSK 122

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS-----RRYSII 177
           + +      +     I    K           FD L     N  I D        + + I
Sbjct: 123 ISESFDITAKEAGGVIDFVLKPKTKDT----LFDSLRLSFRNGIINDMQLIDSVGQRTNI 178

Query: 178 KILKYKENTVLDPKVFEIPYDKIHNI 203
                K N  +    F+    K  ++
Sbjct: 179 LFTGVKANESIAASKFQFQIPKGADV 204


>gi|170691966|ref|ZP_02883130.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           graminis C4D1M]
 gi|170143250|gb|EDT11414.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           graminis C4D1M]
          Length = 252

 Score = 71.5 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 43/250 (17%), Positives = 79/250 (31%), Gaps = 53/250 (21%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLS-----------IQTMQG 51
           F    +  G V  F + A      A  +    SV  A + F S           + + +G
Sbjct: 4   FAQQHAQSGRVGRFAHLARALARTAGTVAIGASVLVASQAFASGTEQLKAFVSQVHSARG 63

Query: 52  TFLQ-----------------------------EDAGYVMKGEFFMARPSKFYFKYSSPS 82
           TF+Q                                     G F  ARP KF ++Y  P 
Sbjct: 64  TFVQQEVRAPGKAQGASGGSGGSGASGVLSTTGGSKNSTSSGTFTFARPGKFIWQYEKPY 123

Query: 83  SVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVI-----FSNNQHVIQESIQRVES 133
           +  L +DG  + VY+  L+  +V      L     +++        N  +    ++    
Sbjct: 124 AQLLQADGDKLYVYDKDLNQVTVRSLGGALGASPAAILFGSNDLDKNFTLRDAGVKAG-I 182

Query: 134 NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
           +   +T   KD      + + F      L   ++ D     +++     ++N  L    F
Sbjct: 183 DWLELTPKAKDTQFQ-RVGIGF--KDGNLQAMELHDVFGNVTLLTFSNIQKNPPLPADAF 239

Query: 194 EIPYDKIHNI 203
           +    K  ++
Sbjct: 240 KFTVPKGADV 249


>gi|186475402|ref|YP_001856872.1| outer-membrane lipoprotein carrier protein [Burkholderia phymatum
           STM815]
 gi|184191861|gb|ACC69826.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           phymatum STM815]
          Length = 231

 Score = 71.5 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 74/220 (33%), Gaps = 38/220 (17%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED---------------- 57
            L F +++   + A+    +Q  +        +++ +G F+Q +                
Sbjct: 17  ALAFGASMLITSHAFASGTEQLKQ----FVSQVRSARGEFVQTEVRAPSNAQQQASGVLS 72

Query: 58  -----AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PL 108
                   V  G F  ARP KF + Y  P +  L +DG  + VY+  L+  +V      L
Sbjct: 73  TQNASQNKVSSGSFTFARPGKFIWAYEKPYAQLLQADGDKLYVYDKDLNQVTVRKLGGAL 132

Query: 109 RYMAFSVI-----FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLL 163
                +++        N  +    ++        I       F    + + F   +   +
Sbjct: 133 GASPAAILFGSNDLDKNFTLKDAGVKAGIDWLELIPKSKDTQFQ--RVGIGFKEGNLEAM 190

Query: 164 NWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
              + D     +++K    ++N  L    F+    K  ++
Sbjct: 191 E--LHDVFGNVTLLKFSNIQKNPSLPADAFKFTVPKGADV 228


>gi|254480621|ref|ZP_05093868.1| outer membrane lipoprotein carrier protein LolA [marine gamma
           proteobacterium HTCC2148]
 gi|214039204|gb|EEB79864.1| outer membrane lipoprotein carrier protein LolA [marine gamma
           proteobacterium HTCC2148]
          Length = 207

 Score = 71.5 bits (174), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 62/174 (35%), Gaps = 13/174 (7%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQED-------AGYVMKGEFFMARPSKFYFKYSSPSS 83
           + + + ++ I    S+  +QG F Q            +  G F + +P  F +   SP +
Sbjct: 21  SNESATEQLIVELESLNQLQGRFEQTQFAADQDQPSALSSGHFKLLKPMYFLWDIDSPDN 80

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQESIQRVESNNSFIT 139
             +++DG ++  ++  L+T +   +          V+  +   + +           F+ 
Sbjct: 81  QLIVADGEHLWHHDRDLETVTRRSVAGHDQLSPLQVLAGDRAILSERFEVSRTGEGRFLL 140

Query: 140 IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
           +          +++ F       +   + D   +   I++     +T L P  F
Sbjct: 141 VPIDGSPGFRSLTLVFANGQISAME--VNDQLNQRLFIQLQDVDSDTALMPADF 192


>gi|299138877|ref|ZP_07032054.1| outer membrane lipoprotein carrier protein LolA [Acidobacterium sp.
           MP5ACTX8]
 gi|298599031|gb|EFI55192.1| outer membrane lipoprotein carrier protein LolA [Acidobacterium sp.
           MP5ACTX8]
          Length = 210

 Score = 71.1 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 29/192 (15%), Positives = 60/192 (31%), Gaps = 14/192 (7%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----YVMKGEFFMA 69
           +L  +    P  A  P T      +   H+  +Q++Q  + +   G        G   + 
Sbjct: 4   LLLLFVLASPLAAQSP-TAASLAHQVDAHYNHLQSLQARYTERYQGMGLDRTETGSLTLR 62

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY-----MAFSVIFSNNQHVI 124
           +P +  + Y SP+    I DG N   Y          P +           +  + +   
Sbjct: 63  KPGRMRWSYDSPAGKLFILDGKNAISYTPGDAQAQRIPEKQLDDLRSPLRFLLGHTELAK 122

Query: 125 QESIQRVESNNSFITIFFKDDFMGNM---ISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           +     + + N   T+      M      +++T D  +  +   +I ++    +      
Sbjct: 123 ELDGLSLTAVNGGYTLSGTPKGMQQRVRSLALTVDS-TGTIHTMRIEETDGATTTFTFTD 181

Query: 182 YKENTVLDPKVF 193
             EN       F
Sbjct: 182 MHENIPTKDSDF 193


>gi|221213646|ref|ZP_03586620.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           multivorans CGD1]
 gi|221166435|gb|EED98907.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           multivorans CGD1]
          Length = 229

 Score = 71.1 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 70/223 (31%), Gaps = 32/223 (14%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED------- 57
             +  +G  +      +   +A    T+     +       +++ +G F Q+        
Sbjct: 12  STRRWLGAALAGASLMLAAAHAFAGGTE-----QLRAFVAQVRSAKGDFTQQIVKATAKG 66

Query: 58  ---------AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL 108
                          G F  +RP KF + Y  P    L +DG  + VY+  L+  +   L
Sbjct: 67  ASAAQAAPKPTDNSSGTFVFSRPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKL 126

Query: 109 R----YMAFSVIFSNNQHVIQESIQRVESNNSFI----TIFFKDDFMGNMISVTFDRLSY 160
                    +++F +N  + +    R       I     +    D     I + F   + 
Sbjct: 127 NGALGASPAAILFGSN-DLDKSYTLRDAGEKGGIEWLEMLPKAQDTQFQRIGIGFKNGTL 185

Query: 161 RLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
             +   + D     +++     + N  L    F+    K  ++
Sbjct: 186 AAME--LHDVFGNVTLLTFSNIQTNPPLKADTFKFVVPKGADV 226


>gi|294788015|ref|ZP_06753259.1| outer membrane lipoprotein carrier protein LolA [Simonsiella
           muelleri ATCC 29453]
 gi|294484308|gb|EFG31991.1| outer membrane lipoprotein carrier protein LolA [Simonsiella
           muelleri ATCC 29453]
          Length = 205

 Score = 71.1 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 28/157 (17%), Positives = 49/157 (31%), Gaps = 13/157 (8%)

Query: 49  MQGTFLQE----DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS 104
           + G F Q            G F + RP  F + Y SP   +++ DG+NI +Y+  L   +
Sbjct: 39  LSGNFTQTVQSKKKNQTSSGTFQILRPGLFKWDYKSPYKQTIVGDGANIWLYDVDLKQVT 98

Query: 105 VYPLRYMAFS---VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGN----MISVTFDR 157
                         I SN   +    + + +  +  I          N     I + F  
Sbjct: 99  KSNQDQTIGDSPAAILSNKSALDASYMLKEDGTSGDIQYVLATPKRANAGYQYIRIGFQG 158

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
                +   + D     + I+         L    F+
Sbjct: 159 DKLAAMQ--LKDGFGNQTSIRFNGVNTKPNLSRGAFK 193


>gi|319761901|ref|YP_004125838.1| outer membrane lipoprotein carrier protein lola [Alicycliphilus
           denitrificans BC]
 gi|317116462|gb|ADU98950.1| outer membrane lipoprotein carrier protein LolA [Alicycliphilus
           denitrificans BC]
          Length = 210

 Score = 71.1 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 30/189 (15%), Positives = 63/189 (33%), Gaps = 24/189 (12%)

Query: 36  VKKAIEHFLSIQTMQGTFLQE-----DAG-----YVMKGEFFMARPSKFYFKYSSPSSVS 85
           +K   +   +  + +  F Q        G      +  G F   RP +F F Y  P   +
Sbjct: 22  LKSLEQFMAAAHSGRADFTQTVTAPAKDGQAQRPKLSSGSFEFQRPGRFKFVYKKPFEQT 81

Query: 86  LISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHV----IQESIQRVESNNSF 137
           +++DG  + +Y+A L+  +  P    L     + + ++   +        +Q     +  
Sbjct: 82  IVADGKTLWLYDADLNQVTERPQAQALGSTP-AALLTSAPDLAALRADYQLQSAPEQDGL 140

Query: 138 ITIFFKDDFMGNMISVT---FDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
             +          +      F+    RL    I+D   + S I+    + N  L    F+
Sbjct: 141 QWVLATPKASEGQLKSVRVGFEGD--RLAALDIVDGFGQRSQIRFSGMQINPALPAGTFQ 198

Query: 195 IPYDKIHNI 203
                  ++
Sbjct: 199 FKPPAGADV 207


>gi|152981724|ref|YP_001352845.1| outer-membrane lipoprotein carrier protein [Janthinobacterium sp.
           Marseille]
 gi|151281801|gb|ABR90211.1| outer membrane lipoproteins carrier protein [Janthinobacterium sp.
           Marseille]
          Length = 222

 Score = 71.1 bits (173), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 38/215 (17%), Positives = 81/215 (37%), Gaps = 27/215 (12%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ----EDAGY-- 60
           ++++   +L   +   P  A        ++++      S Q+ +G F Q     ++G   
Sbjct: 15  RTLLVSALLVGAALAVPRFA-----HAAALEQFKSFVASTQSARGEFTQQLVKIESGTSK 69

Query: 61  ---VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAF 113
                 G F  ARP KF + Y  P    L +DG  + +Y+  L+  ++      L     
Sbjct: 70  VSNKSTGTFTFARPGKFIWVYQKPYEQLLQADGDKLYIYDKDLNQVTIKKLGDALGSSPA 129

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWK-----IM 168
           +++F +N      +++   + N    +              FD +   L N       + 
Sbjct: 130 AILFGSNDLEKNFTLKEAGTKNGLEWLEATPKAKDTT----FDHIGIGLRNGVPEAMELR 185

Query: 169 DSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           DS  + S++   K+++N  +    F+    K  ++
Sbjct: 186 DSFGQVSLLTFTKFEKNPPMPANQFKFVVPKGADV 220


>gi|206561378|ref|YP_002232143.1| outer-membrane lipoprotein carrier protein [Burkholderia
           cenocepacia J2315]
 gi|198037420|emb|CAR53355.1| probable outer-membrane lipoproteins carrier protein [Burkholderia
           cenocepacia J2315]
          Length = 229

 Score = 71.1 bits (173), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 37/227 (16%), Positives = 70/227 (30%), Gaps = 31/227 (13%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED--- 57
           + FL          L   S +     A+    +Q           +++ +G F Q+    
Sbjct: 7   VPFLRSTRRWLGAALAGASLMLAATHAFAGGTEQL----KAFVSQVRSAKGDFTQQIVKA 62

Query: 58  -------------AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS 104
                              G F  ARP KF + Y  P    L +DG  + VY+  L+  +
Sbjct: 63  PAKGASAAQAAPKPTDNSSGTFVFARPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVT 122

Query: 105 VYPLR----YMAFSVIFSNNQHVIQESIQRVESNNSFI----TIFFKDDFMGNMISVTFD 156
              L         +++F +N  + +    R       I     +    D     I + F 
Sbjct: 123 ERKLNGALGASPAAILFGSN-DLDKNYTLRDAGEKGGIEWLEMLPKAQDTQFQRIGIGFR 181

Query: 157 RLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
             +   +   + D     +++     + N  L    F+    K  ++
Sbjct: 182 NGTLAAME--LHDVFGNVTLLTFTNIQTNPALKGDTFKFVVPKGADV 226


>gi|170732289|ref|YP_001764236.1| outer-membrane lipoprotein carrier protein [Burkholderia
           cenocepacia MC0-3]
 gi|169815531|gb|ACA90114.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           cenocepacia MC0-3]
          Length = 229

 Score = 71.1 bits (173), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 34/213 (15%), Positives = 65/213 (30%), Gaps = 27/213 (12%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED----------------A 58
           L    A      A         ++       +++ +G F Q+                  
Sbjct: 17  LGAALAGASLMLAATHAFAGGTEQLKAFVSQVRSAKGDFTQQIVKAPAKGASAAQAAPKP 76

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFS 114
                G F  ARP KF + Y  P    L +DG  + VY+  L+  +   L         +
Sbjct: 77  TDNSSGTFVFARPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLNGALGASPAA 136

Query: 115 VIFSNNQHVIQESIQRVESNNSFI----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
           ++F +N  + +    R       I     +    D     I + F   +   +   + D 
Sbjct: 137 ILFGSN-DLDKNYTLRDAGEKGGIDWLEMLPKAQDTQFQRIGIGFRNGTLAAME--LHDV 193

Query: 171 SRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
               +++     + N  L    F+    K  ++
Sbjct: 194 FGNVTLLTFTNIQTNPPLKGDTFKFVVPKGADV 226


>gi|258542210|ref|YP_003187643.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256633288|dbj|BAH99263.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256636347|dbj|BAI02316.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256639400|dbj|BAI05362.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256642456|dbj|BAI08411.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256645511|dbj|BAI11459.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256648564|dbj|BAI14505.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256651617|dbj|BAI17551.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256654608|dbj|BAI20535.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 190

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 59/154 (38%), Gaps = 5/154 (3%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
            K+  V +   +F ++      FLQ  A     G     +P   Y  Y++P  + L + G
Sbjct: 34  AKNADVARVENYFRTVDLENAPFLQTWANGSRGGGLITYKPGSLYMHYTAPHEMELRASG 93

Query: 91  SNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSF--ITIFFKDDFM 147
            +    +A+  + +   L +    ++  N   +    ++  V+       +++   D+  
Sbjct: 94  HHAVFTDAQQGSQTRIGLAHNPLGLLLDNPVVLSGAVTVTNVQKQPGVLQLSLTRTDNPS 153

Query: 148 GNMISVTF--DRLSYRLLNWKIMDSSRRYSIIKI 179
             ++++ F        L + +I+D  R    I +
Sbjct: 154 QGLVTLVFHDVANRLALSSIQIVDERRHVISISL 187


>gi|221201179|ref|ZP_03574219.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           multivorans CGD2M]
 gi|221206367|ref|ZP_03579380.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           multivorans CGD2]
 gi|221173676|gb|EEE06110.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           multivorans CGD2]
 gi|221179029|gb|EEE11436.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           multivorans CGD2M]
          Length = 229

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 33/213 (15%), Positives = 65/213 (30%), Gaps = 27/213 (12%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED----------------A 58
           L    A      A         ++       +++ +G F Q+                  
Sbjct: 17  LGAALAGASLMLAATHAFAGGTEQLRAFVAQVRSAKGDFTQQIVKAPAKGASAAQAAPKP 76

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFS 114
                G F  +RP KF + Y  P    L +DG  + VY+  L+  +   L         +
Sbjct: 77  TDNSSGTFVFSRPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLNGALGASPAA 136

Query: 115 VIFSNNQHVIQESIQRVESNNSFI----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
           ++F +N  + +    R       I     +    D     I + F   +   +   + D 
Sbjct: 137 ILFGSN-DLDKSYTLRDAGEKGGIEWLEMLPKAQDTQFQRIGIGFKNGTLAAME--LHDV 193

Query: 171 SRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
               +++     + N  L    F+    K  ++
Sbjct: 194 FGNVTLLTFSNIQTNPPLKADTFKFVVPKGADV 226


>gi|161525592|ref|YP_001580604.1| outer-membrane lipoprotein carrier protein [Burkholderia
           multivorans ATCC 17616]
 gi|189349679|ref|YP_001945307.1| outer-membrane lipoprotein carrier protein [Burkholderia
           multivorans ATCC 17616]
 gi|160343021|gb|ABX16107.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           multivorans ATCC 17616]
 gi|189333701|dbj|BAG42771.1| outer membrane lipoprotein carrier protein [Burkholderia
           multivorans ATCC 17616]
          Length = 229

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 33/213 (15%), Positives = 65/213 (30%), Gaps = 27/213 (12%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED----------------A 58
           L    A      A         ++       +++ +G F Q+                  
Sbjct: 17  LGAALAGASLMLAATHAFAGGTEQLKAFVAQVRSAKGDFTQQIVKAPAKGASAAQAAPKP 76

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFS 114
                G F  +RP KF + Y  P    L +DG  + VY+  L+  +   L         +
Sbjct: 77  TDNSSGTFVFSRPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLNGALGASPAA 136

Query: 115 VIFSNNQHVIQESIQRVESNNSFI----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
           ++F +N  + +    R       I     +    D     I + F   +   +   + D 
Sbjct: 137 ILFGSN-DLDKSYTLRDAGEKGGIEWLEMLPKAQDTQFQRIGIGFKNGTLAAME--LHDV 193

Query: 171 SRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
               +++     + N  L    F+    K  ++
Sbjct: 194 FGNVTLLTFSNIQTNPPLKADTFKFVVPKGADV 226


>gi|254427179|ref|ZP_05040886.1| outer membrane lipoprotein carrier protein LolA [Alcanivorax sp.
           DG881]
 gi|196193348|gb|EDX88307.1| outer membrane lipoprotein carrier protein LolA [Alcanivorax sp.
           DG881]
          Length = 207

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 40/195 (20%), Positives = 73/195 (37%), Gaps = 22/195 (11%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE--DAG----YVMKGEFFMA 69
               ++ P           +    ++   ++++M+G F Q   D G        G F +A
Sbjct: 3   TLLLSLAPAVLLASTAWAGATDDLLDRLQTLKSMKGQFEQVVLDQGGTHMQEATGRFQVA 62

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQ 125
           R ++FY+   +P      SDG  + VY+  L+   V PL          +       V +
Sbjct: 63  RGNQFYWLTETPYEQMAASDGETVWVYDKDLEQVVVRPLSQDLGQTPALLFGGKPADVAK 122

Query: 126 E-SIQRVESNNSFITIFF---KDDFMGNMISVTF---DRLSYRLLNWKIMDSSRRYSIIK 178
             SI   ++  S +T        D + + + VTF   +  S RL      D+  + ++I 
Sbjct: 123 AFSISERDNQGSEVTYRLTPKGQDPLFDQLDVTFKGDEPASMRLQ-----DALGQQTVID 177

Query: 179 ILKYKENTVLDPKVF 193
                 N  +D  +F
Sbjct: 178 FKSLTLNGGIDSDLF 192


>gi|71897619|ref|ZP_00679864.1| Outer membrane lipoprotein carrier protein LolA [Xylella fastidiosa
           Ann-1]
 gi|182681261|ref|YP_001829421.1| outer-membrane lipoprotein carrier protein [Xylella fastidiosa M23]
 gi|28056664|gb|AAO28543.1| periplasmic chaperone [Xylella fastidiosa Temecula1]
 gi|71732522|gb|EAO34575.1| Outer membrane lipoprotein carrier protein LolA [Xylella fastidiosa
           Ann-1]
 gi|182631371|gb|ACB92147.1| outer membrane lipoprotein carrier protein LolA [Xylella fastidiosa
           M23]
 gi|307579711|gb|ADN63680.1| outer-membrane lipoprotein carrier protein [Xylella fastidiosa
           subsp. fastidiosa GB514]
          Length = 214

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/195 (14%), Positives = 69/195 (35%), Gaps = 22/195 (11%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTF------LQEDAGYVMKGEFFM 68
           +FF  A+           D            ++T+QG F       Q        G   +
Sbjct: 14  IFFAVALLSGPVCAGARAD-----LSAFTRGLKTLQGHFSQEVIDTQGRVKERSNGTVAL 68

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV---------YPLRYMAFSVIFSN 119
           + P+   ++  +P    +++DG  + +++  L+  SV          PL  +   +    
Sbjct: 69  SLPNLLRWECDAPYKQLVVADGKRVWLFDPDLNQASVLLQDNEERNSPLIALIDPIQLDR 128

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
              V +E    +     ++++  +     +  S +F     +L   +++D+  + ++I  
Sbjct: 129 KYDVSEE--VAMRDGLRWLSLRPRGSTEASFQSASFGFSQTQLARMELVDNLGQRTVIAF 186

Query: 180 LKYKENTVLDPKVFE 194
             ++ N V     F 
Sbjct: 187 SGWQRNPVFAVNTFR 201


>gi|145588876|ref|YP_001155473.1| outer membrane lipoprotein carrier protein LolA [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145047282|gb|ABP33909.1| outer membrane lipoprotein carrier protein LolA [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 227

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 33/221 (14%), Positives = 77/221 (34%), Gaps = 36/221 (16%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---------- 56
           + +   + +   S +    A      +   ++  +   + +T +G F+Q+          
Sbjct: 2   QRLFSALAIGIASILISNVA--IAEGESGSEQLRQFVRNSKTAEGDFVQQQLRAPKANEP 59

Query: 57  -DAG----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP---- 107
            D G       +G+F   RP +F +    P    LI++G+ + +++  L+  +  P    
Sbjct: 60  QDKGLKVVRQTQGQFVFQRPGRFVWDTQKPYEQKLITNGTQLILWDKDLNQATFRPAGQA 119

Query: 108 LRYMAFSVI-----FSNNQHVIQESIQRVESNNSFI-----TIFFKDDFMGNMISV-TFD 156
           L     +++        +  +I    +      + +         ++D     IS+   +
Sbjct: 120 LASTPAAILFGESSLDQHFELIDGEERLGMKWVALVPKKDPNAKNQNDLPYTKISIGMTN 179

Query: 157 RLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE-IP 196
            L   L    ++D      ++ +   K N  L    F  IP
Sbjct: 180 GLPKALE---LIDGLGSVVLVTLDNIKLNVNLPANRFNFIP 217


>gi|167586456|ref|ZP_02378844.1| outer-membrane lipoprotein carrier protein [Burkholderia ubonensis
           Bu]
          Length = 229

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 34/213 (15%), Positives = 66/213 (30%), Gaps = 27/213 (12%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED----------------A 58
           L    A      A         ++       +++ +G F Q+                 +
Sbjct: 17  LGAALAGASLMLAATHAFAGGTEQLKAFVSQVRSAKGEFTQQIVKAPAKGASAAQAAPKS 76

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFS 114
                G F  ARP KF + Y  P    L +DG  + VY+  L+  +       L     +
Sbjct: 77  TDNSSGTFVFARPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLAGALGASPAA 136

Query: 115 VIFSNNQHVIQESIQRVESNNSFI----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
           ++F +N  + +    R       I     +    D     I + F   +   +   + D 
Sbjct: 137 ILFGSN-DLDKNYTLRDAGEKGGIEWLEMLPKAQDTQFQRIGIGFRNGTLAAME--LHDV 193

Query: 171 SRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
               +++     + N  L    F+    K  ++
Sbjct: 194 FGNVTLLTFTNIQTNPPLKSDTFKFVVPKGADV 226


>gi|32129707|sp|Q87DL0|LOLA_XYLFT RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
          Length = 210

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/195 (14%), Positives = 69/195 (35%), Gaps = 22/195 (11%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTF------LQEDAGYVMKGEFFM 68
           +FF  A+           D            ++T+QG F       Q        G   +
Sbjct: 10  IFFAVALLSGPVCAGARAD-----LSAFTRGLKTLQGHFSQEVIDTQGRVKERSNGTVAL 64

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV---------YPLRYMAFSVIFSN 119
           + P+   ++  +P    +++DG  + +++  L+  SV          PL  +   +    
Sbjct: 65  SLPNLLRWECDAPYKQLVVADGKRVWLFDPDLNQASVLLQDNEERNSPLIALIDPIQLDR 124

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
              V +E    +     ++++  +     +  S +F     +L   +++D+  + ++I  
Sbjct: 125 KYDVSEE--VAMRDGLRWLSLRPRGSTEASFQSASFGFSQTQLARMELVDNLGQRTVIAF 182

Query: 180 LKYKENTVLDPKVFE 194
             ++ N V     F 
Sbjct: 183 SGWQRNPVFAVNTFR 197


>gi|161484694|ref|NP_778894.2| outer-membrane lipoprotein carrier protein [Xylella fastidiosa
           Temecula1]
          Length = 208

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/195 (14%), Positives = 69/195 (35%), Gaps = 22/195 (11%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTF------LQEDAGYVMKGEFFM 68
           +FF  A+           D            ++T+QG F       Q        G   +
Sbjct: 8   IFFAVALLSGPVCAGARAD-----LSAFTRGLKTLQGHFSQEVIDTQGRVKERSNGTVAL 62

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV---------YPLRYMAFSVIFSN 119
           + P+   ++  +P    +++DG  + +++  L+  SV          PL  +   +    
Sbjct: 63  SLPNLLRWECDAPYKQLVVADGKRVWLFDPDLNQASVLLQDNEERNSPLIALIDPIQLDR 122

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
              V +E    +     ++++  +     +  S +F     +L   +++D+  + ++I  
Sbjct: 123 KYDVSEE--VAMRDGLRWLSLRPRGSTEASFQSASFGFSQTQLARMELVDNLGQRTVIAF 180

Query: 180 LKYKENTVLDPKVFE 194
             ++ N V     F 
Sbjct: 181 SGWQRNPVFAVNTFR 195


>gi|323697858|ref|ZP_08109770.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio sp.
           ND132]
 gi|323457790|gb|EGB13655.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           desulfuricans ND132]
          Length = 230

 Score = 69.6 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/214 (14%), Positives = 78/214 (36%), Gaps = 25/214 (11%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ----EDAG 59
           +   SV   V++          AA PI          + + +++T +  F Q      +G
Sbjct: 1   MSRLSVAVFVMVSCLLLPVLAGAAEPIPAQDLPDLIQKRYETLKTFRADFSQELTNVASG 60

Query: 60  YV--MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA--VYNAKLD-TWSVYPL--RYMA 112
            V   +G+ +  +PS+  ++ S+P    L+         + + +L   + V  L      
Sbjct: 61  EVDKREGKIWFRQPSQVRWETSAPEKELLVVGPEFAWDYIPDEELAIKYGVAALLDSKTI 120

Query: 113 FSVIFSNNQHVIQESIQRVE------------SNNSFITIFFKDDFMGNMISVT-FDRLS 159
                S   ++ ++ + + E             + + + +  K+   G +++    +  +
Sbjct: 121 LRF-LSGQANIKEDFVVKTEWPGADEVRAKWGKDLTVLQLVPKEAEPGMVLAFVGVEPAT 179

Query: 160 YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
             L    I+D     + +++   + +  L P +F
Sbjct: 180 GLLRQVMIVDFYGNGNEVRLSNVETDVDLAPDMF 213


>gi|107022055|ref|YP_620382.1| outer-membrane lipoprotein carrier protein [Burkholderia
           cenocepacia AU 1054]
 gi|116688999|ref|YP_834622.1| outer-membrane lipoprotein carrier protein [Burkholderia
           cenocepacia HI2424]
 gi|105892244|gb|ABF75409.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           cenocepacia AU 1054]
 gi|116647088|gb|ABK07729.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           cenocepacia HI2424]
          Length = 229

 Score = 69.6 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/213 (15%), Positives = 65/213 (30%), Gaps = 27/213 (12%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED----------------A 58
           L    A      A         ++       +++ +G F Q+                  
Sbjct: 17  LGAALAGASLMLAATHAFAGGTEQLKAFVSQVRSAKGDFTQQIVKAPAKGASAAQAAPKP 76

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFS 114
                G F  ARP KF + Y  P    L +DG  + VY+  L+  +   L         +
Sbjct: 77  TDNSSGTFVFARPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLNGALGASPAA 136

Query: 115 VIFSNNQHVIQESIQRVESNNSFI----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
           ++F +N  + +    R       I     +    D     I + F   +   +   + D 
Sbjct: 137 ILFGSN-DLDKNYTLRDAGEKGGIDWLEMLPKAQDTQFQRIGIGFRNGALAAME--LHDV 193

Query: 171 SRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
               +++     + N  L    F+    K  ++
Sbjct: 194 FGNVTLLTFTNIQTNPPLKGDTFKFVVPKGADV 226


>gi|332530917|ref|ZP_08406841.1| outer membrane lipoprotein carrier protein LolA [Hylemonella
           gracilis ATCC 19624]
 gi|332039605|gb|EGI76007.1| outer membrane lipoprotein carrier protein LolA [Hylemonella
           gracilis ATCC 19624]
          Length = 250

 Score = 69.6 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 32/214 (14%), Positives = 68/214 (31%), Gaps = 34/214 (15%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE--------------DAGYVMKGE 65
           A  P  A      D  +        + ++ +  F Q                      G 
Sbjct: 38  APGPVQAQDGKPLDG-LSALSVFLQTTRSGRSDFTQVVTLPPRASEGSTRVARTRSSNGS 96

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQ 121
           F   RP +F F Y++P S ++++DG  + +++  L+  +V      L     ++I   + 
Sbjct: 97  FAFQRPGRFRFVYAAPLSQTIVADGKTLWLHDEDLNQVTVRSQAGALDDTPAALIAGASD 156

Query: 122 ------------HVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMD 169
                          ++ +  V +         +   +G             L  ++I+D
Sbjct: 157 LRTLQASYELANDGARDGLLWVRATPKAREGQTQQLRVGLR---AVSPTQVELGAFEILD 213

Query: 170 SSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           S  + S++   + + N  L    F        +I
Sbjct: 214 SFGQRSLLTFSRMQVNANLPADTFRFTPPAGADI 247


>gi|238021913|ref|ZP_04602339.1| hypothetical protein GCWU000324_01817 [Kingella oralis ATCC 51147]
 gi|237866527|gb|EEP67569.1| hypothetical protein GCWU000324_01817 [Kingella oralis ATCC 51147]
          Length = 205

 Score = 69.6 bits (169), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 27/157 (17%), Positives = 52/157 (33%), Gaps = 15/157 (9%)

Query: 49  MQGTFLQEDAGY----VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS 104
           + G+F Q         +  G F + RP  F ++Y+ P   +++ DG  I +Y+ +L   +
Sbjct: 39  ISGSFTQTVRSKKKTQISSGSFKILRPGLFRWEYTKPYQQTIVGDGKTIWLYDIELKQVT 98

Query: 105 VYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNM----ISVTFD 156
                          I SN   +      + + + + +          N     I + F 
Sbjct: 99  KSDQNQAIGDSPA-AILSNKTALDASYSLKEDGSKNGVDYVLATPKKNNAGYQFIRIGFK 157

Query: 157 RLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
             +   +   + DS    + I       N  L    F
Sbjct: 158 GDTLAAME--LKDSFGNQTSISFGGVNTNAHLSRGAF 192


>gi|330829976|ref|YP_004392928.1| outer-membrane lipoprotein carrier protein [Aeromonas veronii B565]
 gi|328805112|gb|AEB50311.1| Outer-membrane lipoprotein carrier protein [Aeromonas veronii B565]
          Length = 206

 Score = 69.2 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 39/208 (18%), Positives = 83/208 (39%), Gaps = 23/208 (11%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---D 57
           M  ++ K ++   +L   S+    +AA  + +             +      F Q     
Sbjct: 1   MKSVMKKQLLMGTVLLMASSQVWADAASDLKQK---------LAGVSLFSAKFAQTVYDS 51

Query: 58  AGY---VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----Y 110
            G       G+  + RP++F +  +SP    +++DG ++ VY+  ++  +   L+     
Sbjct: 52  KGKELQKASGDLLVQRPNRFNWHTTSPDESLIVADGQDVWVYDPFVEQVTALKLKDAVLN 111

Query: 111 MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
             F +I  N+    +      E +   +T   KD+ + +   VTFDR    +  + + ++
Sbjct: 112 TPFILIAGNDDKFWKNYDVTKEGDVYTVTSRNKDELIASF-RVTFDRQD-NISRFDVKEA 169

Query: 171 SRRYSIIKILKYKENTVLDPK--VFEIP 196
             ++S   +  +    VL     VF+IP
Sbjct: 170 QGQWSEFTLSSFNRKPVLKGNEFVFKIP 197


>gi|163752529|ref|ZP_02159715.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           benthica KT99]
 gi|161327584|gb|EDP98782.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           benthica KT99]
          Length = 208

 Score = 69.2 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 33/202 (16%), Positives = 72/202 (35%), Gaps = 22/202 (10%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKF 74
             P  A+  +  D+S          + T++  F Q              G F +A P+KF
Sbjct: 11  ALPLMASLLVVADESSA-LRAKLEEMATLKANFSQVVTDINNKEIQKGSGVFALAYPNKF 69

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQR 130
           Y+  + P    +++DG+++ +YN   +  SV  L         +++   ++    +    
Sbjct: 70  YWHLTEPDESLIVADGTDVWIYNPFAEQVSVMDLNQAITASPIALLVHRDEETWAQYSVT 129

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
            + +   I     D  + + + V F      L    + D     S  ++      T  + 
Sbjct: 130 SKGDCFDIQPKSVDAGVES-VKVCF--KDKTLTQMVLKDQQGNVSSFQLTDQTAITEAEM 186

Query: 191 KVFE--------IPYDKIHNIN 204
            +F+        I   +++ +N
Sbjct: 187 SLFKFILPEDVDIDDQRLNAVN 208


>gi|110834152|ref|YP_693011.1| outer membrane lipoprotein carrier protein [Alcanivorax borkumensis
           SK2]
 gi|122959498|sp|Q0VQ09|LOLA_ALCBS RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|110647263|emb|CAL16739.1| outer membrane lipoprotein carrier protein [Alcanivorax borkumensis
           SK2]
          Length = 209

 Score = 69.2 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 39/206 (18%), Positives = 77/206 (37%), Gaps = 22/206 (10%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------GEFFM 68
           L    A+ P     P     +    +    ++++M+G F Q              G+F +
Sbjct: 4   LLLTLAMVPAVLFSPTAWGDATDDLLGRLQTLESMKGGFEQVVLDQSGTHMQEALGKFQV 63

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVI 124
           AR ++FY+   +P      SDG+ + VY+  L+   V PL          +       V 
Sbjct: 64  ARGNRFYWLTETPYEQMAASDGTTVWVYDKDLEQVVVRPLSQDLGQTPALLFGGKPADVA 123

Query: 125 QE-SIQRVESNNSFITIFF---KDDFMGNMISVTF---DRLSYRLLNWKIMDSSRRYSII 177
           +  +I   ++  + +T        D + + + VTF      S RL      D+  + ++I
Sbjct: 124 KAFTISERDNRGAEVTYRLTPKGQDPLFDQLDVTFKGGQPASMRLQ-----DALGQQTVI 178

Query: 178 KILKYKENTVLDPKVFEIPYDKIHNI 203
             +    N  +D  +F     +  ++
Sbjct: 179 DFIGLTLNDGIDSSLFHFDPPEGTDV 204


>gi|71274774|ref|ZP_00651062.1| Outer membrane lipoprotein carrier protein LolA [Xylella fastidiosa
           Dixon]
 gi|170729982|ref|YP_001775415.1| outer-membrane lipoprotein carrier protein [Xylella fastidiosa M12]
 gi|71164506|gb|EAO14220.1| Outer membrane lipoprotein carrier protein LolA [Xylella fastidiosa
           Dixon]
 gi|167964775|gb|ACA11785.1| periplasmic chaperone [Xylella fastidiosa M12]
          Length = 214

 Score = 69.2 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/170 (14%), Positives = 63/170 (37%), Gaps = 17/170 (10%)

Query: 40  IEHFLSIQTMQGTF------LQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
                 ++T+QG F       Q        G   ++ P+   ++  +P    +++DG  +
Sbjct: 34  SAFTRGLKTLQGHFSQEVIDTQGRVKERSNGTVALSLPNLLRWECDAPYKQLVVADGKRV 93

Query: 94  AVYNAKLDTWSV---------YPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKD 144
            +++  L+  SV          PL  +   +       V +E    +     ++++  + 
Sbjct: 94  WLFDPDLNQASVLLQDNEERNSPLIALIDPIQLDRKYDVSEE--VAMRDGLRWLSLRPRG 151

Query: 145 DFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
               +  S +F     +L   +++D+  + ++I    ++ N V     F 
Sbjct: 152 GTEASFQSASFGFSQTQLARMELVDNLGQRTVIAFSGWQRNPVFAVNTFR 201


>gi|308049687|ref|YP_003913253.1| outer membrane lipoprotein carrier protein LolA [Ferrimonas
           balearica DSM 9799]
 gi|307631877|gb|ADN76179.1| outer membrane lipoprotein carrier protein LolA [Ferrimonas
           balearica DSM 9799]
          Length = 202

 Score = 68.8 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 71/186 (38%), Gaps = 20/186 (10%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---DAGY---VMK 63
           +  + L   + + P   A P    Q+          +   +  F Q      G      +
Sbjct: 4   LKTLTLALGALVAPLAMAAPQQALQA------KLAQLPEFEAQFEQVVTDPDGTLLQQGQ 57

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSN 119
           G   MA P++F +   +P    ++SDG ++ +Y+  L+  S+Y L         S++ SN
Sbjct: 58  GSLAMAVPNRFAWHQQAPEESVILSDGEDVYLYDPLLEQVSIYDLQDATGQTPLSLLSSN 117

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
                + +  +V  N    T+   D      +++ FD  +    +  ++D  +  + + +
Sbjct: 118 --DEAEWAAYQVSQNGDCFTLTPSDADGIQTMAICFDGDAIE--SLSLVDGQQVETRMTL 173

Query: 180 LKYKEN 185
            ++   
Sbjct: 174 SRFHTG 179


>gi|160872671|ref|ZP_02062803.1| outer membrane lipoprotein carrier protein LolA [Rickettsiella
           grylli]
 gi|159121470|gb|EDP46808.1| outer membrane lipoprotein carrier protein LolA [Rickettsiella
           grylli]
          Length = 207

 Score = 68.8 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 38/174 (21%), Positives = 74/174 (42%), Gaps = 15/174 (8%)

Query: 43  FLSIQTMQGTFLQE---DAGYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY 96
             +IQT +  F Q      G +++   GE  + RP  F ++   P+   LI+DG +I  Y
Sbjct: 33  LNNIQTYRAHFTQTVFDPRGQILQTANGEMTLQRPGHFRWEIYQPTKQLLIADGQHIWFY 92

Query: 97  NAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD-FMGNMI 151
           +  L   +V            +++  +++++ Q  I +        T+F K+   +   I
Sbjct: 93  DINLQQITVQKQTKADPDSPQALLSESSKNLSQRFIIQPLKTIQGFTLFPKNKNALFQNI 152

Query: 152 SVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV--FEIPYDKIHNI 203
           ++ F   +  L    ++D   + ++I     + N +L  +   F IP DK   I
Sbjct: 153 TLIF--KNNLLYEMHLIDKLDQQTVINFSHIELNPILPKQTFRFVIPKDKNIEI 204


>gi|187479167|ref|YP_787192.1| outer-membrane lipoprotein carrier protein [Bordetella avium 197N]
 gi|123738543|sp|Q2KWE1|LOLA_BORA1 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|115423754|emb|CAJ50305.1| outer-membrane lipoprotein carrier protein [Bordetella avium 197N]
          Length = 209

 Score = 68.8 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 26/168 (15%), Positives = 55/168 (32%), Gaps = 11/168 (6%)

Query: 37  KKAIEHFLSIQTMQGTFLQEDAGYV------MKGEFFMARPSKFYFKYSSPSSVSLISDG 90
            +       +Q+  G F Q   G          G F   RP KF +  + P    +ISDG
Sbjct: 29  DQLKAFVAKVQSATGDFTQSTVGPQGRTQPAQSGSFAFQRPGKFKWAVARPYEQLVISDG 88

Query: 91  SNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDF 146
             +  Y+  L   +   +         +++F +        +  +   +    +  K   
Sbjct: 89  KQVYQYDPDLAQVTERKVDQAIGTSPAAILFGSGDLDKAFHVSPLPDRDGLQWLRAKPRN 148

Query: 147 MGNMISVTFDRLSYRL-LNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
                S     ++  L    +++D+  + + + +   + N  L    F
Sbjct: 149 ADAGFSQVDIAMNGDLPARVELLDAFGQTTRVDLSNIQANPKLPAAEF 196


>gi|260220656|emb|CBA28415.1| Outer-membrane lipoprotein carrier protein [Curvibacter putative
           symbiont of Hydra magnipapillata]
          Length = 221

 Score = 68.8 bits (167), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 33/200 (16%), Positives = 73/200 (36%), Gaps = 34/200 (17%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQE----------DAGYVMKGEFFMARPSKFYFKYS 79
                 +         +++ +  F Q               V  G F   RP +F F Y 
Sbjct: 27  SAGATGLNDLESFIKGVKSGKAEFSQVVTAPAKEGQVARSKVSSGTFEFLRPGRFKFTYK 86

Query: 80  SPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVI--------FSNNQHVI--- 124
            P   ++++DG  + +Y+  L+  +       L     ++I           + ++    
Sbjct: 87  KPFEQTIVADGQTLWLYDVDLNQVTARKQAQALGSTPAALIASSADIKALQADFNLADSP 146

Query: 125 -QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
            +E +Q V+          KD  + + + V F +    +L   I+D+  + S++    ++
Sbjct: 147 DKEGLQWVQGAPKA-----KDSQLQS-VRVGFRQGKLEILE--IVDTFGQKSVLTFNGFQ 198

Query: 184 ENTVLDPKVFEIPYDKIHNI 203
            N V DP++F+       ++
Sbjct: 199 SNPVTDPELFQFKPPAGADV 218


>gi|162453352|ref|YP_001615719.1| hypothetical protein sce5076 [Sorangium cellulosum 'So ce 56']
 gi|161163934|emb|CAN95239.1| putative exported protein [Sorangium cellulosum 'So ce 56']
          Length = 232

 Score = 68.8 bits (167), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 34/199 (17%), Positives = 71/199 (35%), Gaps = 20/199 (10%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEF 66
           V+L   +      AA P T ++  ++  + + S +T + +F Q       D   V  G+ 
Sbjct: 23  VVLATLATAGESQAAGP-TAEELGRRVQQFYDSTKTFKASFTQTYTIKVQDVKKVSTGKV 81

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT-------WSVYP--LRYMAFSVIF 117
              +P K  + Y +P+   ++SDG  I VY    +         S YP  L ++      
Sbjct: 82  TFEKPGKMSWIYDAPNGNRVVSDGVTIKVYEKDNEQMFETPVKGSQYPAALAFLMGKGQL 141

Query: 118 SNNQHVIQESIQRVESNNSFI---TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           + +  +      +++    ++   T          M+    D  + ++    I+D+    
Sbjct: 142 TKDFSLRLLDPAQMKFEGGYVLEGTPKEATPAYQKMLLYV-DGQTNQVRRVLILDAQGNR 200

Query: 175 SIIKILKYKENTVLDPKVF 193
           +         N  +    F
Sbjct: 201 NRFDFSSPVVNQPVGKTEF 219


>gi|9106472|gb|AAF84261.1|AE003975_4 chaperone [Xylella fastidiosa 9a5c]
          Length = 214

 Score = 68.4 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 61/174 (35%), Gaps = 19/174 (10%)

Query: 37  KKAIEHFLSIQTMQGTFLQEDAGYV------MKGEFFMARPSKFYFKYSSPSSVSLISDG 90
                    ++T+QG F QE             G   ++ P+   ++  +P    +++DG
Sbjct: 31  ADLSAFTRGLKTLQGHFSQEIIDTQGRVKERSNGTVALSLPNLLRWECDAPYKQLVVADG 90

Query: 91  SNIAVYNAKLDTWSVYPL----RYMAFSVIFSN-NQHVIQESIQRVESNNSFITIFFKDD 145
             + +++  L+  SV       R      +       +  +  + V   +    +  +  
Sbjct: 91  KRVWLFDPDLNQASVRLQGNEERNSPLIALIDPIQLDLKYDVSEEVAMRDGLRWLSLRPR 150

Query: 146 FMGNMISVTFDRLSY-----RLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
                I  +F   S+     +L   +++D+  + ++I    ++ N V     F 
Sbjct: 151 VG---IEASFQSASFGFAQTQLARMELVDNLGQRTVIVFSGWQRNPVFAVDTFR 201


>gi|300311229|ref|YP_003775321.1| outer-membrane lipoprotein-sorting protein [Herbaspirillum
           seropedicae SmR1]
 gi|300074014|gb|ADJ63413.1| outer-membrane lipoprotein-sorting protein [Herbaspirillum
           seropedicae SmR1]
          Length = 237

 Score = 68.4 bits (166), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 40/222 (18%), Positives = 80/222 (36%), Gaps = 24/222 (10%)

Query: 2   AFLLYKSVI--GVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---- 55
           A  L + ++  G+  L    AI             ++ +  +   S Q+ +G F Q    
Sbjct: 17  ASTLRRRLMAAGLSALVVAGAITITALTPGRASAAALDQFKQFVSSTQSAKGAFTQRMVR 76

Query: 56  EDAG-----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY 110
            + G         G F  +RP KF + Y  P    + +DG  + +Y+  L+  +   L  
Sbjct: 77  TENGATKVVNTSSGSFVFSRPGKFIWTYQKPYEQVIQADGEKLFIYDKDLNQVTTKKLGN 136

Query: 111 ----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWK 166
                  +++F +N  + +    +   +   +          +    TFDR+   L N  
Sbjct: 137 ALGSSPAAILFGSN-DLEKNFTLKEAGDKDGLEWLEAVPKSKDT---TFDRIGIGLKNGT 192

Query: 167 -----IMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
                + DS  + S++    +++N  L    F     K  ++
Sbjct: 193 PVAMELHDSFGQVSLLSFDSFEKNPPLKVNSFSFTIPKGADV 234


>gi|326559966|gb|EGE10364.1| outer-membrane lipoproteins carrier protein [Moraxella catarrhalis
           46P47B1]
 gi|326561150|gb|EGE11515.1| outer-membrane lipoproteins carrier protein [Moraxella catarrhalis
           7169]
 gi|326567660|gb|EGE17768.1| outer-membrane lipoproteins carrier protein [Moraxella catarrhalis
           12P80B1]
          Length = 293

 Score = 68.4 bits (166), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 32/212 (15%), Positives = 78/212 (36%), Gaps = 21/212 (9%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYP-------ITKDQSVKKAIEHFLSIQTMQGTF 53
           +   L  +V+  VI     A      A          ++ Q+ K        I++M   F
Sbjct: 73  LTSTLKTAVVNAVISGAIMASVMMPVALTTVAHAAAASQSQATKNLNSQLSGIRSMTANF 132

Query: 54  LQE-DAGYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV---- 105
            Q   AG       G   + R ++F ++  SP+   ++++G+ + +Y+  L   +     
Sbjct: 133 SQTTQAGNKKTNFTGMMGVQRQNQFRWETKSPAEQLIVANGNTMWIYDKDLQQATRQSVG 192

Query: 106 YPLRYMAFSVIFSNNQHVIQ-ESIQRVESNNSFITIFFKDDFMG-NMISVTF-DRLSYRL 162
             +  +   ++  +   + +  ++ + ++N ++  +  K        +S++F       +
Sbjct: 193 SQIGEVPALLLSGDPSQIDRHFNVSQPDANKNYFILTPKSSNANFGSLSLSFNGGRPVMM 252

Query: 163 LNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
               + DS  + + I+      N  L    F 
Sbjct: 253 ---VLQDSIGQTTTIQFSNIALNKKLPATQFN 281


>gi|257453966|ref|ZP_05619242.1| outer membrane lipoprotein carrier protein LolA [Enhydrobacter
           aerosaccus SK60]
 gi|257448631|gb|EEV23598.1| outer membrane lipoprotein carrier protein LolA [Enhydrobacter
           aerosaccus SK60]
          Length = 233

 Score = 68.4 bits (166), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 23/168 (13%), Positives = 60/168 (35%), Gaps = 20/168 (11%)

Query: 43  FLSIQTMQGTFLQEDAG----------YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSN 92
             ++++M   F Q  +G              G   + RP++F ++    +S  ++++G+ 
Sbjct: 56  LKNVKSMTANFSQTTSGAGGKGLSKASRNFSGTMAVQRPNQFRWQIDGTASQLIVANGNT 115

Query: 93  IAVYNAKLDTWSVYPLRY----MAFSVIFSN--NQHVIQESIQRVESNNSFITIFFKDDF 146
           + VY+  L+  +   +          ++  +           Q + S N ++      + 
Sbjct: 116 LWVYDKDLNQATKQSVSNQVGDTPALILSGDPSKIANSFNVTQPIASKNYYVLYPKSGNA 175

Query: 147 MGNMISVTF-DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
               + + F       +    + D+  + + I+    K NT +    F
Sbjct: 176 NFKSLGIAFNSGNPVMM---VLNDNLGQTTTIRFSNVKRNTSIASNQF 220


>gi|190574294|ref|YP_001972139.1| outer-membrane lipoprotein carrier protein [Stenotrophomonas
           maltophilia K279a]
 gi|190012216|emb|CAQ45839.1| putative outer membrane lipoprotein carrier protein
           [Stenotrophomonas maltophilia K279a]
          Length = 212

 Score = 68.4 bits (166), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 33/218 (15%), Positives = 72/218 (33%), Gaps = 24/218 (11%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---ED 57
           M F   + +    +    +A     A        +          ++ + G F Q   + 
Sbjct: 1   MNFRFRRFLATTTLAVACAAAGSVWA-------GARDDLKTFTSGLKGLDGQFSQQVFDS 53

Query: 58  AGYV---MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY-------- 106
            G V     G   ++ P  F ++Y  P    +++DG  + +Y   L+  +V         
Sbjct: 54  RGKVKESTSGRVALSAPRLFRWEYVRPHEQLIVADGKKVWMYEPDLEQATVREQGKEEQN 113

Query: 107 -PLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNW 165
            PL  +    +      V +E+ QR       ++   + +      ++ F+      +  
Sbjct: 114 SPLTALINPALLEQQYDVSEEAAQRDGLQWLSLSPKRETEASFQYAALGFNAQGLAKME- 172

Query: 166 KIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            I D+  + ++I    +K N       F     K  ++
Sbjct: 173 -ITDAVGQRTVISFSGWKRNPGFAAGTFSFTPPKGTDV 209


>gi|167624140|ref|YP_001674434.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           halifaxensis HAW-EB4]
 gi|189028560|sp|B0TUP7|LOLA_SHEHH RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|167354162|gb|ABZ76775.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           halifaxensis HAW-EB4]
          Length = 208

 Score = 68.0 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 31/191 (16%), Positives = 70/191 (36%), Gaps = 14/191 (7%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFF 67
           I    +   P  + +P     +  +       I +++  F Q             +G F 
Sbjct: 4   IFAIAALSLPLFSHFPAFA-GASDELKVKLTEISSLKANFNQTVTDINDKVIQTGEGVFA 62

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHV 123
           ++ P++FY+  ++P    +++DG+++ +YN   +  SV  L         +++  ++   
Sbjct: 63  LSHPNQFYWHLTAPDESLIVADGTDVWIYNPFAEEVSVMDLNQAINASPIALLVHSDDET 122

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
             +     + N   I+   KD   G+ + V F     +L    + D     S   +    
Sbjct: 123 WSQYNVSQKENCFDISPKDKDS-GGSEVQVCF--NDNQLTKMVLKDQQGNISDFTLTNQS 179

Query: 184 ENTVLDPKVFE 194
                D  +F+
Sbjct: 180 VIAGKDQDLFK 190


>gi|254496576|ref|ZP_05109444.1| truncated outer membrane lipoprotein carrier protein [Legionella
           drancourtii LLAP12]
 gi|254354200|gb|EET12867.1| truncated outer membrane lipoprotein carrier protein [Legionella
           drancourtii LLAP12]
          Length = 146

 Score = 68.0 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 56/145 (38%), Gaps = 9/145 (6%)

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW----SVYPLRYMAFSVIFSNNQ 121
             + RP +F ++   P +  +I+DG  I VY+  L+          L   A   +   + 
Sbjct: 1   MALERPGRFRWQTKEPMAQLMIADGQRIWVYDTDLEQVTVKKQQKGLGGTAALFLSGYDD 60

Query: 122 HVIQESIQRVESNNSFITIFFKDDFMGN---MISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
            V ++       + + ++   K          I + F +    L+  ++ D   + + ++
Sbjct: 61  TVTRDFTVSQSGSGNELSFDLKSKSAKANFQRIRLMFRQN--LLVGLELFDQLGQVTTVQ 118

Query: 179 ILKYKENTVLDPKVFEIPYDKIHNI 203
           + + K N  L   +F+    K  ++
Sbjct: 119 LSQAKLNPKLAAALFQFKPPKGVDV 143


>gi|308272707|emb|CBX29311.1| hypothetical protein N47_J02920 [uncultured Desulfobacterium sp.]
          Length = 220

 Score = 68.0 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 22/106 (20%), Positives = 46/106 (43%), Gaps = 10/106 (9%)

Query: 7   KSVIGVVILFFYSAIFPFNA---AYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA----- 58
           K++I  + + F    F F+A      +  +Q + K  + + S+      F+Q        
Sbjct: 4   KTIILSLAIIFCLTCFAFDAQAKEESLKANQIMMKVEKKY-SVPGFVAKFIQSSTLKAMG 62

Query: 59  -GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW 103
              V +G+ F+ RP    ++Y  P    +++DG N+ +Y  + +  
Sbjct: 63  IADVAEGKMFVKRPGMMRWEYEKPEKQIVVTDGENLWIYRPQDNQV 108


>gi|311694709|gb|ADP97582.1| outer-membrane lipoprotein carrier protein precursor [marine
           bacterium HP15]
          Length = 215

 Score = 68.0 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 33/214 (15%), Positives = 86/214 (40%), Gaps = 19/214 (8%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV 61
           + +S +  ++    + +     +     D S  +        ++ Q  F+Q    + G  
Sbjct: 1   MGQSFLKCLVTLVMAVLIAGPLSASEGSD-SANELASLLKGYESYQADFIQIVVNENGNK 59

Query: 62  ---MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFS 114
               +G     RP  FY++ S+P S  ++SDG  + VY+  L+  +++ L         +
Sbjct: 60  VQETRGSLKAKRPGLFYWETSAPLSQFIVSDGETVEVYDPDLEQVTIHNLDDRVQSTP-A 118

Query: 115 VIFSNNQHVIQE--SIQRVESNNSFITIFFKDDFMGN---MISVTFDRLSYRLLNWKIMD 169
           ++ S     +++   +   +  ++ +    +     +    + +TF +    L   ++ D
Sbjct: 119 LLLSGEVDNLEDTYRVSGRQIGDNTLEFTLQPRSPDSLFTSLRLTFFKG--ELQEMRMQD 176

Query: 170 SSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           S  + S++   + + N  ++   F + Y +  +I
Sbjct: 177 SLAQLSVLSFDRIRLNEPVEAGAFTLDYPEGVDI 210


>gi|161378168|ref|NP_298741.2| outer-membrane lipoprotein carrier protein [Xylella fastidiosa
           9a5c]
          Length = 208

 Score = 68.0 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 61/174 (35%), Gaps = 19/174 (10%)

Query: 37  KKAIEHFLSIQTMQGTFLQEDAGYV------MKGEFFMARPSKFYFKYSSPSSVSLISDG 90
                    ++T+QG F QE             G   ++ P+   ++  +P    +++DG
Sbjct: 25  ADLSAFTRGLKTLQGHFSQEIIDTQGRVKERSNGTVALSLPNLLRWECDAPYKQLVVADG 84

Query: 91  SNIAVYNAKLDTWSVYPL----RYMAFSVIFSN-NQHVIQESIQRVESNNSFITIFFKDD 145
             + +++  L+  SV       R      +       +  +  + V   +    +  +  
Sbjct: 85  KRVWLFDPDLNQASVRLQGNEERNSPLIALIDPIQLDLKYDVSEEVAMRDGLRWLSLRPR 144

Query: 146 FMGNMISVTFDRLSY-----RLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
                I  +F   S+     +L   +++D+  + ++I    ++ N V     F 
Sbjct: 145 VG---IEASFQSASFGFAQTQLARMELVDNLGQRTVIVFSGWQRNPVFAVDTFR 195


>gi|9977696|sp|Q9PDC7|LOLA_XYLFA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
          Length = 210

 Score = 68.0 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 61/174 (35%), Gaps = 19/174 (10%)

Query: 37  KKAIEHFLSIQTMQGTFLQEDAGYV------MKGEFFMARPSKFYFKYSSPSSVSLISDG 90
                    ++T+QG F QE             G   ++ P+   ++  +P    +++DG
Sbjct: 27  ADLSAFTRGLKTLQGHFSQEIIDTQGRVKERSNGTVALSLPNLLRWECDAPYKQLVVADG 86

Query: 91  SNIAVYNAKLDTWSVYPL----RYMAFSVIFSN-NQHVIQESIQRVESNNSFITIFFKDD 145
             + +++  L+  SV       R      +       +  +  + V   +    +  +  
Sbjct: 87  KRVWLFDPDLNQASVRLQGNEERNSPLIALIDPIQLDLKYDVSEEVAMRDGLRWLSLRPR 146

Query: 146 FMGNMISVTFDRLSY-----RLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
                I  +F   S+     +L   +++D+  + ++I    ++ N V     F 
Sbjct: 147 VG---IEASFQSASFGFAQTQLARMELVDNLGQRTVIVFSGWQRNPVFAVDTFR 197


>gi|117620952|ref|YP_856397.1| outer membrane lipoprotein carrier protein LolA [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|189028546|sp|A0KJE6|LOLA_AERHH RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|117562359|gb|ABK39307.1| outer membrane lipoprotein carrier protein LolA [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 202

 Score = 67.6 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 35/204 (17%), Positives = 83/204 (40%), Gaps = 23/204 (11%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---DAGY- 60
           + K ++   +L   S+    +AA  + +             +      F Q      G  
Sbjct: 1   MKKQLLMGTVLLVASSQVWADAASDLKQK---------LAGVSLFSAKFAQTVYDSKGKE 51

Query: 61  --VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFS 114
                G+  + RP++F +  +SP    +++DG ++ VY+  ++  +   ++       F 
Sbjct: 52  LQRAGGDLLVQRPNRFNWHTTSPDESLIVADGKDVWVYDPFVEQVTALKMKDAVLNTPFV 111

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +I  N+  + +      E +   +T   +D+ + +   +TFDR +  +  + + ++  ++
Sbjct: 112 LIAGNDNSLWKNYDVTQEGDVYTVTSRNQDELIASF-RITFDRQN-NISRFDVKEAQGQW 169

Query: 175 SIIKILKYKENTVLDPK--VFEIP 196
           S   +  +    VL     VF+IP
Sbjct: 170 SEFTLSNFNRKPVLKGNEFVFKIP 193


>gi|57339510|gb|AAW49742.1| hypothetical protein FTT1636 [synthetic construct]
          Length = 240

 Score = 67.6 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/200 (17%), Positives = 83/200 (41%), Gaps = 15/200 (7%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------EDAGYVMKGEFF 67
           I+  +  +F  N ++     + + K      +I +M   F Q       +     KG   
Sbjct: 30  IIICFIFVFSINVSFADATSELIDKI----KNIHSMTANFNQKLIDGQTNNNLNSKGNMS 85

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHV 123
           + +P  F +  +SP++  ++S+G+ + +Y+  LD   +  +        + ++ S N + 
Sbjct: 86  LKKPQYFKWITTSPNNQEIVSNGTKLWIYDGDLDQLIIKKVSNDIAQFPYLILLSKNTNN 145

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
           I +       +N+   +  K+D M + I + F   + +L   +I  S  +++ I+    K
Sbjct: 146 INKLFTVTAQDNNSYILKPKNDQMIDSIKIKFTPNN-QLEYLEISTSLNQFTKIEFNNVK 204

Query: 184 ENTVLDPKVFEIPYDKIHNI 203
            +  +    F+    +  +I
Sbjct: 205 TDVDISNTSFDFKAPQNTDI 224


>gi|88608557|ref|YP_506586.1| hypothetical protein NSE_0710 [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600726|gb|ABD46194.1| conserved hypothetical protein [Neorickettsia sennetsu str.
           Miyayama]
          Length = 171

 Score = 67.6 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/163 (16%), Positives = 61/163 (37%), Gaps = 8/163 (4%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           +  + + +  S++T+  TF+Q    G +  G  F+A P KF   Y     VS++ +   +
Sbjct: 8   ANAELVSYLASLRTLCATFVQYNPDGTLSTGTLFLAVPHKFRIDYHK-EGVSVVMNKGMM 66

Query: 94  AVYNAKLDTWSVYPLRYM-AFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMIS 152
              +A L     + L       +  S+       ++ + + + S   ++           
Sbjct: 67  TYRDATLKESRSFFLGKSDPLLLAISD-----LGALHKYKQSISGELLYLGRSSKNKKYV 121

Query: 153 VTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
           +        +      D S++ + + +     N  LD  +F+I
Sbjct: 122 LVLSHSPAEIREILFEDDSKQVTRMVLSDVCYNADLDRHIFDI 164


>gi|89256975|ref|YP_514337.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           holarctica LVS]
 gi|115315335|ref|YP_764058.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           holarctica OSU18]
 gi|134301388|ref|YP_001121356.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|156503171|ref|YP_001429236.1| lipoprotein releasing system subunit A, outer membrane lipoproteins
           carrier [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|167010156|ref|ZP_02275087.1| outer membrane lipoprotein carrier protein LolA [Francisella
           tularensis subsp. holarctica FSC200]
 gi|254368233|ref|ZP_04984253.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           holarctica 257]
 gi|254369828|ref|ZP_04985838.1| hypothetical protein FTAG_01173 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|290953891|ref|ZP_06558512.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295312734|ref|ZP_06803474.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           holarctica URFT1]
 gi|122324673|sp|Q0BKG3|LOLA_FRATO RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|122500278|sp|Q2A1R5|LOLA_FRATH RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|171769935|sp|A7NE77|LOLA_FRATF RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|172044162|sp|A4IWD4|LOLA_FRATW RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|89144806|emb|CAJ80145.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           holarctica LVS]
 gi|115130234|gb|ABI83421.1| lipoprotein releasing system, subunit A, outer membrane
           [Francisella tularensis subsp. holarctica OSU18]
 gi|134049165|gb|ABO46236.1| outer membrane lipoprotein carrier protein LolA [Francisella
           tularensis subsp. tularensis WY96-3418]
 gi|134254043|gb|EBA53137.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           holarctica 257]
 gi|156253774|gb|ABU62280.1| outer membrane lipoprotein carrier protein LolA [Francisella
           tularensis subsp. holarctica FTNF002-00]
 gi|157122787|gb|EDO66916.1| hypothetical protein FTAG_01173 [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 205

 Score = 67.6 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/200 (17%), Positives = 83/200 (41%), Gaps = 15/200 (7%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------EDAGYVMKGEFF 67
           I+  +  +F  N ++     + + K      +I +M   F Q       +     KG   
Sbjct: 4   IIICFIFVFSINVSFADATSELIDKI----KNIHSMTANFNQKLIDGQTNNNLNSKGNMS 59

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHV 123
           + +P  F +  +SP++  ++S+G+ + +Y+  LD   +  +        + ++ S N + 
Sbjct: 60  LKKPQYFKWITTSPNNQEIVSNGTKLWIYDGDLDQLIIKKVSNDIAQFPYLILLSKNTNN 119

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
           I +       +N+   +  K+D M + I + F   + +L   +I  S  +++ I+    K
Sbjct: 120 INKLFTVTAQDNNSYILKPKNDQMIDSIKIKFTPNN-QLEYLEISTSLNQFTKIEFNNVK 178

Query: 184 ENTVLDPKVFEIPYDKIHNI 203
            +  +    F+    +  +I
Sbjct: 179 TDVDISNTSFDFKAPQNTDI 198


>gi|326577445|gb|EGE27329.1| outer-membrane lipoproteins carrier protein [Moraxella catarrhalis
           O35E]
          Length = 293

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 32/212 (15%), Positives = 78/212 (36%), Gaps = 21/212 (9%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYP-------ITKDQSVKKAIEHFLSIQTMQGTF 53
           +   L  +V+  VI     A      A          ++ Q+ K        I++M   F
Sbjct: 73  LTSTLKTAVVNAVISGAIMASVMMPVALTTVAHAAAASQSQATKNLNSQLSGIRSMTANF 132

Query: 54  LQE-DAGYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV---- 105
            Q   AG       G   + R ++F ++  SP+   ++++G+ + +Y+  L   +     
Sbjct: 133 SQTTQAGNKKTNFTGMMGVQRQNQFRWETKSPAEQLIVANGNTMWIYDKDLQQATRQSVG 192

Query: 106 YPLRYMAFSVIFSNNQHVIQ-ESIQRVESNNSFITIFFKDDFMG-NMISVTF-DRLSYRL 162
             +  +   ++  +   + +  ++ + ++N ++  +  K        +S++F       +
Sbjct: 193 SQIGEVPALLLSGDPGQIDRHFNVSQPDANKNYFILTPKSSNANFGSLSLSFNGGRPVMM 252

Query: 163 LNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
               + DS  + + I+      N  L    F 
Sbjct: 253 ---VLQDSIGQTTTIQFSNIALNKKLPATQFN 281


>gi|56708653|ref|YP_170549.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110671125|ref|YP_667682.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           tularensis FSC198]
 gi|224457855|ref|ZP_03666328.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254371283|ref|ZP_04987285.1| lipoprotein releasing system [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254875522|ref|ZP_05248232.1| lipoprotein releasing system protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|81597079|sp|Q5NEJ3|LOLA_FRATT RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|123063354|sp|Q14FZ6|LOLA_FRAT1 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|54114381|gb|AAV29824.1| NT02FT0484 [synthetic construct]
 gi|56605145|emb|CAG46269.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110321458|emb|CAL09652.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           tularensis FSC198]
 gi|151569523|gb|EDN35177.1| lipoprotein releasing system [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254841521|gb|EET19957.1| lipoprotein releasing system protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|282159894|gb|ADA79285.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 205

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/200 (17%), Positives = 83/200 (41%), Gaps = 15/200 (7%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------EDAGYVMKGEFF 67
           I+  +  +F  N ++     + + K      +I +M   F Q       +     KG   
Sbjct: 4   IIICFIFVFSINVSFADATSELIDKI----KNIHSMTANFNQKLIDGQTNNNLNSKGNMS 59

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHV 123
           + +P  F +  +SP++  ++S+G+ + +Y+  LD   +  +        + ++ S N + 
Sbjct: 60  LKKPQYFKWITTSPNNQEIVSNGTKLWIYDGDLDQLIIKKVSNDIAQFPYLILLSKNTNN 119

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
           I +       +N+   +  K+D M + I + F   + +L   +I  S  +++ I+    K
Sbjct: 120 INKLFTVTAQDNNSYILKPKNDQMIDSIKIKFTPNN-QLEYLEISTSLNQFTKIEFNNVK 178

Query: 184 ENTVLDPKVFEIPYDKIHNI 203
            +  +    F+    +  +I
Sbjct: 179 TDVDISNTSFDFKAPQNTDI 198


>gi|298530194|ref|ZP_07017596.1| outer membrane lipoprotein carrier protein LolA
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509568|gb|EFI33472.1| outer membrane lipoprotein carrier protein LolA
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 206

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 43/202 (21%), Positives = 80/202 (39%), Gaps = 19/202 (9%)

Query: 11  GVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKG 64
            + +  F    F             ++K  E   SIQT+ G+F+Q+      D   V +G
Sbjct: 5   ALALFVFILMPFTGWGKDQSIPADVLEKLHEIHDSIQTVSGSFVQKKHLDVFDQTLVSRG 64

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-FSVIFSN---- 119
            F + RP +  + Y  PS     SDG  +  ++ +       PL      SVI       
Sbjct: 65  SFAIDRPGRIRWAYEEPSVFGFSSDGLQVRRWSEESGMSQSAPLSRDPVLSVIVDQMLAW 124

Query: 120 ---NQHVIQE--SIQRVESNNSFITIFFKDDFMGNMIS---VTFDRLSYRLLNWKIMDSS 171
              +   I++  S+   ES    + +  +   + ++IS   ++FD  S  +   +I++  
Sbjct: 125 STMDLQAIEDHFSLTLAESEPMVLELEPEAKELRDIISKVLISFDSTSTHIEKIRILEHD 184

Query: 172 RRYSIIKILKYKENTVLDPKVF 193
              + I+  +   N  LD ++F
Sbjct: 185 SDRTNIRFEEVSLNQDLDHELF 206


>gi|289208987|ref|YP_003461053.1| outer membrane lipoprotein carrier protein LolA [Thioalkalivibrio
           sp. K90mix]
 gi|288944618|gb|ADC72317.1| outer membrane lipoprotein carrier protein LolA [Thioalkalivibrio
           sp. K90mix]
          Length = 219

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/215 (14%), Positives = 70/215 (32%), Gaps = 16/215 (7%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHF-LSIQTMQGTFLQEDAGYV 61
            L+ + ++ +     +    P  A      D     A++ F   ++T    F Q      
Sbjct: 4   RLVPRLLLALAATTMFLFAGPLAAERGPAPDARA--ALDRFVEGLETFTAEFTQTVRDET 61

Query: 62  ------MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YM 111
                   G   +  P++  ++ + P   +++SDG ++  Y+  L   +V PL       
Sbjct: 62  GYVLQESDGSMQLGMPNRLRWEVTEPFPQTIVSDGEDLWTYDPDLAQATVRPLGDAFDAT 121

Query: 112 AFSVIFSNNQ--HVIQESIQRVESNNSFITIFFKDDFMGNMISVTFD-RLSYRLLNWKIM 168
             + I    +     +  +  V   ++   +    +   +   +  D      L      
Sbjct: 122 PIAAITQPERLDEHFRMDVLPVRDASALRLLLIPRNEQADFTHLELDLTPDGDLTRMAFR 181

Query: 169 DSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           D   + + I   + + N  +D  VF        +I
Sbjct: 182 DIFGQETEIHFERSERNAPVDESVFTFDPPSGVDI 216


>gi|256822344|ref|YP_003146307.1| outer membrane lipoprotein carrier protein LolA [Kangiella
           koreensis DSM 16069]
 gi|256795883|gb|ACV26539.1| outer membrane lipoprotein carrier protein LolA [Kangiella
           koreensis DSM 16069]
          Length = 227

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/203 (15%), Positives = 65/203 (32%), Gaps = 26/203 (12%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------ 60
              +    L  +S +   +A   + K            +I + +  F Q           
Sbjct: 10  TQFVSASALLCFSTLVAADAPQDLEKK---------LTAIDSFKANFSQVITDEFGTLID 60

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSVI 116
              G F + RP  F +  S P    +I+DG N+  ++  ++  +V  L         +++
Sbjct: 61  ESSGYFELQRPQLFRWVVSEPFEQEIIADGVNLWQFDIDIEQINVSSLDQTLANSPAALL 120

Query: 117 FSNNQHV-IQESIQRVESNNSFITI---FFKDDFMGNMISVT-FDRLSYRLLNWKIMDSS 171
                 V     +  V+     + I     +D      + +  F+      L   + D+ 
Sbjct: 121 SQAQLDVATNYEVAAVQGQQEGVMIYHLMPRDPDALYEVLIIEFNGDDLVALQ--VKDNL 178

Query: 172 RRYSIIKILKYKENTVLDPKVFE 194
            + +++       N   D   FE
Sbjct: 179 GQSTLVDFTNVVMNPPFDEDHFE 201


>gi|24213836|ref|NP_711317.1| outer membrane lipoprotein-sorting protein [Leptospira interrogans
           serovar Lai str. 56601]
 gi|45658387|ref|YP_002473.1| outer membrane lipoprotein carrier protein [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
 gi|24194674|gb|AAN48335.1| outer membrane lipoprotein-sorting protein [Leptospira interrogans
           serovar Lai str. 56601]
 gi|45601630|gb|AAS71110.1| outer membrane lipoprotein carrier protein [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
          Length = 257

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 36/221 (16%), Positives = 77/221 (34%), Gaps = 30/221 (13%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITK----DQSVKKAIEHFLSIQTMQGTF-LQED 57
           FL+ K++I    + F  A+ P   A P        + VK+  + F  + + +  F +Q  
Sbjct: 20  FLMKKTIILSFFILF-LALEPSLLAQPAHNWNSPSEVVKQVKKKFSDLNSYKADFQIQTV 78

Query: 58  AGYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL------ 108
           +    K   G     +  +  ++++ PS   ++SDG  + +Y A+L+      L      
Sbjct: 79  SNKKSKNMKGVCLYKKGGRIRYQFNEPSGDEIVSDGKTLYIYIARLNAVGKQDLTLNKSN 138

Query: 109 RYMA---------FSVIFSN---NQHVIQESIQRVESNNSFITIFFKDDFMGN---MISV 153
           +             S IF         I++     +    +  +  +          + +
Sbjct: 139 KSGPIFSNFTDEGLSRIFRKYHYKFDSIEQPQTSSKDGRKYFVLNLEQREKIGGFETMLL 198

Query: 154 TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
             D  +Y +      D   + + I+    + N  L+   F 
Sbjct: 199 YVDAQTYFIQKAVASDGRGKETTIEFSNLEINPDLEDGQFN 239


>gi|329113379|ref|ZP_08242160.1| Outer Membrane Lipoprotein Carrier Protein LolA [Acetobacter
           pomorum DM001]
 gi|326697204|gb|EGE48864.1| Outer Membrane Lipoprotein Carrier Protein LolA [Acetobacter
           pomorum DM001]
          Length = 190

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 60/153 (39%), Gaps = 5/153 (3%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGS 91
           K+  V +   +F ++      FLQ  A     G     +P   Y  Y++P  + L + G 
Sbjct: 35  KNADVARVENYFRTVDLENTPFLQTWANGSRGGGLITYKPGSLYMHYTAPHEMELRASGH 94

Query: 92  NIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSF--ITIFFKDDFMG 148
           +    +A+  + +   L +    ++  N   +  E ++  V+       +++   D+   
Sbjct: 95  HAVFTDAQQGSQTRIGLAHNPLGLLMGNPVVLSGEVTVTNVQKQPGVLQLSLTRTDNPSQ 154

Query: 149 NMISVTF--DRLSYRLLNWKIMDSSRRYSIIKI 179
            ++++ F        L + +I+D  R    I +
Sbjct: 155 GLVTLVFHDVANRLALSSIQIVDERRHVISISL 187


>gi|109898774|ref|YP_662029.1| outer membrane lipoprotein carrier protein LolA [Pseudoalteromonas
           atlantica T6c]
 gi|109701055|gb|ABG40975.1| outer membrane lipoprotein carrier protein LolA [Pseudoalteromonas
           atlantica T6c]
          Length = 213

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 34/203 (16%), Positives = 76/203 (37%), Gaps = 18/203 (8%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ--EDA 58
           + ++ Y + +   +L    AIF  NA     +     K      ++     +F Q   DA
Sbjct: 4   VKYIGYVAKLSGTLLLMLGAIFSVNA-----QQTDEDKLKARLQTLHNFSASFTQKVTDA 58

Query: 59  G----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM--- 111
                    G   + +P+K Y++ + P+   LI+DGS +   +  ++  +          
Sbjct: 59  NHEVLQEATGVIKLKQPNKLYWELNPPNENILIADGSTLWNVDPFVEQVTAISQDQAVAN 118

Query: 112 -AFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
               ++   N    +       ++   I     D  + + + + FD    +L +  + DS
Sbjct: 119 NPLILLTQPNSDAWENFSVSHTNDTFRIDAKKPDSAVHS-LVLVFDGA--QLTSMSMQDS 175

Query: 171 SRRYSIIKILKYKENTVLDPKVF 193
            ++ S +     ++N  +  +VF
Sbjct: 176 QQQISDLYFNDIQQNKTVSDEVF 198


>gi|326565209|gb|EGE15395.1| outer-membrane lipoproteins carrier protein [Moraxella catarrhalis
           103P14B1]
          Length = 293

 Score = 66.9 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 35/216 (16%), Positives = 75/216 (34%), Gaps = 29/216 (13%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYP-------ITKDQSVKKAIEHFLSIQTMQGTF 53
           +   L  +V+  VI     A      A          ++ Q+ K        I++M   F
Sbjct: 73  LTSTLKTAVVNAVISGAIMASVMMPVALTTVAHAAAASQSQATKNLNSQLSGIRSMTANF 132

Query: 54  LQE-DAGYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV---- 105
            Q   AG       G   + R ++F ++  SP+   ++++G+ + +Y+  L   +     
Sbjct: 133 SQTTQAGNKKTNFTGMMGVQRQNQFRWETKSPAEQLIVANGNTMWIYDKDLQQATRQSVG 192

Query: 106 YPLRYMAFSVI------FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTF-DRL 158
             +  +   ++         + +V Q  +    + N FI      +     +S++F    
Sbjct: 193 SQIGEVPALLLSGDPGQIDRHFNVSQPDV----NKNYFILTPKSSNANFGSLSLSFNGGR 248

Query: 159 SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
              +    + DS  + + I+      N  L    F 
Sbjct: 249 PVMM---VLQDSIGQTTTIQFSNIALNKKLPATQFN 281


>gi|226951586|ref|ZP_03822050.1| outer-membrane lipoprotein carrier protein [Acinetobacter sp. ATCC
           27244]
 gi|294651245|ref|ZP_06728573.1| outer-membrane lipoprotein carrier [Acinetobacter haemolyticus ATCC
           19194]
 gi|226837667|gb|EEH70050.1| outer-membrane lipoprotein carrier protein [Acinetobacter sp. ATCC
           27244]
 gi|292822898|gb|EFF81773.1| outer-membrane lipoprotein carrier [Acinetobacter haemolyticus ATCC
           19194]
          Length = 231

 Score = 66.9 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 40/227 (17%), Positives = 84/227 (37%), Gaps = 26/227 (11%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-- 58
           M  + Y + +  + L    +I    A    +  Q+    ++   S+Q     F Q     
Sbjct: 4   MKKIAYATTLSAITLAPVVSIQVSAAPVAASAQQATTSLVQQLSSLQRFTADFEQTTKVS 63

Query: 59  ---------------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW 103
                              KG   + RP KFY++ +SP+  ++++ G  + +Y+  L   
Sbjct: 64  NNKAAPKRGLTAQHMNQTFKGVMKVERPGKFYWEITSPAKQTIVTSGKTVWIYDPDLQQA 123

Query: 104 SVYPLR----YMAFSVIFSN-NQHVIQESIQRVESNNSFITIFFK-DDFMGNMISVTFDR 157
               L          ++  N NQ +    + + +    + T++ K DD     ++++F  
Sbjct: 124 IRQNLDDQVANTPALLLSGNTNQIMQSYRVTQPDRTKLYYTLYPKQDDSTFQSLTISFGA 183

Query: 158 L-SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
             +  L+   + DS  + + ++    K N  +   VF     K  +I
Sbjct: 184 NRAPNLM--ILQDSLGQTTYVRFSNVKVNQAIPASVFNFEPPKGTDI 228


>gi|108762741|ref|YP_629730.1| outer membrane lipoprotein carrier protein LolA [Myxococcus xanthus
           DK 1622]
 gi|108466621|gb|ABF91806.1| outer membrane lipoprotein carrier protein LolA [Myxococcus xanthus
           DK 1622]
          Length = 219

 Score = 66.5 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/179 (13%), Positives = 57/179 (31%), Gaps = 16/179 (8%)

Query: 33  DQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYFKYSSPSSVSL 86
              V +    +      +  F Q+            +G     +P    ++Y  PS  + 
Sbjct: 26  KSLVDRMQAFYEKTGDFRAGFRQDYKYKTFRRTQTSEGTVTYKKPGLMRWEYLKPSPRTF 85

Query: 87  ISDGSNIAVYNAK-----LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIF 141
           +  G+ +  Y+       +       L     + +F   +   + +I +    +   T+ 
Sbjct: 86  VLAGNKVYAYDPAAQSLTVANVDTSQLSAS-VTFLFGQGKLADEFNITKGACKDCKGTLL 144

Query: 142 FKDDFMG----NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
             D          + +  D  + ++L   ++D     + I  L  K N  LD   F++ 
Sbjct: 145 VLDPLKNEPRFRQVRLEVDPSTAQVLKSTVVDPDGSENTISFLNLKTNVGLDADSFKLD 203


>gi|157375265|ref|YP_001473865.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           sediminis HAW-EB3]
 gi|189028562|sp|A8FV64|LOLA_SHESH RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|157317639|gb|ABV36737.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           sediminis HAW-EB3]
          Length = 208

 Score = 66.5 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 77/218 (35%), Gaps = 31/218 (14%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------Y 60
           +  + ++ +     +    + Y    +  V KA      I T++  F Q           
Sbjct: 2   RKTLSILAISLPLLV----SGYAQASESGVLKAK--LAEISTLKANFTQTVTDVNKKEIQ 55

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVI 116
              G F +A P++FY+  + P    +++DG ++ +YN   +  SV  L         +++
Sbjct: 56  KGSGVFALAYPNQFYWHLTEPDESLIVADGRDVWIYNPFAEEVSVMDLNQAINASPIALL 115

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKD-DFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
              ++    +    V +     +I  K  D     + V FD  +  L    + D     S
Sbjct: 116 VHRDEETWSK--YTVTNEEGCFSIAPKSVDAGVESVDVCFDGNT--LTQMVLQDQQGNVS 171

Query: 176 IIKILKYKENTVLDP-KVFE--------IPYDKIHNIN 204
              +   +     D   +F+        I   +++ +N
Sbjct: 172 QFMLSD-QTAISDDELSMFKFTVPDDVDIDDQRLNTVN 208


>gi|323525158|ref|YP_004227311.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           CCGE1001]
 gi|323382160|gb|ADX54251.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           CCGE1001]
          Length = 247

 Score = 66.5 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 36/234 (15%), Positives = 79/234 (33%), Gaps = 39/234 (16%)

Query: 2   AFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED---- 57
           A  L ++V   +      A     +    +  + +K  +     + + +GTF+Q++    
Sbjct: 18  AGTLARTVARRIGALAIGASMLVASQAFASGTEQLKAFVAQ---VHSARGTFVQQEVRAP 74

Query: 58  -AGYVMKG------------------EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNA 98
                  G                   F  ARP KF ++Y  P +  L +DG  + VY+ 
Sbjct: 75  SKAQAASGASGVLSTNGGGKSSTSSGTFTFARPGKFIWQYEKPYAQLLQADGDKLYVYDK 134

Query: 99  KLDTWSVYP----LRYMAFSVI-----FSNNQHVIQESIQRVESNNSFITIFFKDDFMGN 149
            L+  +V      L     +++        N  +    ++    +   +T   +D     
Sbjct: 135 DLNQVTVRSLGGALGASPAAILFGSNDLDKNFTLRDAGVKAG-IDWLELTPKTRDTQFQ- 192

Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            + + F      L   ++ D     +++     ++N  L    F+    K  ++
Sbjct: 193 RVGIGF--KDGNLQAMELHDVFGNVTLLTFSNIQKNPPLPADAFKFTVPKGADV 244


>gi|116749034|ref|YP_845721.1| outer membrane lipoprotein carrier protein LolA [Syntrophobacter
           fumaroxidans MPOB]
 gi|116698098|gb|ABK17286.1| outer membrane lipoprotein carrier protein LolA [Syntrophobacter
           fumaroxidans MPOB]
          Length = 247

 Score = 66.5 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/217 (15%), Positives = 71/217 (32%), Gaps = 21/217 (9%)

Query: 1   MAFLLYKSVIGVVILFFYSAIF---PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED 57
           M  +    +   + LF   A        A       + +KK   ++  IQ     F Q  
Sbjct: 1   MRAMKNFHISCGLFLFLILASMWCGTARANQAALLSEILKKTEANYQKIQAFTANFHQST 60

Query: 58  AGY--------VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY--- 106
                         G+ F  +P +  ++Y  P     +++     +Y       S++   
Sbjct: 61  TSSAASTMTTTQASGKLFYEKPRQMRWEYEKPEPQVFVANRDLAWLYVPADKQISLFDAK 120

Query: 107 -----PLRYMAFS--VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLS 159
                PL    F   V    +  V  +  Q  ++      +  ++D     + +  D  +
Sbjct: 121 TLFASPLAQTFFDGMVELKKHFQVSLDPKQSSKATAVLRLVPKQEDPNIKALFLRIDLQT 180

Query: 160 YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
           Y+++  +  D+    + I +        LD K+FE+ 
Sbjct: 181 YKIITIESHDALGNANRIMLDSQNSVPQLDRKLFELD 217


>gi|328676377|gb|AEB27247.1| Outer membrane lipoprotein carrier protein LolA [Francisella cf.
           novicida Fx1]
          Length = 205

 Score = 66.5 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 35/200 (17%), Positives = 84/200 (42%), Gaps = 15/200 (7%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------EDAGYVMKGEFF 67
           I+ ++  +F  N ++     + + K      +I +M   F Q       +     KG   
Sbjct: 4   IIIYFIFVFSINVSFADATSELIDKI----KNIHSMTANFNQKLIDGQTNNNLNSKGNMS 59

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHV 123
           + +P  F +  +SP++  ++S+G+ + +Y+  LD   +  +        + ++ S N + 
Sbjct: 60  LKKPQYFKWITTSPNNQEIVSNGTKLWIYDGDLDQLIIKKVSNDIAQFPYLILLSKNTNN 119

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
           I +       +N+   +  K+D M + I + F   + +L   +I  S  +++ I+    K
Sbjct: 120 INKLFTVTAQDNNSYILKPKNDQMIDSIKIKFTPNN-QLEYLEISTSLNQFTKIEFNNVK 178

Query: 184 ENTVLDPKVFEIPYDKIHNI 203
            +  +    F+    +  +I
Sbjct: 179 TDVDISNTSFDFTAPQDTDI 198


>gi|221135428|ref|ZP_03561731.1| outer membrane lipoprotein carrier protein LolA [Glaciecola sp.
           HTCC2999]
          Length = 226

 Score = 66.5 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/186 (12%), Positives = 67/186 (36%), Gaps = 13/186 (6%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------VMKGEFFMARPSKF 74
           +    A        +  +  +   +I ++Q TF Q              G   + +P++ 
Sbjct: 31  LAASEAPLIANASLAKTELRQRLEAISSLQSTFTQTVTDEANNLIHSSSGNLVLQQPNRV 90

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQESIQR 130
           Y+    P    +I++G  +   +  ++  S++     +      ++ S +  V ++    
Sbjct: 91  YWHAQVPDETLVIANGDKVFYVDDFVEQVSIFNQADMVSDNPLMLLTSTDDKVWEQFSVT 150

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
            ++++  +T       +   +++ F +    L  + ++D+  + S   +     N  L  
Sbjct: 151 QQADSFEVTPSSAQGQIQG-LTLVFTQG--ELRAFTLLDNQAQRSEFVLSNITMNMPLPV 207

Query: 191 KVFEIP 196
             F+  
Sbjct: 208 SQFQYD 213


>gi|121606100|ref|YP_983429.1| outer membrane lipoprotein carrier protein LolA [Polaromonas
           naphthalenivorans CJ2]
 gi|120595069|gb|ABM38508.1| outer membrane lipoprotein carrier protein LolA [Polaromonas
           naphthalenivorans CJ2]
          Length = 216

 Score = 66.1 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 29/190 (15%), Positives = 66/190 (34%), Gaps = 22/190 (11%)

Query: 36  VKKAIEHFLSIQTMQGTFLQ----------EDAGYVMKGEFFMARPSKFYFKYSSPSSVS 85
           ++       ++ + +  F Q                  G F  +RP++F F Y  P   S
Sbjct: 24  LESLASFVKTVSSGRADFTQVVTAPAKEGQTARSKTSSGTFEFSRPNRFKFLYKKPFEQS 83

Query: 86  LISDGSNIAVYNAKLDTW----SVYPLRYMAFSVIFS--NNQHVIQE-SIQRVESNNSFI 138
           +++DG  + +Y+A L+          L     ++I +  + + +  + ++      +   
Sbjct: 84  IVADGQTLWLYDADLNQVTARKQSAALGSTPAALIAAAPDLRALQADFTLAAAPEKDGLE 143

Query: 139 TIFFKDDFMGNMISVT---F--DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
            +          +      F        L   +I+DS  + S++   K + N  L    F
Sbjct: 144 WVVATPKTKEGQLQAVRVGFRAGEKPAGLAALEILDSFGQRSVLSFSKVEVNPALPKDAF 203

Query: 194 EIPYDKIHNI 203
           +    K  ++
Sbjct: 204 QFITPKGADV 213


>gi|116328780|ref|YP_798500.1| Outer membrane lipoprotein-sorting protein [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
 gi|116121524|gb|ABJ79567.1| Outer membrane lipoprotein-sorting protein [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
          Length = 236

 Score = 66.1 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 30/208 (14%), Positives = 69/208 (33%), Gaps = 25/208 (12%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTF-LQEDAGYVMK---GEFF 67
           ++ L    A     A    +  + VK+  + F  + + +  F +Q  +    K   G   
Sbjct: 11  ILFLVLEPAFLAQPAHNWNSPSEVVKQVKKKFNDLSSYKANFQIQTVSNKKSKNMRGVCL 70

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL------RYMA--------- 112
             +  +  +++S PS   ++SDG  + +Y A+L+      L      +            
Sbjct: 71  YKKGGRIRYQFSDPSGDEIVSDGKTLYIYIARLNAVGKQDLTLNKSNKSGPIFSSFTDEG 130

Query: 113 FSVIFSN---NQHVIQESIQRVESNNSFITIFFKDDFMGN---MISVTFDRLSYRLLNWK 166
            S IF         I++     +    +  +  +          + +  D  +Y +    
Sbjct: 131 LSRIFRKYHYKFDSIEQPQTSSKDGRKYFVLNLEQREKIGGFETMLLYVDAETYFIQKAV 190

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFE 194
             D   + + ++    + N  L+   F 
Sbjct: 191 ASDGRGKETTVEFSNLEINPDLEDGQFN 218


>gi|294141066|ref|YP_003557044.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           violacea DSS12]
 gi|293327535|dbj|BAJ02266.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           violacea DSS12]
          Length = 208

 Score = 66.1 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 33/195 (16%), Positives = 69/195 (35%), Gaps = 24/195 (12%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFM 68
           L   +   PF A+     D+S          + T++  F Q              G F +
Sbjct: 5   LTLLAMALPFMASNLAIADESSA-LKAKLEEVATLKANFSQVVTDINNKEIQRGSGVFAL 63

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIF-SNNQHV 123
           A P++FY+  + P    +++DG+++ +YN   +  SV  L         +++   + +  
Sbjct: 64  AYPNQFYWHLTEPDESLIVADGTDVWIYNPFAEQVSVMDLNQAITASPIALLVHRDKETW 123

Query: 124 IQESIQR----VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
            Q ++       + N   +      D     + V F   +  L    + D     S  ++
Sbjct: 124 AQYTVTSKDGCFDINPKSV------DAGVESVKVCFKGKT--LTQMVLEDQQGNVSSFEL 175

Query: 180 LKYKENTVLDPKVFE 194
                 T  +  +F+
Sbjct: 176 TGQTAITDAEKSLFK 190


>gi|194365712|ref|YP_002028322.1| outer-membrane lipoprotein carrier protein [Stenotrophomonas
           maltophilia R551-3]
 gi|194348516|gb|ACF51639.1| outer membrane lipoprotein carrier protein LolA [Stenotrophomonas
           maltophilia R551-3]
          Length = 212

 Score = 66.1 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 28/175 (16%), Positives = 62/175 (35%), Gaps = 17/175 (9%)

Query: 44  LSIQTMQGTFLQ---EDAGYV---MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
             ++ + G F Q   +  G V     G   ++ P  F ++Y  P    +++DG  + +Y 
Sbjct: 37  SGLKGLDGQFSQQVFDSRGKVKESTSGRVALSAPRLFRWEYVRPHEQLIVADGKKVWMYE 96

Query: 98  AKLDTWSVY---------PLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG 148
             L+  +V          PL  +    +      + +E+ QR       ++     +   
Sbjct: 97  PDLEQATVREQGKEEQNSPLTALINPALLEQQYDLSEEAAQRDGLQWLSLSPKRDTEASF 156

Query: 149 NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
              ++ F+      +   I D+  + ++I    +K N       F     K  ++
Sbjct: 157 QYAALGFNAQGLAKME--ITDAVGQRTVISFSGWKRNPGFAAGTFSFTPPKGTDV 209


>gi|208780355|ref|ZP_03247696.1| outer membrane lipoprotein carrier protein LolA [Francisella
           novicida FTG]
 gi|208743723|gb|EDZ90026.1| outer membrane lipoprotein carrier protein LolA [Francisella
           novicida FTG]
          Length = 205

 Score = 66.1 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 36/200 (18%), Positives = 83/200 (41%), Gaps = 15/200 (7%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------EDAGYVMKGEFF 67
           I+  +  +F  N ++       + K      +I +M   F Q       +     KG   
Sbjct: 4   IIICFIFVFSINVSFADATSDLIDKI----KNIHSMTANFNQKLIDGQTNNNLNSKGNMS 59

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHV 123
           + +P  F +  +SP++  ++S+G+ + +Y+  LD   +  +        + ++ S N + 
Sbjct: 60  LKKPQYFKWITTSPNNQEIVSNGTKLWIYDGDLDQLIIKKVSNDIAQFPYLILLSKNTNN 119

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
           I +       +N+   +  K+D M + I + F   + +L   +I  S  +++ I+    K
Sbjct: 120 INKLFTVTAQDNNSYILKPKNDQMIDSIKIKFTPNN-QLEYLEISTSLNQFTKIEFNNVK 178

Query: 184 ENTVLDPKVFEIPYDKIHNI 203
            +  +  K F+    +  +I
Sbjct: 179 TDVDISNKSFDFTAPQDTDI 198


>gi|115372369|ref|ZP_01459678.1| outer membrane lipoprotein carrier protein LolA, putative
           [Stigmatella aurantiaca DW4/3-1]
 gi|310819548|ref|YP_003951906.1| outer membrane lipoprotein carrier protein lola [Stigmatella
           aurantiaca DW4/3-1]
 gi|115370582|gb|EAU69508.1| outer membrane lipoprotein carrier protein LolA, putative
           [Stigmatella aurantiaca DW4/3-1]
 gi|309392620|gb|ADO70079.1| Outer membrane lipoprotein carrier protein LolA [Stigmatella
           aurantiaca DW4/3-1]
          Length = 239

 Score = 66.1 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 29/202 (14%), Positives = 66/202 (32%), Gaps = 18/202 (8%)

Query: 20  AIFPFNAAYPITKD--QSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARP 71
           A  P  A   +  +    V++    +   +  Q  F Q+             G     +P
Sbjct: 32  AKPPAAAKGSVAPEVKTLVERMQSFYEKTEDFQSGFKQDYKYKTFRRTQTSTGTVTYKKP 91

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNA-----KLDTWSVYPLRYMAFSVIFSNNQHVIQE 126
               ++Y  PS  + +  GS +  Y+       +       L     + +F   +   + 
Sbjct: 92  GLMRWEYEKPSPRTFVLAGSKVYAYDPGAQSLTVGNVDTNTLSAS-VTFLFGQGRLADEF 150

Query: 127 SIQRVESNNSFITIFF----KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
           +I +    +   T+      + D     + +  D  + ++L   ++D     + I  L  
Sbjct: 151 NITKGTCADCKGTLLVLNPAQADPRFKQVRLEVDSKTAQVLKSTVIDPDGSENTIAFLDL 210

Query: 183 KENTVLDPKVFEIPYDKIHNIN 204
           K N  +    F++   +   I+
Sbjct: 211 KTNVGISKDSFKLDPPEGTRID 232


>gi|225023898|ref|ZP_03713090.1| hypothetical protein EIKCOROL_00764 [Eikenella corrodens ATCC
           23834]
 gi|224943372|gb|EEG24581.1| hypothetical protein EIKCOROL_00764 [Eikenella corrodens ATCC
           23834]
          Length = 205

 Score = 66.1 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 33/181 (18%), Positives = 62/181 (34%), Gaps = 18/181 (9%)

Query: 26  AAYPITKDQSVKKAIEHFLSIQTMQGTFLQE----DAGYVMKGEFFMARPSKFYFKYSSP 81
            +      ++++K       I    G+F Q     +     +G F + RP  F ++Y+SP
Sbjct: 19  GSAQAGGIEALQKFNADTDGIS---GSFSQSVQSRNKTRNAQGRFSILRPGLFKWEYTSP 75

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSF 137
              +++ DGS+I +Y+  L   +             + I SN + +      + + +   
Sbjct: 76  YKQTIVGDGSHIWLYDIDLAQITKTAQNQAIGDSP-AAILSNKEALSASYTLKEDGSAGG 134

Query: 138 ITIFFKDDFMGN----MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
           I          N     I + F      L   ++ DS    + IK         L    F
Sbjct: 135 IDYVLATPKRSNAGYQYIRLGFKGDD--LAEMRLKDSFGNQTTIKFNNLNTRPNLSRSQF 192

Query: 194 E 194
            
Sbjct: 193 R 193


>gi|319778383|ref|YP_004129296.1| Outer membrane lipoprotein carrier protein LolA [Taylorella
           equigenitalis MCE9]
 gi|317108407|gb|ADU91153.1| Outer membrane lipoprotein carrier protein LolA [Taylorella
           equigenitalis MCE9]
          Length = 230

 Score = 66.1 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 41/179 (22%), Positives = 69/179 (38%), Gaps = 23/179 (12%)

Query: 38  KAIEHFLSIQTMQGTFLQE--------------DAGYVMKGEFFMARPSKFYFKYSSPSS 83
           +      ++Q+  GTF Q               +   + KGEF   RP KF +    P  
Sbjct: 44  QLKNFINNVQSASGTFEQSQVVLGWGAAEGQTLNTSDLQKGEFVFERPGKFAWIVKEPLE 103

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFIT 139
             ++SDGS +  Y+  L   +   ++        S++F N++      ++ +     +I 
Sbjct: 104 QQIVSDGSVLLQYDPDLLQVTERDVKKAIGTSPASILFGNSKIETSFKLENLPEKEGWIR 163

Query: 140 IFFKDDFMG-NMISVTF-DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
              K    G   I + F D +   LL   IMDS  + + IK    KE   L    F++ 
Sbjct: 164 ARPKQSDSGMKYIDIHFIDGMPTELL---IMDSFDKTTSIKFTSIKEGNPLGASAFKLK 219


>gi|296112926|ref|YP_003626864.1| outer membrane lipocarrier protein LolA [Moraxella catarrhalis RH4]
 gi|295920620|gb|ADG60971.1| outer membrane lipocarrier protein LolA [Moraxella catarrhalis RH4]
          Length = 222

 Score = 66.1 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 29/205 (14%), Positives = 81/205 (39%), Gaps = 16/205 (7%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAG 59
           +  ++  +++  V++    A+     A   ++ Q+ K        I++M   F Q   AG
Sbjct: 11  VNAVISGAIMASVMM--PVALTTVAHAAAASQSQATKNLNSQLSGIRSMTANFSQTTQAG 68

Query: 60  YVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV----YPLRYMA 112
                  G   + R ++F ++  SP+   ++++G+ + +Y+  L   +       +  + 
Sbjct: 69  NKKTNFTGMMGVQRQNQFRWETKSPAEQLIVANGNTMWIYDKDLQQATRQSVGSQIGEVP 128

Query: 113 FSVIFSNNQHVIQ-ESIQRVESNNSFITIFFKDDFMG-NMISVTF-DRLSYRLLNWKIMD 169
             ++  +   + +  ++ + ++N ++  +  K        +S++F       +    + D
Sbjct: 129 ALLLSGDPSQIDRHFNVSQPDANKNYFILTPKSSNANFGSLSLSFNGGRPVMM---VLQD 185

Query: 170 SSRRYSIIKILKYKENTVLDPKVFE 194
           S  + + I+      N  L    F 
Sbjct: 186 SLGQTTTIQFSNIALNKKLPATQFN 210


>gi|254523386|ref|ZP_05135441.1| outer membrane lipoprotein carrier protein LolA [Stenotrophomonas
           sp. SKA14]
 gi|219720977|gb|EED39502.1| outer membrane lipoprotein carrier protein LolA [Stenotrophomonas
           sp. SKA14]
          Length = 212

 Score = 65.7 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 29/175 (16%), Positives = 63/175 (36%), Gaps = 17/175 (9%)

Query: 44  LSIQTMQGTFLQ---EDAGYV---MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
             ++ + G F Q   +  G V     G   ++ P  F ++Y  P    +++DG  + +Y 
Sbjct: 37  SGLKGLDGQFSQQVFDSRGKVKESTSGRVALSAPRLFRWEYVRPHEQLIVADGKKVWMYE 96

Query: 98  AKLDTWSVY---------PLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG 148
             L+  +V          PL  +    +      V +E+ QR       ++   + +   
Sbjct: 97  PDLEQATVREQGKEEQNSPLTALINPALLEQQYDVSEEAAQRDGLQWLSLSPKRETEASF 156

Query: 149 NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
              ++ F+      +   I D+  + ++I    +K N       F     K  ++
Sbjct: 157 QYAALGFNAQGLAKME--ITDAVGQRTVISFTGWKRNPGFAAGTFSFTPPKGTDV 209


>gi|94968602|ref|YP_590650.1| outer membrane lipoprotein carrier protein LolA [Candidatus
           Koribacter versatilis Ellin345]
 gi|94550652|gb|ABF40576.1| outer membrane lipoprotein carrier protein LolA [Candidatus
           Koribacter versatilis Ellin345]
          Length = 219

 Score = 65.7 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 16/109 (14%), Positives = 38/109 (34%), Gaps = 10/109 (9%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEH-FLSIQTMQGTFLQEDAG----YVMKGEFFMARPSKF 74
            +   + A+  T  + + + ++H +  +++M   F +  +G        G   + +P K 
Sbjct: 10  FLLLASLAFAQTDIKKLAEGVDHRYNDLRSMSAQFSERYSGNGMEREETGTLSLKKPGKM 69

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAFSVIFS 118
            ++Y SP     +SDG     Y           ++           +  
Sbjct: 70  RWEYQSPREKLFVSDGKLAWFYVPGEKQVRQAQVKKLDDLRSPLRYLLG 118


>gi|167626751|ref|YP_001677251.1| lipoprotein releasing system subunit A [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|189028551|sp|B0U0J9|LOLA_FRAP2 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|167596752|gb|ABZ86750.1| lipoprotein releasing system, subunit A [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
          Length = 205

 Score = 65.3 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 39/198 (19%), Positives = 79/198 (39%), Gaps = 18/198 (9%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-------EDAGYVMKGEF 66
           I+   + +F  N ++    D  + K      +I +M  +F Q              KG  
Sbjct: 4   IVLLVTLVFSINYSFANASDDLINKI----KNIHSMSASFDQKLINGGRASDNISSKGYM 59

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQH 122
            + +P  F +  ++P++  +IS+GS + +Y+  L+   +  +        + ++ S N  
Sbjct: 60  SLKKPKFFRWITTTPNNQEIISNGSKLWIYDGDLEQVIIKKVSNNIAQFPYLILLSKNTD 119

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
            I +     E + +   +  K+D M + I + F      L    I  S  +++ I     
Sbjct: 120 NINKLFTVKELDKNTYLLKPKNDQMIDSIQIKFSDNE-NLEYLAISTSLNQFTKISFSDV 178

Query: 183 KENTVLDPK--VFEIPYD 198
           K +  +D     F+IP D
Sbjct: 179 KTDIDIDNNKFDFKIPDD 196


>gi|83645243|ref|YP_433678.1| outer-membrane lipoprotein carrier protein [Hahella chejuensis KCTC
           2396]
 gi|123533542|sp|Q2SJC1|LOLA_HAHCH RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|83633286|gb|ABC29253.1| outer membrane lipoprotein carrier protein LolA [Hahella chejuensis
           KCTC 2396]
          Length = 209

 Score = 65.3 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 26/173 (15%), Positives = 62/173 (35%), Gaps = 17/173 (9%)

Query: 36  VKKAIEHFLSIQTMQGTFLQEDAGYV------MKGEFFMARPSKFYFKYSSPSSVSLISD 89
           V        +++T    F Q            + G     RP  F++K  +P   ++++D
Sbjct: 24  VDALSGLLKNVETFTANFTQTMRSQSGQVLQEVTGTLKAKRPGLFFWKTRAPLEQTIVTD 83

Query: 90  GSNIAVYNAKLDTWSV----YPLRYMAFSVIFSN--NQHVIQESIQRVESNNSFITIFFK 143
           G  + +Y+  L+  ++      L      ++           +  Q+ ES    +    +
Sbjct: 84  GQQVWIYDPDLEQVTIQHLSQQLSNTPALLLSGEVGKIDEQYQVEQQPESQPGQVDFLLR 143

Query: 144 DDFMGN---MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
              + +    + ++F     +L++ K+ DS  + + +       N  +  K F
Sbjct: 144 PKGVDSLFDTLQLSFVND--QLVSMKLKDSLGQQTSLFFTAVSVNQTISEKAF 194


>gi|237745818|ref|ZP_04576298.1| outer-membrane lipoprotein carrier protein [Oxalobacter formigenes
           HOxBLS]
 gi|229377169|gb|EEO27260.1| outer-membrane lipoprotein carrier protein [Oxalobacter formigenes
           HOxBLS]
          Length = 233

 Score = 65.3 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 37/221 (16%), Positives = 75/221 (33%), Gaps = 33/221 (14%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTF--LQEDA 58
           M   + K+V  V++LF                  ++ +      +  + +G F   Q  +
Sbjct: 25  MRSYISKTVGTVLLLFLPLF----------AGATALDQLKNFSANAHSARGEFSQAQVKS 74

Query: 59  GYV------MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PL 108
           G          G F  +RP KF + Y  P    L +DG+ + +Y+  L+  +V      L
Sbjct: 75  GEKVRFTNAASGTFLFSRPGKFIWTYKKPYEQVLQADGTRLYMYDKDLNQVTVKKLGDAL 134

Query: 109 RYMAFSVI-----FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFD-RLSYRL 162
                +++        N  +              I       F    I +      +  L
Sbjct: 135 GSSPAAILFGSNNLEKNFMLKNAGAHNGYEWVEVIPKKKDTPFEKINIGMKNGIPEAMEL 194

Query: 163 LNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
                 DS  + ++IK  ++ +N  ++  +F+    K  ++
Sbjct: 195 -----YDSLGQLTLIKFTQFTKNPPVNAGMFKFVAPKGADV 230


>gi|126442023|ref|YP_001060002.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei 668]
 gi|126221516|gb|ABN85022.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 668]
          Length = 240

 Score = 65.3 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 32/191 (16%), Positives = 61/191 (31%), Gaps = 27/191 (14%)

Query: 37  KKAIEHFLSIQTMQGTFLQ--------EDAGYV--------MKGEFFMARPSKFYFKYSS 80
           ++       +   +G F Q          +G V          G F  +RP KF + Y  
Sbjct: 50  EQLKAFVAKVHAAKGEFTQQIVKAPPKAASGAVPTVKPTDNSSGSFVFSRPGKFIWTYQK 109

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESIQRVESNNS 136
           P    L +DG  + VY+  L+  +       L     +++F +N  + +    R      
Sbjct: 110 PYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSN-DLDKNYTLRDAGEKG 168

Query: 137 FI----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
            I     +    D     I + F       +   + D     +++     + N  L    
Sbjct: 169 GIDWLEMVPKAQDTQFQRIGIGFRNGMLAAME--LHDVFGNVTLLTFTNIQTNPPLKADQ 226

Query: 193 FEIPYDKIHNI 203
           F+    K  ++
Sbjct: 227 FKFVVPKGADV 237


>gi|116619188|ref|YP_821344.1| outer membrane lipoprotein carrier protein LolA [Candidatus
           Solibacter usitatus Ellin6076]
 gi|116222350|gb|ABJ81059.1| outer membrane lipoprotein carrier protein LolA [Candidatus
           Solibacter usitatus Ellin6076]
          Length = 202

 Score = 65.3 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 28/185 (15%), Positives = 56/185 (30%), Gaps = 34/185 (18%)

Query: 33  DQSVKKAIEHFLSIQTMQGTFLQ--EDAGY---VMKGEFFMARPSKFYFKYSSPSSVSLI 87
           D  +K     +   +T+Q  F +     G       G   + +P K  + Y  P     I
Sbjct: 15  DSLLKGVEARYNKTKTLQVLFHEDYTPPGRPKRTESGTLILRKPGKMRWDYEQPKGKLFI 74

Query: 88  SDGSNIAVYNAKLDTWSVYPLRYM-----AFSVIFSNNQHVIQE--SIQRVESNNSFITI 140
           SDG  + +Y    +      L+         + +        +E  ++Q         T 
Sbjct: 75  SDGKFLWLYTPDDNRAEKMKLKESDDMRAPLAFLLG-KLDFQKEFRNLQAKAEGPD--TR 131

Query: 141 FFKDDFMGNMISVTFDRLSYRLLNWKIMDSS--------RRYSII---KILKYKENTVLD 189
              D           D L Y  + + +                 +   ++ + K +  +D
Sbjct: 132 ITGDSKS--------DNLPYSSVEFVVTPEQRIRLVKVTGYDHSVLEFRLEQEKADLPVD 183

Query: 190 PKVFE 194
            K+F+
Sbjct: 184 AKLFQ 188


>gi|53720213|ref|YP_109199.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei K96243]
 gi|53726032|ref|YP_103692.1| outer-membrane lipoprotein carrier protein [Burkholderia mallei
           ATCC 23344]
 gi|67643956|ref|ZP_00442699.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei GB8 horse 4]
 gi|76808561|ref|YP_334449.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei 1710b]
 gi|121600147|ref|YP_992136.1| outer-membrane lipoprotein carrier protein [Burkholderia mallei
           SAVP1]
 gi|124383961|ref|YP_001028580.1| outer-membrane lipoprotein carrier protein [Burkholderia mallei
           NCTC 10229]
 gi|126451282|ref|YP_001081521.1| outer-membrane lipoprotein carrier protein [Burkholderia mallei
           NCTC 10247]
 gi|126452390|ref|YP_001067281.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei 1106a]
 gi|134280238|ref|ZP_01766949.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 305]
 gi|166998318|ref|ZP_02264178.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei PRL-20]
 gi|167720768|ref|ZP_02404004.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei DM98]
 gi|167739752|ref|ZP_02412526.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei 14]
 gi|167816972|ref|ZP_02448652.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei 91]
 gi|167825382|ref|ZP_02456853.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei 9]
 gi|167912101|ref|ZP_02499192.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei 112]
 gi|217420385|ref|ZP_03451890.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 576]
 gi|226193752|ref|ZP_03789354.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei Pakistan 9]
 gi|242316681|ref|ZP_04815697.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 1106b]
 gi|254175419|ref|ZP_04882079.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei ATCC 10399]
 gi|254191851|ref|ZP_04898354.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254196031|ref|ZP_04902456.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei S13]
 gi|254202388|ref|ZP_04908751.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei FMH]
 gi|254207720|ref|ZP_04914070.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei JHU]
 gi|254261881|ref|ZP_04952935.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 1710a]
 gi|254298873|ref|ZP_04966323.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 406e]
 gi|254356380|ref|ZP_04972656.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei 2002721280]
 gi|52210627|emb|CAH36611.1| probable outer-membrane lipoproteins carrier protein [Burkholderia
           pseudomallei K96243]
 gi|52429455|gb|AAU50048.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei ATCC 23344]
 gi|76578014|gb|ABA47489.1| Outer-membrane lipoprotein carrier protein precursor [Burkholderia
           pseudomallei 1710b]
 gi|121228957|gb|ABM51475.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei SAVP1]
 gi|124291981|gb|ABN01250.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei NCTC 10229]
 gi|126226032|gb|ABN89572.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 1106a]
 gi|126244152|gb|ABO07245.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei NCTC 10247]
 gi|134248245|gb|EBA48328.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 305]
 gi|147746635|gb|EDK53712.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei FMH]
 gi|147751614|gb|EDK58681.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei JHU]
 gi|148025377|gb|EDK83531.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei 2002721280]
 gi|157809118|gb|EDO86288.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 406e]
 gi|157939522|gb|EDO95192.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160696463|gb|EDP86433.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei ATCC 10399]
 gi|169652775|gb|EDS85468.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei S13]
 gi|217395797|gb|EEC35814.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 576]
 gi|225934057|gb|EEH30042.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei Pakistan 9]
 gi|238525429|gb|EEP88857.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei GB8 horse 4]
 gi|242139920|gb|EES26322.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 1106b]
 gi|243065390|gb|EES47576.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei PRL-20]
 gi|254220570|gb|EET09954.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 1710a]
          Length = 238

 Score = 64.9 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 32/191 (16%), Positives = 61/191 (31%), Gaps = 27/191 (14%)

Query: 37  KKAIEHFLSIQTMQGTFLQ--------EDAGYV--------MKGEFFMARPSKFYFKYSS 80
           ++       +   +G F Q          +G V          G F  +RP KF + Y  
Sbjct: 48  EQLKAFVAKVHAAKGEFTQQIVKAPPKAASGAVPTVKPTDNSSGSFVFSRPGKFIWTYQK 107

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESIQRVESNNS 136
           P    L +DG  + VY+  L+  +       L     +++F +N  + +    R      
Sbjct: 108 PYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSN-DLDKNYTLRDAGEKG 166

Query: 137 FI----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
            I     +    D     I + F       +   + D     +++     + N  L    
Sbjct: 167 GIDWLEMVPKAQDTQFQRIGIGFRNGMLAAME--LHDVFGNVTLLTFTNIQTNPPLKADQ 224

Query: 193 FEIPYDKIHNI 203
           F+    K  ++
Sbjct: 225 FKFVVPKGADV 235


>gi|332969576|gb|EGK08594.1| outer membrane lipoprotein carrier protein LolA [Kingella kingae
           ATCC 23330]
          Length = 243

 Score = 64.9 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 28/171 (16%), Positives = 58/171 (33%), Gaps = 13/171 (7%)

Query: 44  LSIQTMQGTFLQE----DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
                + G F Q     +      G F + RP  F ++Y+ P    ++ DG +I +Y+  
Sbjct: 72  NDADGISGAFTQTVQTRNKKQTTSGSFQILRPGLFKWEYTKPYRQMIVGDGKHIWLYDVD 131

Query: 100 LDTWSVYPLRYMAFS---VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNM----IS 152
           L   +              I SN   +      + + + + +          N+    I 
Sbjct: 132 LKQVTQSNQDQTIGDSPAAILSNKSALDTSYTLKEDGSQNGVDYVLATPRKNNVGYQFIR 191

Query: 153 VTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           + F   + +L   ++ DS    + I+  +      L    F+    K  ++
Sbjct: 192 IGF--KNNQLAAMELKDSFGNQTSIQFGQLNTKPNLSRSAFQFTPPKGVDV 240


>gi|167903835|ref|ZP_02491040.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei NCTC 13177]
          Length = 238

 Score = 64.9 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 30/191 (15%), Positives = 58/191 (30%), Gaps = 27/191 (14%)

Query: 37  KKAIEHFLSIQTMQGTFLQ----------------EDAGYVMKGEFFMARPSKFYFKYSS 80
           ++       +   +G F Q                        G F  +RP KF + Y  
Sbjct: 48  EQLKAFVAKVHAAKGEFTQQIVKAPPKAASGAMPTVKPTDNSSGSFVFSRPGKFIWTYQK 107

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESIQRVESNNS 136
           P    L +DG  + VY+  L+  +       L     +++F +N  + +    R      
Sbjct: 108 PYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSN-DLDKNYTLRDAGEKG 166

Query: 137 FI----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
            I     +    D     I + F       +   + D     +++     + N  L    
Sbjct: 167 GIDWLEMVPKAQDTQFQRIGIGFRNGMLAAME--LHDVFGNVTLLTFTNIQTNPPLKADQ 224

Query: 193 FEIPYDKIHNI 203
           F+    K  ++
Sbjct: 225 FKFVVPKGADV 235


>gi|167895449|ref|ZP_02482851.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei 7894]
 gi|237813405|ref|YP_002897856.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei MSHR346]
 gi|254181007|ref|ZP_04887605.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 1655]
 gi|184211546|gb|EDU08589.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 1655]
 gi|237506051|gb|ACQ98369.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei MSHR346]
          Length = 236

 Score = 64.9 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 32/191 (16%), Positives = 61/191 (31%), Gaps = 27/191 (14%)

Query: 37  KKAIEHFLSIQTMQGTFLQ--------EDAGYV--------MKGEFFMARPSKFYFKYSS 80
           ++       +   +G F Q          +G V          G F  +RP KF + Y  
Sbjct: 46  EQLKAFVAKVHAAKGEFTQQIVKAPPKAASGAVPTVKPTDNSSGSFVFSRPGKFIWTYQK 105

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESIQRVESNNS 136
           P    L +DG  + VY+  L+  +       L     +++F +N  + +    R      
Sbjct: 106 PYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSN-DLDKNYTLRDAGEKG 164

Query: 137 FI----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
            I     +    D     I + F       +   + D     +++     + N  L    
Sbjct: 165 GIDWLEMVPKAQDTQFQRIGIGFRNGMLAAME--LHDVFGNVTLLTFTNIQTNPPLKADQ 222

Query: 193 FEIPYDKIHNI 203
           F+    K  ++
Sbjct: 223 FKFVVPKGADV 233


>gi|328675455|gb|AEB28130.1| Outer membrane lipoprotein carrier protein LolA [Francisella cf.
           novicida 3523]
          Length = 205

 Score = 64.9 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 36/178 (20%), Positives = 74/178 (41%), Gaps = 11/178 (6%)

Query: 36  VKKAIEHFLSIQTMQGTFLQ------EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISD 89
               IE   +I +M   F Q             KG   + +P  F +  +SP++  ++S+
Sbjct: 22  ASDLIEKIKNIHSMTANFNQKLIDGQTSNNLNSKGNMSLKKPQYFKWITTSPNNQVIVSN 81

Query: 90  GSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD 145
           G+N+ +Y+  LD   +  +        + ++ S N + I +     E NN+   +  K+D
Sbjct: 82  GTNLWIYDGDLDQLIIKKVSNDIAQFPYLILLSRNTNNINKLFTVTEQNNNSYILKPKND 141

Query: 146 FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            M + I + F   + +L   +I  S  +++ I+    K +  +    F     +  +I
Sbjct: 142 QMIDSIKIKFTS-TNQLEYLEISTSLNQFTKIEFSDVKTDVNISDTSFNFRAPENTDI 198


>gi|167846875|ref|ZP_02472383.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei B7210]
 gi|167920075|ref|ZP_02507166.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei BCC215]
          Length = 242

 Score = 64.9 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 32/191 (16%), Positives = 61/191 (31%), Gaps = 27/191 (14%)

Query: 37  KKAIEHFLSIQTMQGTFLQ--------EDAGYV--------MKGEFFMARPSKFYFKYSS 80
           ++       +   +G F Q          +G V          G F  +RP KF + Y  
Sbjct: 52  EQLKAFVAKVHAAKGEFTQQIVKAPPKAASGAVPTVKPTDNSSGSFVFSRPGKFIWTYQK 111

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESIQRVESNNS 136
           P    L +DG  + VY+  L+  +       L     +++F +N  + +    R      
Sbjct: 112 PYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSN-DLDKNYTLRDAGEKG 170

Query: 137 FI----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
            I     +    D     I + F       +   + D     +++     + N  L    
Sbjct: 171 GIDWLEMVPKAQDTQFQRIGIGFRNGMLAAME--LHDVFGNVTLLTFTNIQTNPPLKADQ 228

Query: 193 FEIPYDKIHNI 203
           F+    K  ++
Sbjct: 229 FKFVVPKGADV 239


>gi|312961668|ref|ZP_07776166.1| Outer-membrane lipoprotein carrier protein [Pseudomonas fluorescens
           WH6]
 gi|311283927|gb|EFQ62510.1| Outer-membrane lipoprotein carrier protein [Pseudomonas fluorescens
           WH6]
          Length = 207

 Score = 64.5 bits (156), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 35/188 (18%), Positives = 65/188 (34%), Gaps = 19/188 (10%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQE--DAG----YVMKGEFFMARPSKFYFKYSSPSSV 84
               SV          QT+   F Q   DAG        GE  + RP  FY+     +  
Sbjct: 21  ADPASVASLKNLLDKSQTLTARFSQLTLDAGGTQLQETAGEMAVQRPGLFYWHTEGKAEQ 80

Query: 85  SLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQESIQRVESNNSFITI 140
           +++SDG  + +++  L+  ++      L     +++ S +   I +     +  +   + 
Sbjct: 81  TIVSDGQKVTLWDPDLEQATIKKLDPRLNQTP-ALLLSGDVSKIND---SFDITSKQTSN 136

Query: 141 FFKDDFMGNMISVTFDRLSYRLLNWKI-----MDSSRRYSIIKILKYKENTVLDPKVFEI 195
             +           FD LS    N  I     +DS  + + I     K N  +    F+ 
Sbjct: 137 VIEFTLKPKSKDTLFDTLSLSFGNGVINNMRLVDSVGQRTDILFSGVKANQPVPASKFKF 196

Query: 196 PYDKIHNI 203
              K  ++
Sbjct: 197 DIPKGADV 204


>gi|90579110|ref|ZP_01234920.1| hypothetical outer membrane lipoproteins carrier protein [Vibrio
           angustum S14]
 gi|90439943|gb|EAS65124.1| hypothetical outer membrane lipoproteins carrier protein [Vibrio
           angustum S14]
          Length = 205

 Score = 64.5 bits (156), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 25/169 (14%), Positives = 64/169 (37%), Gaps = 15/169 (8%)

Query: 37  KKAIEHFLSIQTMQGTFLQ---EDAGYVM---KGEFFMARPSKFYFKYSSPSSVSLISDG 90
           +        +      F Q      G ++    G+  + RP+ F +   +P +  L+SDG
Sbjct: 27  QTLSSRLDKVNAFSANFTQKVISPDGEILVDGTGDLSIKRPNLFRWDTKTPDASLLVSDG 86

Query: 91  SNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQ-HVIQESIQRVESNNSFITIFFKDD 145
             +  Y+  ++  +   L+       F ++  NN+    + +++++       T+  KD 
Sbjct: 87  KTVWYYSPFVEQVTAMWLKDATEQTPFVLLTRNNEKDWSRYNVKQL---ADTFTLTPKDK 143

Query: 146 FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
                  +       ++ N+ +++S  + S   + K+         +F+
Sbjct: 144 TSSMDEFIVTVSKDGQVRNFSVVESDGQRSNYTLSKFTRT-TPAADLFK 191


>gi|229591235|ref|YP_002873354.1| outer-membrane lipoprotein carrier protein [Pseudomonas fluorescens
           SBW25]
 gi|259491789|sp|C3JY57|LOLA_PSEFS RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229363101|emb|CAY50104.1| outer-membrane lipoprotein carrier protein [Pseudomonas fluorescens
           SBW25]
          Length = 207

 Score = 64.5 bits (156), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 35/188 (18%), Positives = 65/188 (34%), Gaps = 19/188 (10%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQ--EDAG----YVMKGEFFMARPSKFYFKYSSPSSV 84
               SV          QT+   F Q   DAG        GE  + RP  FY+     +  
Sbjct: 21  ADPASVASLKNLLDKSQTLTARFSQMTLDAGGTQLQETAGEMAVQRPGLFYWHTEGKAEQ 80

Query: 85  SLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQESIQRVESNNSFITI 140
           +++SDG  + +++  L+  ++      L     +++ S +   I +     +  +   + 
Sbjct: 81  TIVSDGQKVTLWDPDLEQATINKLDPRLNQTP-ALLLSGDVSKIND---SFDITSKQTSN 136

Query: 141 FFKDDFMGNMISVTFDRLSYRLLNWKI-----MDSSRRYSIIKILKYKENTVLDPKVFEI 195
             +           FD LS    N  I     +DS  + + I     K N  +    F+ 
Sbjct: 137 VIEFTLKPKSKDTLFDTLSLSFGNGVINNMRLVDSVGQRTDILFSGVKANQPVPASKFKF 196

Query: 196 PYDKIHNI 203
              K  ++
Sbjct: 197 DIPKGADV 204


>gi|167563731|ref|ZP_02356647.1| outer-membrane lipoprotein carrier protein [Burkholderia
           oklahomensis EO147]
          Length = 236

 Score = 64.5 bits (156), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 32/191 (16%), Positives = 61/191 (31%), Gaps = 27/191 (14%)

Query: 37  KKAIEHFLSIQTMQGTFLQ--------EDAGYV--------MKGEFFMARPSKFYFKYSS 80
           ++       +   +G F Q          +G V          G F  +RP KF + Y  
Sbjct: 46  EQLRAFVSKVHAAKGDFTQQIVKAPSKAASGAVPTVKPTDNSSGSFVFSRPGKFIWTYQK 105

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESIQRVESNNS 136
           P    L +DG  + VY+  L+  +       L     +++F +N  + +    R      
Sbjct: 106 PYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSN-DLEKNYTLRDAGEKG 164

Query: 137 FI----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
            I     +    D     I + F       +   + D     +++     + N  L    
Sbjct: 165 GIDWLEMVPKAQDTQFQRIGIGFRNGVLAAME--LHDVFGNVTLLTFTNIQTNPPLKADQ 222

Query: 193 FEIPYDKIHNI 203
           F+    K  ++
Sbjct: 223 FKFVVPKGADV 233


>gi|269102236|ref|ZP_06154933.1| outer membrane lipoprotein carrier protein LolA [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268162134|gb|EEZ40630.1| outer membrane lipoprotein carrier protein LolA [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 203

 Score = 64.5 bits (156), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 29/189 (15%), Positives = 62/189 (32%), Gaps = 14/189 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVM---KGEFFM 68
                 + P   A  +  D + +        +      F Q      G  +    G   +
Sbjct: 4   AVLGLLVAPLLFASNVWAD-AQQDLSARLDKVNAFTADFQQKVVSPDGETLVNGSGTVAV 62

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVI 124
            RP+ F +    P    L+SDG  +  YN  ++  +   L+       F ++  N+    
Sbjct: 63  KRPNLFRWDTQKPDENLLVSDGKTVWYYNPFVEQVTAMWLKNATEQTPFVLLTRNSASDW 122

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
            +      ++   +T   K   MG  +       + ++ N+ +++   + S      +K 
Sbjct: 123 SQYNVHQTADTFTLTPKDKTSSMGKFVLTV--NKNGQVRNFTVVEQDGQKSSFTFNDFKT 180

Query: 185 NTVLDPKVF 193
                 K+F
Sbjct: 181 -ATPAAKLF 188


>gi|224367520|ref|YP_002601683.1| outer membrane lipoprotein carrier protein precursor
           [Desulfobacterium autotrophicum HRM2]
 gi|223690236|gb|ACN13519.1| outer membrane lipoprotein carrier protein precursor
           [Desulfobacterium autotrophicum HRM2]
          Length = 267

 Score = 64.5 bits (156), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 75/209 (35%), Gaps = 19/209 (9%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA------GYVM 62
           V+ VV+  F +A     A       ++V   IEH  S Q     F Q             
Sbjct: 56  VLSVVLFSFANA----QADTQTPDLETVLTGIEHRYSGQDFTANFYQTSRLAAIEITETA 111

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW---SVYPLRYMAFSVIFSN 119
            G+ F + P +  ++Y  P    +I++G  + +Y  + +                  F +
Sbjct: 112 NGQAFFSHPGRMRWEYQEPERQEIITNGKTLWIYRTEENQVVKGDAAAFFKTGGGGAFLS 171

Query: 120 NQHVIQ--ESIQRVESNNSFITIFF---KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +  +I+   +I   + +  F+T+     + +     I +   R ++ +   +  ++    
Sbjct: 172 DITLIRIDYTITLGKFDTDFVTLVLVPKRQNPEITTIDIRVSRTTFDVDRVETTNTYG-D 230

Query: 175 SIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           + I   K      L+  +FE    +  ++
Sbjct: 231 TTILEFKEITFHKLEKALFEFTVPEGTDL 259


>gi|254372265|ref|ZP_04987756.1| hypothetical protein FTCG_01331 [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|151569994|gb|EDN35648.1| hypothetical protein FTCG_01331 [Francisella novicida GA99-3549]
          Length = 205

 Score = 64.5 bits (156), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 35/200 (17%), Positives = 81/200 (40%), Gaps = 15/200 (7%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------EDAGYVMKGEFF 67
           I+  +   F  N ++       + K      +I +M   F Q       +     KG   
Sbjct: 4   IIICFIFAFSINVSFADATSDLIDKI----KNIHSMTANFNQKLIDGQTNNNLNSKGNMS 59

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHV 123
           + +P  F +  +SP++  ++S+G+ + +Y+  LD   +  +        + ++ S N + 
Sbjct: 60  LKKPQYFKWITTSPNNQEIVSNGTKLWIYDGDLDQLIIKKVSNDIAQFPYLILLSKNTNN 119

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
           I +       +N+   +  K+D M + I + F   + +L   +I  S  +++ I+    K
Sbjct: 120 INKLFTVTAQDNNSYILKPKNDQMIDSIKIKFTPNN-QLEYLEISTSLNQFTKIEFNNVK 178

Query: 184 ENTVLDPKVFEIPYDKIHNI 203
            +  +    F+    +  +I
Sbjct: 179 TDVDISNTSFDFTAPQDTDI 198


>gi|152997261|ref|YP_001342096.1| outer membrane lipoprotein carrier protein LolA [Marinomonas sp.
           MWYL1]
 gi|150838185|gb|ABR72161.1| outer membrane lipoprotein carrier protein LolA [Marinomonas sp.
           MWYL1]
          Length = 215

 Score = 64.2 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 30/211 (14%), Positives = 80/211 (37%), Gaps = 12/211 (5%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---DAG 59
           FL   +++  ++      I        +    +           + ++G F Q    + G
Sbjct: 2   FLWRYNLLNKLVTMAMFTIVTVFQTAMVQAADATSSIESLLELNRNIEGEFRQVTYDEKG 61

Query: 60  YV---MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMA 112
                 +G F +A+P++F +   +P +  +ISDG  I V++  L+  +  PL        
Sbjct: 62  KQLQVSEGVFLLAKPNQFVWDSVTPFAQRIISDGKYITVWDVDLEQATKKPLSGAVGNSP 121

Query: 113 FSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSR 172
            +++      V+         +  F     +D  +   ++++F       ++  I+D+  
Sbjct: 122 AALLGQPAAEVLPHYNVTKLGDEKFRLAPKEDQDLFQTLTLSFRNKVISAMS--ILDALG 179

Query: 173 RYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           + ++I+    + +  +  + F +      ++
Sbjct: 180 QTTVIEFKNVETHEGVAKENFVLDLPANVDV 210


>gi|83718722|ref|YP_442106.1| outer-membrane lipoprotein carrier protein [Burkholderia
           thailandensis E264]
 gi|167580958|ref|ZP_02373832.1| outer-membrane lipoprotein carrier protein [Burkholderia
           thailandensis TXDOH]
 gi|257138291|ref|ZP_05586553.1| outer-membrane lipoprotein carrier protein [Burkholderia
           thailandensis E264]
 gi|83652547|gb|ABC36610.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           thailandensis E264]
          Length = 236

 Score = 64.2 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 32/191 (16%), Positives = 61/191 (31%), Gaps = 27/191 (14%)

Query: 37  KKAIEHFLSIQTMQGTFLQ--------EDAGYV--------MKGEFFMARPSKFYFKYSS 80
           ++       +   +G F Q          +G V          G F  +RP KF + Y  
Sbjct: 46  EQLKAFVAKVHAAKGDFTQQIVKAPSKAASGAVPTVKPTDNSSGSFVFSRPGKFIWTYQK 105

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESIQRVESNNS 136
           P    L +DG  + VY+  L+  +       L     +++F +N  + +    R      
Sbjct: 106 PYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSN-DIDKNYTLRDAGEKG 164

Query: 137 FI----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
            I     +    D     I + F       +   + D     +++     + N  L    
Sbjct: 165 GIDWLEMVPKAQDTQFQRIGIGFRNGMLAAME--LHDVFGNVTLLTFTNIQTNPPLKADQ 222

Query: 193 FEIPYDKIHNI 203
           F+    K  ++
Sbjct: 223 FKFVVPKGADV 233


>gi|262277805|ref|ZP_06055598.1| putative outer membrane lipoprotein carrier protein [alpha
           proteobacterium HIMB114]
 gi|262224908|gb|EEY75367.1| putative outer membrane lipoprotein carrier protein [alpha
           proteobacterium HIMB114]
          Length = 187

 Score = 64.2 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 33/178 (18%), Positives = 68/178 (38%), Gaps = 12/178 (6%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPS 82
           PFN+   IT D       +       +  +F Q+       GE ++  P      YS   
Sbjct: 14  PFNSFSNITDD-----IAKKLNETNNLIFSFEQKSNNLNEIGECYLLFPGNLKCIYSGEE 68

Query: 83  SVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHV----IQESIQRVESNNSFI 138
              +    +++ +   K      YP++  AF+++   N+ +      +  +    N+++ 
Sbjct: 69  GKEIYVKNNSLYIIKHKFKRSYRYPIKNSAFNIVLDKNKILENLKSIDQSKIGSQNDNYF 128

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
                DD  G  + + F++ +  L  W+ +  ++      I+  K NT    K F +P
Sbjct: 129 YEIRTDD--GVFVKIFFNKKTKLLRGWETISYNQEPVKFTIINPKINTEFKEK-FILP 183


>gi|167570878|ref|ZP_02363752.1| outer-membrane lipoprotein carrier protein [Burkholderia
           oklahomensis C6786]
          Length = 231

 Score = 64.2 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 32/191 (16%), Positives = 61/191 (31%), Gaps = 27/191 (14%)

Query: 37  KKAIEHFLSIQTMQGTFLQ--------EDAGYV--------MKGEFFMARPSKFYFKYSS 80
           ++       +   +G F Q          +G V          G F  +RP KF + Y  
Sbjct: 41  EQLRAFVSKVHAAKGDFTQQIVKAPSKAASGAVPTVKPTDNSSGSFVFSRPGKFIWTYQK 100

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESIQRVESNNS 136
           P    L +DG  + VY+  L+  +       L     +++F +N  + +    R      
Sbjct: 101 PYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSN-DLEKNYTLRDAGEKG 159

Query: 137 FI----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
            I     +    D     I + F       +   + D     +++     + N  L    
Sbjct: 160 GIDWLEMVPKAQDTQFQRIGIGFRNGVLAAME--LHDVFGNVTLLTFTNIQTNPPLKADQ 217

Query: 193 FEIPYDKIHNI 203
           F+    K  ++
Sbjct: 218 FKFVVPKGADV 228


>gi|241667330|ref|ZP_04754908.1| lipoprotein releasing system, subunit A [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254875882|ref|ZP_05248592.1| lipoprotein releasing system protein [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254841903|gb|EET20317.1| lipoprotein releasing system protein [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
          Length = 205

 Score = 64.2 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 38/201 (18%), Positives = 79/201 (39%), Gaps = 16/201 (7%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-------EDAGYVMKGEF 66
           I+   + +F  N ++    D  + K      +I +M  +F Q              KG  
Sbjct: 4   IVLLVTLVFSINYSFANASDDLINKI----KNIHSMSASFDQKLINGGRASDNISSKGYM 59

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQH 122
            + +P  F +  +SP++  +IS+GS + +Y+  L+   +  +        + ++ S N  
Sbjct: 60  SLKKPKFFRWITTSPNNQEIISNGSKLWIYDGDLEQVIIKKVSNNIAQFPYLILLSKNTD 119

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
            I +     E + +   +  K+D M + I + F      L    I  S  +++ I     
Sbjct: 120 NINKLFTVRELDKNTYLLKPKNDQMIDSIQIKFSDNE-NLEYLAISTSLNQFTKISFSDL 178

Query: 183 KENTVLDPKVFEIPYDKIHNI 203
           K +  +D   F+    K  ++
Sbjct: 179 KTDIDIDNTKFDFDIPKDTDV 199


>gi|118496903|ref|YP_897953.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           novicida U112]
 gi|194324130|ref|ZP_03057904.1| outer membrane lipoprotein carrier protein LolA [Francisella
           tularensis subsp. novicida FTE]
 gi|171472962|sp|A0Q4N4|LOLA_FRATN RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|118422809|gb|ABK89199.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella novicida U112]
 gi|194321577|gb|EDX19061.1| outer membrane lipoprotein carrier protein LolA [Francisella
           tularensis subsp. novicida FTE]
          Length = 205

 Score = 64.2 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 32/179 (17%), Positives = 75/179 (41%), Gaps = 11/179 (6%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQ------EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLIS 88
           +    I+   +I +M   F Q       +     KG   + +P  F +  +SP++  ++S
Sbjct: 21  ATSDLIDKIKNIHSMTANFNQKLIDGQTNNNLNSKGNMSLKKPQYFKWITTSPNNQEIVS 80

Query: 89  DGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKD 144
           +G+ + +Y+  LD   +  +        + ++ S N + I +       +N+   +  K+
Sbjct: 81  NGTKLWIYDGDLDQLIIKKVSNDIAQFPYLILLSKNTNNINKLFTVTAQDNNSYILKPKN 140

Query: 145 DFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           D M + I + F   + +L   +I  S  +++ I+    K +  +    F+    +  +I
Sbjct: 141 DQMIDSIKIKFTPNN-QLEYLEISTSLNQFTKIEFNNVKTDVDISNTSFDFTAPQDTDI 198


>gi|167837526|ref|ZP_02464409.1| outer-membrane lipoprotein carrier protein [Burkholderia
           thailandensis MSMB43]
          Length = 236

 Score = 64.2 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 32/191 (16%), Positives = 60/191 (31%), Gaps = 27/191 (14%)

Query: 37  KKAIEHFLSIQTMQGTFLQ--------EDAGYV--------MKGEFFMARPSKFYFKYSS 80
           ++       +   +G F Q          +G V          G F  +RP KF + Y  
Sbjct: 46  EQLKAFVAKVHAARGDFTQQIVKAPSKAASGAVPTVKPTDNSSGSFVFSRPGKFIWTYQK 105

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESIQRVESNNS 136
           P    L +DG  + VY+  L+  +       L     +++F +N  + +    R      
Sbjct: 106 PYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSN-DLEKNYTLRDAGEKG 164

Query: 137 FI----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
            I     +    D     I + F       +   + D     +++     + N  L    
Sbjct: 165 GIDWLEMVPKAQDTQFQRIGIGFRNGMLAAME--LHDVFGNVTLLTFTNIQTNPPLKADQ 222

Query: 193 FEIPYDKIHNI 203
           F     K  ++
Sbjct: 223 FRFVVPKGADV 233


>gi|322435183|ref|YP_004217395.1| outer membrane lipoprotein carrier protein LolA [Acidobacterium sp.
           MP5ACTX9]
 gi|321162910|gb|ADW68615.1| outer membrane lipoprotein carrier protein LolA [Acidobacterium sp.
           MP5ACTX9]
          Length = 220

 Score = 64.2 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/124 (12%), Positives = 39/124 (31%), Gaps = 12/124 (9%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----YVMKGEFFMARPSKFYFKYSSPSSV 84
              +D  ++K  +H+  + +++  + +   G        G   + +P +  + Y  P+  
Sbjct: 28  QSPQDALLQKVDDHYNHLASLRARYREHYTGMGMDRSESGTLLLKKPGRMAWHYDVPAGK 87

Query: 85  SLISDGSNIAVYNAKLDTWSVYPLRY-----MAFSVIFSN---NQHVIQESIQRVESNNS 136
             + DG     Y          P +           +  +    + + Q  +  V +   
Sbjct: 88  LFVFDGKFAWFYTPGDPQAQKIPAKQMDDLHTPLRFLLGHTQLKKELDQIKVTPVGTEFR 147

Query: 137 FITI 140
              I
Sbjct: 148 ITGI 151


>gi|289679163|ref|ZP_06500053.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. syringae FF5]
          Length = 145

 Score = 63.8 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/136 (16%), Positives = 49/136 (36%), Gaps = 11/136 (8%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEF 66
           +I    +    F+        + V +  +     QT+   F Q   +  G       GE 
Sbjct: 3   LIRMLLATALTFSMIPAHADSKDVARLTQLLEKSQTLTARFSQLTLDGGGTQLQETTGEM 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQH 122
            + RP  F +   +P    ++SDG  +++++  L+  ++  L         +++ S +  
Sbjct: 63  ALQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTP-ALLLSGDVS 121

Query: 123 VIQESIQRVESNNSFI 138
            I ES          +
Sbjct: 122 KISESFDITAKEAGGV 137


>gi|319787146|ref|YP_004146621.1| outer membrane lipoprotein carrier protein LolA [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465658|gb|ADV27390.1| outer membrane lipoprotein carrier protein LolA [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 210

 Score = 63.8 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/175 (14%), Positives = 56/175 (32%), Gaps = 17/175 (9%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQ---EDAGY---VMKGEFFMARPSKFYFKYSSPSSVSLIS 88
           +  + +     ++ ++G F Q   +  G       G   ++ P  F ++Y  P +  +++
Sbjct: 26  ARDELVRFTSGLKGLEGRFEQQVFDANGRSKERSSGSVAVSAPRLFRWEYQKPFAQLIVA 85

Query: 89  DGSNIAVYNAKLDTWSVYPL----RYMAFSVI-----FSNNQHVIQESIQRVESNNSFIT 139
           DG  + VY   L   +V       R      +           V +E+          +T
Sbjct: 86  DGQKVWVYEPDLKQATVKSQGEEERNSPLVALFEPARLDRQFDVSEEATASEGLQWLTLT 145

Query: 140 IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
                +    +  + F       +   + D   + + I+   +K N       F 
Sbjct: 146 PKIDTEASFQVARLGFGPQGLARMQ--VTDLVGQKTEIRFDAWKRNPSFGAGTFV 198


>gi|254797060|ref|YP_003081898.1| outer membrane lipoprotein carrier protein LolA [Neorickettsia
           risticii str. Illinois]
 gi|254590307|gb|ACT69669.1| outer membrane lipoprotein carrier protein LolA [Neorickettsia
           risticii str. Illinois]
          Length = 183

 Score = 63.8 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 66/191 (34%), Gaps = 12/191 (6%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGE 65
            SV    +LF   A     A+  +   + V     +  S++T+  TF+Q    G +  G 
Sbjct: 1   MSVKRFAVLFCVLAFCCVRASCALDNAELV----SYLASLRTLCATFVQYNPDGTLSTGS 56

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM-AFSVIFSNNQHVI 124
            F++ P KF   Y     VS+  +   I   +A L     + +       +  S+   + 
Sbjct: 57  LFLSVPHKFRVDYHE-EGVSVAMNKGMITYRDATLKESRSFFVGKSDPLLLAISDLGALH 115

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           +   Q +     +     +         +        +      D S++ + + +     
Sbjct: 116 RYK-QSIRGGLFY----LERSSKNRKYVLVLSHSPAEIREILFEDDSKQITRMILSDVCY 170

Query: 185 NTVLDPKVFEI 195
           N  LD  +F+I
Sbjct: 171 NASLDRSIFDI 181


>gi|254373745|ref|ZP_04989228.1| hypothetical protein FTDG_01529 [Francisella novicida GA99-3548]
 gi|151571466|gb|EDN37120.1| hypothetical protein FTDG_01529 [Francisella novicida GA99-3548]
          Length = 205

 Score = 63.8 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 36/200 (18%), Positives = 83/200 (41%), Gaps = 15/200 (7%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------EDAGYVMKGEFF 67
           I+  +   F  N ++     + + K      +I +M   F Q       +     KG   
Sbjct: 4   IIICFIFAFSINVSFADATSELIDKI----KNIHSMTANFNQKLIDGQTNNNLNSKGNMS 59

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHV 123
           + +P  F +  +SP++  ++S+G+ + +Y+  LD   +  +        + ++ S N + 
Sbjct: 60  LKKPQYFKWITTSPNNQEIVSNGTKLWIYDGDLDQLIIKKVSNDIAQFPYLILLSKNTNN 119

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
           I +       +N+   +  K+D M + I + F  L+ +L   +I  S  +++ I+    K
Sbjct: 120 INKLFTVTAQDNNSYILKPKNDQMIDSIKIKFT-LNNQLEYLEISTSLNQFTKIEFNNVK 178

Query: 184 ENTVLDPKVFEIPYDKIHNI 203
            +  +    F+    +  +I
Sbjct: 179 TDVDISNTSFDFTAPQDTDI 198


>gi|332285170|ref|YP_004417081.1| outer-membrane lipoprotein carrier protein [Pusillimonas sp. T7-7]
 gi|330429123|gb|AEC20457.1| outer-membrane lipoprotein carrier protein [Pusillimonas sp. T7-7]
          Length = 211

 Score = 63.8 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 30/191 (15%), Positives = 66/191 (34%), Gaps = 17/191 (8%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGE------FFMAR 70
           F + I    +        + ++  +    +++  G F Q+      +G       F   R
Sbjct: 10  FVTTIVLAVSPLAAWSVPAPEQLEQFIAQVKSATGDFTQQRLDQNSQGRPAQSGQFSFKR 69

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQE 126
           P +F +    P    +ISDG  +  Y+  L   +       +     +++F +       
Sbjct: 70  PGQFKWAVVKPYEQLIISDGKRVYQYDPDLAQVTERGVDQSIGASPAAILFGSGSLEEAF 129

Query: 127 SIQRVESNNSFITIFFK---DDFMGNMISVTF-DRLSYRLLNWKIMDSSRRYSIIKILKY 182
           +I  + S +    +  +    D     + + F + +  RL    ++DS  + + I +   
Sbjct: 130 TISSLPSKDGLDWLRAQPRSADAGFTHVDIGFKNAMPARLE---LLDSFGQTTRIDLSNI 186

Query: 183 KENTVLDPKVF 193
             N  L    F
Sbjct: 187 VANPTLGADEF 197


>gi|127512951|ref|YP_001094148.1| outer membrane lipoprotein carrier protein LolA [Shewanella loihica
           PV-4]
 gi|166230499|sp|A3QEJ1|LOLA_SHELP RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|126638246|gb|ABO23889.1| outer membrane lipoprotein carrier protein LolA [Shewanella loihica
           PV-4]
          Length = 208

 Score = 63.8 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 33/196 (16%), Positives = 70/196 (35%), Gaps = 15/196 (7%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPS 72
            A+    AA     D +  K  +    +  ++  F Q+             G F +A P+
Sbjct: 10  CALPLVVAASSYADDSAALK--DKLAKLDNLKANFSQQVTDVNNKVIQQGTGTFALAVPN 67

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESI 128
           +FY+  + P    +++DG ++ +YN   +  SV            +++   +    Q   
Sbjct: 68  QFYWHLTQPDESLIVADGRDVWIYNPFAEEVSVLDFNQAINASPIALLVHRDDATWQAYQ 127

Query: 129 QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
            + + +   IT    D  +   + V F     +L   K+ D     S+  +         
Sbjct: 128 VKRQDDCYQITPKAVDASVTG-VEVCF--KDEQLEVMKLTDQQGNLSVFNLSAQAPLKDA 184

Query: 189 DPKVFEIPYDKIHNIN 204
           D  +F+    +  +I+
Sbjct: 185 DASLFQFTVPEGVDID 200


>gi|116331691|ref|YP_801409.1| Outer membrane lipoprotein-sorting protein [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
 gi|116125380|gb|ABJ76651.1| Outer membrane lipoprotein-sorting protein [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
          Length = 236

 Score = 63.8 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/213 (14%), Positives = 70/213 (32%), Gaps = 27/213 (12%)

Query: 9   VIGVVILFFYSAI--FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTF-LQEDAGYVMK-- 63
           ++   ILF           A    +  + VK+  + F  + + +  F +Q  +    K  
Sbjct: 6   ILSFYILFLVLEPDFLAQPAHNWNSPSEVVKQVKKKFNDLSSYKANFQIQTVSNKKSKNM 65

Query: 64  -GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL------RYMA---- 112
            G     +  +  +++S PS   ++SDG  + +Y A+L+      L      +       
Sbjct: 66  RGVCLYKKGGRIRYQFSDPSGDEIVSDGKTLYIYIARLNAVGKQDLTLNKSNKSGPIFSS 125

Query: 113 -----FSVIFSN---NQHVIQESIQRVESNNSFITIFFKDDFMGN---MISVTFDRLSYR 161
                 S IF         I++     +    +  +  +          + +  D  +Y 
Sbjct: 126 FTDEGLSRIFRKYHYKFDSIEQPQTSSKDGRKYFVLNLEQREKIGGFETMLLYVDAETYF 185

Query: 162 LLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
           +      D   + + ++    + N  L+   F 
Sbjct: 186 IQKAVASDGRGKETTVEFSNLEINPDLEDGQFN 218


>gi|13488529|ref|NP_109536.1| hypothetical protein mll9691 [Mesorhizobium loti MAFF303099]
 gi|14028283|dbj|BAB54875.1| mll9691 [Mesorhizobium loti MAFF303099]
          Length = 56

 Score = 63.8 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 20/52 (38%)

Query: 153 VTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
           + FD+ S  L  W + D   + + + I   KE     P  F I Y      N
Sbjct: 1   MVFDKKSLHLRRWSLTDERGQRTTVTISNVKEGVRAPPGTFTIDYAANREFN 52


>gi|187931113|ref|YP_001891097.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|229485830|sp|B2SFG6|LOLA_FRATM RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|187712022|gb|ACD30319.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 205

 Score = 63.8 bits (154), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 34/200 (17%), Positives = 81/200 (40%), Gaps = 15/200 (7%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------EDAGYVMKGEFF 67
           I+  +  +F  N ++     + + K      +I +M   F Q       +     KG   
Sbjct: 4   IIICFIFVFSINVSFADATSELIDKI----KNIHSMTANFNQKLIDGQTNNNLNSKGNMS 59

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHV 123
           + +P  F +  +SP+   ++ +G+ + +Y+  LD   +  +        + ++ S N + 
Sbjct: 60  LKKPQYFKWITTSPNHQEIVYNGTKLWIYDGDLDQLIIKKVSNDIAQFPYLILLSKNTNN 119

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
           I +       +N+   +  K+D M + I + F   + +L   +I  S  +++ I+    K
Sbjct: 120 INKLFTVTAQDNNSYILKPKNDQMIDSIKIKFTPNN-QLEYLEISTSLNQFTKIEFNNVK 178

Query: 184 ENTVLDPKVFEIPYDKIHNI 203
            +  +    F+    +  +I
Sbjct: 179 TDVDISNTSFDFKAPQNTDI 198


>gi|33593455|ref|NP_881099.1| outer-membrane lipoprotein carrier protein [Bordetella pertussis
           Tohama I]
 gi|47117176|sp|Q7VW06|LOLA_BORPE RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|33572811|emb|CAE42744.1| putative exported protein [Bordetella pertussis Tohama I]
 gi|332382864|gb|AEE67711.1| outer-membrane lipoprotein carrier protein [Bordetella pertussis
           CS]
          Length = 210

 Score = 63.8 bits (154), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/170 (13%), Positives = 57/170 (33%), Gaps = 19/170 (11%)

Query: 37  KKAIEHFLSIQTMQGTFLQE---DAGYVM---KGEFFMARPSKFYFKYSSPSSVSLISDG 90
           ++      +++   G+F Q      G       G F   RP KF +    P    ++SDG
Sbjct: 31  EQLDTFVATVKGATGSFKQSTVSPQGATQPAQSGTFAFQRPGKFKWAVQLPYEQLIVSDG 90

Query: 91  SNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDF 146
             +  Y+  L   +V  +         +++F   Q     ++  +   +     + +   
Sbjct: 91  KQVFQYDPDLAQVTVRQVDQAIGTSPAAILFGAGQLSQAFAVSALPDRDGL--QWLRAKP 148

Query: 147 MGNMISVTFDRLSYRLL-----NWKIMDSSRRYSIIKILKYKENTVLDPK 191
                   F ++   L        +++D+  + + +++       V   +
Sbjct: 149 RNADAG--FSQVDIGLRDNQPARIELVDAFGQTTRVELSNLLPGAVPASE 196


>gi|225874662|ref|YP_002756121.1| outer membrane lipoprotein carrier protein, LolA family
           [Acidobacterium capsulatum ATCC 51196]
 gi|225791682|gb|ACO31772.1| outer membrane lipoprotein carrier protein, LolA family
           [Acidobacterium capsulatum ATCC 51196]
          Length = 226

 Score = 63.4 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/124 (12%), Positives = 39/124 (31%), Gaps = 11/124 (8%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITK-DQSVKKAIEHFLSIQTMQGTFLQEDAG---- 59
               ++    +   +A  P +A+  +    +   +  +H+  + +++  F+Q   G    
Sbjct: 8   PLARILCFAAIASLTA-LPLHASGTMPGVKELAARVDQHYNRLHSLEVAFVQSYTGMGLH 66

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAFS 114
               G   + +P +  + Y+ P     + DG     Y          P +          
Sbjct: 67  KREAGALLLKKPGRMRWTYTQPDGKLYVLDGKFGYFYTPGQTEAQKVPAKKLDDLQSPLR 126

Query: 115 VIFS 118
            +  
Sbjct: 127 YLLG 130


>gi|163783604|ref|ZP_02178593.1| hypothetical protein HG1285_08341 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881097|gb|EDP74612.1| hypothetical protein HG1285_08341 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 206

 Score = 63.4 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 31/195 (15%), Positives = 70/195 (35%), Gaps = 17/195 (8%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEF 66
           +I+F    + P  A     K+       +    +++++  F+Q+          + KG F
Sbjct: 3   LIVFVLLFLTPLIAVSSTFKE-----LEDKLKDVKSVRVVFVQKTRYSWYPKPELSKGVF 57

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAF---SVIFSNNQ 121
           +  +  KF  +Y+ P  V ++S+G  I + N +                      FS   
Sbjct: 58  YAMKDGKFRIEYTYPDEVVMVSNGKEIIILNKEDREAIIDSVENNTSPVIESLFFFSKPL 117

Query: 122 HVIQESIQRVESNNSFITIFFKDDFMGNMISVTFD-RLSYRLLNWKIMDSSRRYSIIKIL 180
             + E +  +E     + I        N+  V  +      +   +++DS    + ++ +
Sbjct: 118 SEVFEPVGELEKKGLKVLILKPKRKDENIKEVYVELDKDLEVRRIRVVDSEDTQTTVEFI 177

Query: 181 KYKENTVLDPKVFEI 195
             ++N      +F I
Sbjct: 178 DIRKNFKPSAGLFRI 192


>gi|167619049|ref|ZP_02387680.1| outer-membrane lipoprotein carrier protein [Burkholderia
           thailandensis Bt4]
          Length = 236

 Score = 63.4 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 62/191 (32%), Gaps = 27/191 (14%)

Query: 37  KKAIEHFLSIQTMQGTFLQ--------EDAGYV--------MKGEFFMARPSKFYFKYSS 80
           ++       +   +G F Q          +G V          G F  +RP KF + Y  
Sbjct: 46  EQLKAFVAKVHAAKGDFTQQIVKAPSKAASGAVPTVKPTDNSSGSFVFSRPGKFIWTYQK 105

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESIQRVESNNS 136
           P    L +DG  + VY+  L+  +       L     +++F +N  + +    R     S
Sbjct: 106 PYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSN-DIDKNYTLRDAGEKS 164

Query: 137 FI----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
            I     +    D     I + F       +   + D     +++     + N  L    
Sbjct: 165 GIDWLEMVPKAQDTQFQRIGIGFRNGMLAAME--LHDVFGNVTLLTFTNIQTNPPLKADQ 222

Query: 193 FEIPYDKIHNI 203
           F+    K  ++
Sbjct: 223 FKFVVPKGADV 233


>gi|328954082|ref|YP_004371416.1| outer membrane lipoprotein carrier protein LolA [Desulfobacca
           acetoxidans DSM 11109]
 gi|328454406|gb|AEB10235.1| outer membrane lipoprotein carrier protein LolA [Desulfobacca
           acetoxidans DSM 11109]
          Length = 240

 Score = 63.4 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 80/211 (37%), Gaps = 21/211 (9%)

Query: 7   KSVI--GVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------EDA 58
           +S++   +++L +   + P   A  ++ ++ + +  + + +    +  F Q        A
Sbjct: 18  RSILWAAMILLVWGFCLGPAGPAVAVSPEEIITQVQKKYDATGMFKTRFRQESQLKTAGA 77

Query: 59  GYVMKGEFFMARPSKFYFKYSSP--SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVI 116
               +G  F  +PS+  ++Y  P      +I+DG  +++Y  +     VYPL  +  S +
Sbjct: 78  PDTAEGWLFFKKPSRMRWQYQYPPEQKKEVIADGREVSIYIPQDRMVMVYPLNQVLRSDL 137

Query: 117 ----------FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWK 166
                        +  V  +   ++           K       + +T D  ++ +   +
Sbjct: 138 VMRFFSGMGRLQTDFTVTWDRPYQIHEPIRIRLKPVKPQPELKHLILTIDPETFLVQALE 197

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFE-IP 196
             ++   ++ +   + + +  L P  F  IP
Sbjct: 198 FSNAYGDHTRMSFTQTQLDIKLAPGFFTFIP 228


>gi|238026470|ref|YP_002910701.1| outer-membrane lipoprotein carrier protein [Burkholderia glumae
           BGR1]
 gi|237875664|gb|ACR27997.1| Outer membrane lipoprotein carrier protein LolA [Burkholderia
           glumae BGR1]
          Length = 233

 Score = 63.4 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/192 (15%), Positives = 60/192 (31%), Gaps = 27/192 (14%)

Query: 37  KKAIEHFLSIQTMQGTFLQ--------EDAGYVMK----------GEFFMARPSKFYFKY 78
            +       +++ +G F Q          +G +            G F   RP KF + Y
Sbjct: 41  DELKAFVAQVKSARGDFTQQIVKAPSKAASGAIATTAAKSTDDSSGSFVFLRPGKFVWSY 100

Query: 79  SSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESIQRVESN 134
             P    L +DG  + VY+  L+  +       L     +++F +N      +++     
Sbjct: 101 EKPYQQLLQADGETLYVYDKDLNQVTERKLAGALGASPAAILFGSNDIEKNYTLRDAGEK 160

Query: 135 NSFITIFF---KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPK 191
                +       D     I + F   +   +   + D     +++     + N  L   
Sbjct: 161 GGIDWVEMLPKARDTQFQRIGIGFKGGALAAME--LHDVFGNVTLLTFTHMQTNPALPAG 218

Query: 192 VFEIPYDKIHNI 203
            F     K  ++
Sbjct: 219 QFRFSVPKGTDV 230


>gi|157962053|ref|YP_001502087.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           pealeana ATCC 700345]
 gi|189028561|sp|A8H4R5|LOLA_SHEPA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|157847053|gb|ABV87552.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           pealeana ATCC 700345]
          Length = 208

 Score = 63.4 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 35/200 (17%), Positives = 73/200 (36%), Gaps = 23/200 (11%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------Y 60
           K +  +  L          A      D  VK      + I T++  F Q           
Sbjct: 2   KKIFTIAALSLPLFCH-LPAMAGGQDDLKVK-----LMEINTLKANFNQTVTDINQKVIQ 55

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVI 116
             +G F ++ P++FY+  ++P    +++DG+++ +YN   +  SV  +         +++
Sbjct: 56  TGEGVFALSHPNQFYWHLTAPDESLIVADGTDVWIYNPFAEEVSVMDINQAINASPIALL 115

Query: 117 F-SNNQHVIQESIQRVESNNSFITIFFKDDFMG-NMISVTFDRLSYRLLNWKIMDSSRRY 174
             S++    Q  +     N     I  +D   G + + V F++   +L    + D     
Sbjct: 116 VHSDDATWSQYDVVN---NGDCFDISPRDKDSGVSEVEVCFNQQ--QLTKMVLKDQQGNT 170

Query: 175 SIIKILKYKENTVLDPKVFE 194
           S   +         D  +F+
Sbjct: 171 SDFTLTNQTPIAENDKDLFK 190


>gi|237748654|ref|ZP_04579134.1| outer-membrane lipoprotein carrier protein [Oxalobacter formigenes
           OXCC13]
 gi|229380016|gb|EEO30107.1| outer-membrane lipoprotein carrier protein [Oxalobacter formigenes
           OXCC13]
          Length = 209

 Score = 63.4 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 38/215 (17%), Positives = 76/215 (35%), Gaps = 28/215 (13%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-----DAGYV 61
           +      I      + P  A+       ++ +      + ++ +G F Q      D   +
Sbjct: 2   RPFFSKAIAMALFVLIPAFAS-----ATALDQLKSFSTNARSAKGEFSQGQVKGGDKARI 56

Query: 62  M---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFS 114
                G F  +RP KF + Y  P    L +DG N+ +Y+  L+  +V  L         +
Sbjct: 57  TNLASGTFIFSRPGKFIWTYKKPYEQVLQADGVNLYIYDKDLNQVTVKKLGNALGSSPAA 116

Query: 115 VIFSNNQHVIQESIQRVESNNSF-----ITIFFKDDFMGNMISVTFD-RLSYRLLNWKIM 168
           ++F +N       ++   ++  +     I       F    I +      +  L      
Sbjct: 117 ILFGSNDLEKSFKLRNAGAHGGYEWVEAIPKTKDTPFEKINIGMKNGMPEAMEL-----Y 171

Query: 169 DSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           DS  + S+IK  K+ +N  +    F+    K  ++
Sbjct: 172 DSLGQLSLIKFTKFTKNPPVSASTFKFVTPKGADV 206


>gi|145299387|ref|YP_001142228.1| outer membrane lipoprotein carrier protein LolA [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|189028547|sp|A4SNK8|LOLA_AERS4 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|142852159|gb|ABO90480.1| outer membrane lipoprotein carrier protein LolA [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 202

 Score = 63.0 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 39/204 (19%), Positives = 82/204 (40%), Gaps = 23/204 (11%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---DAGY- 60
           + K ++   +L   S+    +AA  + +             +      F Q      G  
Sbjct: 1   MKKQLLIGSVLLVASSQVWADAASSLKQK---------LADVSLFSAKFAQTVYDSKGKE 51

Query: 61  --VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFS 114
                G+  + RP++F +  +SP    +++DG ++ VY+  ++  +   L+       F 
Sbjct: 52  LQKAGGDLLVQRPNRFNWHTTSPDESLIVADGKDVWVYDPFVEQVTALKLKDAVLNTPFI 111

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +I  N+    +      E N   +T   KD+ + +   VTFDR +  +  + + ++  ++
Sbjct: 112 LIAGNDDKFWKHYDVTQEGNVYTVTSRNKDELIASF-RVTFDRQN-NISRFDVKEAQGQW 169

Query: 175 SIIKILKYKENTVLDPK--VFEIP 196
           S   +  +    VL     VF+IP
Sbjct: 170 SEFTLSSFNRKPVLKGNEFVFKIP 193


>gi|325921213|ref|ZP_08183075.1| Outer membrane lipoprotein-sorting protein LolA [Xanthomonas
           gardneri ATCC 19865]
 gi|325548305|gb|EGD19297.1| Outer membrane lipoprotein-sorting protein LolA [Xanthomonas
           gardneri ATCC 19865]
          Length = 210

 Score = 63.0 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/170 (14%), Positives = 60/170 (35%), Gaps = 18/170 (10%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHF-LSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
                A +  T     ++ ++ F   ++ + G F Q+ +           G   ++ P +
Sbjct: 43  AVLATALFASTAFAGARQELDTFTRGLKGLDGQFSQQVSDANGRVKESSSGRVALSAPRQ 102

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVI-----FSNNQHVI 124
           F ++Y+ P    +++DG  + V++  L+  +V              +           V 
Sbjct: 103 FRWEYAKPYKQLIVADGKKVWVFDPDLEQVTVRAQGNEEQNSPLVALIDPARLDKQYDVS 162

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +E+  R       +T     +    M S+ F +     +   ++D+  + 
Sbjct: 163 EEAAPRDGLQWLSLTPKVDTEASFQMASLGFGKEGLAKME--VVDAVGQR 210


>gi|33602884|ref|NP_890444.1| outer-membrane lipoprotein carrier protein [Bordetella
           bronchiseptica RB50]
 gi|47117181|sp|Q7WCM5|LOLA_BORBR RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|33577326|emb|CAE35883.1| putative exported protein [Bordetella bronchiseptica RB50]
          Length = 210

 Score = 63.0 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/170 (13%), Positives = 57/170 (33%), Gaps = 19/170 (11%)

Query: 37  KKAIEHFLSIQTMQGTFLQE---DAGYVM---KGEFFMARPSKFYFKYSSPSSVSLISDG 90
           ++      +++   G+F Q      G       G F   RP KF +    P    ++SDG
Sbjct: 31  EQLDTFVATVKGATGSFKQSTVSPQGATQPAQSGTFAFQRPGKFKWAVQLPYEQLIVSDG 90

Query: 91  SNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDF 146
             +  Y+  L   +V  +         +++F   Q     ++  +   +     + +   
Sbjct: 91  KQVFQYDPDLAQVTVRQVDQAIGTSPAAILFGAGQLGQAFAVSALPDRDGL--QWLRAKP 148

Query: 147 MGNMISVTFDRLSYRLL-----NWKIMDSSRRYSIIKILKYKENTVLDPK 191
                   F ++   L        +++D+  + + +++       V   +
Sbjct: 149 RNADAG--FSQVDIGLRDNQPARIELVDAFGQTTRVELSNLLPGAVPASE 196


>gi|170726828|ref|YP_001760854.1| outer membrane lipoprotein carrier protein LolA [Shewanella woodyi
           ATCC 51908]
 gi|229485841|sp|B1KG52|LOLA_SHEWM RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|169812175|gb|ACA86759.1| outer membrane lipoprotein carrier protein LolA [Shewanella woodyi
           ATCC 51908]
          Length = 208

 Score = 63.0 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 38/209 (18%), Positives = 74/209 (35%), Gaps = 24/209 (11%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFM 68
           L       P    +    D+S          I T++  F Q              G F +
Sbjct: 5   LTALMLSLPLLTPHMAFADESSV-LKAKLTEIATLKAKFEQTVTDINNKQIQKGSGIFAL 63

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVI 124
           A P++FY+  ++P    +++DG+++ +YN   +  SV  L         +++   ++   
Sbjct: 64  AYPNQFYWHLTAPDESLIVADGTDVWIYNPFAEEVSVMDLNQAISASPIALLVHRDEETW 123

Query: 125 QESIQRVESNNSFITIFFKD-DFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
            +    V S+N    I  K  D     + V FD  +  L    + D     S   + +  
Sbjct: 124 SQ--YSVTSDNGCFNIKPKSIDAGVESVKVCFDDKT--LTEMVLQDQQGNVSQFTLSEQT 179

Query: 184 ENTVLDPKVFE--------IPYDKIHNIN 204
                +  +F+        I   +++ IN
Sbjct: 180 AIDDAERAMFKFTVPDDVDIDDQRLNAIN 208


>gi|33597978|ref|NP_885621.1| outer-membrane lipoprotein carrier protein [Bordetella
           parapertussis 12822]
 gi|47117180|sp|Q7W543|LOLA_BORPA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|33574407|emb|CAE38745.1| putative exported protein [Bordetella parapertussis]
          Length = 210

 Score = 63.0 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/170 (13%), Positives = 57/170 (33%), Gaps = 19/170 (11%)

Query: 37  KKAIEHFLSIQTMQGTFLQE---DAGYVM---KGEFFMARPSKFYFKYSSPSSVSLISDG 90
           ++      +++   G+F Q      G       G F   RP KF +    P    ++SDG
Sbjct: 31  EQLDTFVATVKGATGSFKQSTVSPQGATQPTQSGTFAFQRPGKFKWAVQLPYEQLIVSDG 90

Query: 91  SNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDF 146
             +  Y+  L   +V  +         +++F   Q     ++  +   +     + +   
Sbjct: 91  KQVFQYDPDLAQVTVRQVDQAIGTSPAAILFGAGQLGQAFAVSALPDRDGL--QWLRAKP 148

Query: 147 MGNMISVTFDRLSYRLL-----NWKIMDSSRRYSIIKILKYKENTVLDPK 191
                   F ++   L        +++D+  + + +++       V   +
Sbjct: 149 RNADAG--FSQVDIGLRDNQPARIELVDAFGQTTRVELSNLLPGAVPASE 196


>gi|293603788|ref|ZP_06686204.1| outer membrane lipoprotein carrier protein LolA [Achromobacter
           piechaudii ATCC 43553]
 gi|292817786|gb|EFF76851.1| outer membrane lipoprotein carrier protein LolA [Achromobacter
           piechaudii ATCC 43553]
          Length = 208

 Score = 63.0 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 33/205 (16%), Positives = 72/205 (35%), Gaps = 21/205 (10%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVM---KGEF 66
           + +    ++ P  +     ++Q          ++ +  G+F Q    + G       G F
Sbjct: 8   LAVVAALSLAPALSFAASAQEQL----KSFVTTVTSATGSFSQYTVNNQGRTQPAQTGVF 63

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQH 122
              RP KF +    P    ++SDG  +  ++  L   +       +     +++F +   
Sbjct: 64  SFQRPGKFKWAVQKPYEQLVVSDGRVLFQFDPDLAQVTERKVDAAIGTSPAAILFGSGSL 123

Query: 123 VIQESIQRVESNNSFITIFFK---DDFMGNMISV-TFDRLSYRLLNWKIMDSSRRYSIIK 178
                +  + S +    +  K    D   + + +   D L  R+    ++DS  + + + 
Sbjct: 124 EQSFDVSALPSKDGVDWLRAKPRTADAGFSRVDIGMKDNLPVRVE---LLDSFGQTTRVD 180

Query: 179 ILKYKENTVLDPKVFEIPYDKIHNI 203
           +     N  L  K FE    K  +I
Sbjct: 181 LSAIAANPSLPAKEFEFTAPKGVDI 205


>gi|325294971|ref|YP_004281485.1| outer membrane lipoprotein carrier protein LolA [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065419|gb|ADY73426.1| outer membrane lipoprotein carrier protein LolA [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 206

 Score = 63.0 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 45/209 (21%), Positives = 89/209 (42%), Gaps = 33/209 (15%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-------EDAG 59
           K ++  ++L F+          P   D  +   +E   SI+T++  F Q        D  
Sbjct: 2   KKILSSLVLTFFFVA-------PAYGDGKLDSFLEKLKSIKTLKIVFSQETKLPVAGDTV 54

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDG---SNIAVYNA-----KLDT-WSVYPLRY 110
            +  G  +  +PSKF ++Y+  S + L+S+G     +   +      +LDT   ++PL  
Sbjct: 55  DLYGGVIYYEKPSKFRWEYTKGSDIYLVSNGEYLETVFPSDNQCQITELDTKSELFPLFQ 114

Query: 111 MAFSVIFSNNQHVIQ-ESIQRVESNNSFITIFFKDDFMGN---MISVTFDRLSYRLLNWK 166
                I +N ++  +   I ++E + +F T+  K  +  +    I +  D     L  +K
Sbjct: 115 -----ILNNPENFKKLFKIVKIEESRNFETVELKPTYENSIFEKIILLID-KDCNLKAFK 168

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEI 195
            +   + ++   I  +KEN  L   +F+I
Sbjct: 169 TVQIDKTFATYVIKSWKENVKLSENLFKI 197


>gi|149377436|ref|ZP_01895179.1| outer membrane lipoprotein carrier protein LolA [Marinobacter
           algicola DG893]
 gi|149358277|gb|EDM46756.1| outer membrane lipoprotein carrier protein LolA [Marinobacter
           algicola DG893]
          Length = 218

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 69/171 (40%), Gaps = 16/171 (9%)

Query: 47  QTMQGTFLQ---EDAGYV---MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL 100
           ++ Q  F+Q    + G      +G     RP  FY++   P S  ++S+G  + VY+  L
Sbjct: 45  ESFQSDFIQIVVNENGNRVQESRGSLKAKRPGLFYWETREPHSQFVVSNGDTVEVYDPDL 104

Query: 101 DTWSVYPLR---YMAFSVIFSNNQHVIQESIQRVESNNSFITIFF-----KDDFMGNMIS 152
           +  +++ L        +++ S     + E+ +    +    T  F      +D +   + 
Sbjct: 105 EQVTIHNLDERVQTTPALLLSGEVDNLNETYRVSSRSPGENTREFTLEPRSEDSLFVSLR 164

Query: 153 VTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           +TF      L   ++ DS  + S++     + N  ++   F + Y    ++
Sbjct: 165 LTFYNG--ELQEMRMRDSLAQLSVLSFEDIRLNAPVEDNAFTLNYPDSVDV 213


>gi|311104408|ref|YP_003977261.1| outer membrane lipocarrier protein LolA [Achromobacter xylosoxidans
           A8]
 gi|310759097|gb|ADP14546.1| outer membrane lipocarrier protein LolA [Achromobacter xylosoxidans
           A8]
          Length = 207

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 62/172 (36%), Gaps = 17/172 (9%)

Query: 37  KKAIEHFLSIQTMQGTFLQ---EDAGYVM---KGEFFMARPSKFYFKYSSPSSVSLISDG 90
           ++      ++ +  G+F Q    + G       G F   RP KF +    P    ++SDG
Sbjct: 27  EQLRAFVATVTSATGSFSQYTVNNQGRTQPAQTGVFSFQRPGKFKWAVQKPYEQLVVSDG 86

Query: 91  SNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFK--- 143
             +  ++  L   +       +     +++F +        +  + S +    +  K   
Sbjct: 87  RQVFQFDPDLAQVTERKVDAAIGTSPAAILFGSGSLEQSFDVSALPSEDGIDWLRAKPRT 146

Query: 144 DDFMGNMISV-TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
            D   + + +   D L  R+    ++DS  + + + +     N  L  K F+
Sbjct: 147 ADAGFSRVDIGMKDNLPVRVE---LLDSFGQTTRVDLSGIAANPQLPAKEFQ 195


>gi|330446444|ref|ZP_08310096.1| outer membrane lipocarrier protein LolA [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328490635|dbj|GAA04593.1| outer membrane lipocarrier protein LolA [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 205

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 29/187 (15%), Positives = 70/187 (37%), Gaps = 18/187 (9%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVM---KGEFFMARPS 72
           +      A    T +Q++         +      F Q      G  +    G+  + RP+
Sbjct: 12  AVPMLATANAWATPEQAL---SSRLDKVNAFSANFTQKVISPEGETLVDGTGDLSIKRPN 68

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNN-QHVIQES 127
            F +   +P    L+SDG  +  Y+  ++  +   L+       F ++  N+ +   + +
Sbjct: 69  LFRWDTKTPDESLLVSDGKTVWYYSPFVEQVTAMWLKDATEQTPFVLLTRNSPKDWARYN 128

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
           +Q++ ++   +T   K   M   I         ++ N+ +++S  + S   + K+     
Sbjct: 129 VQQL-ADTFTLTPKEKTSSMDKFIVTV--AKDGQVRNFSVIESDGQRSNYTLSKFTRT-T 184

Query: 188 LDPKVFE 194
               +F+
Sbjct: 185 PAASLFK 191


>gi|254282786|ref|ZP_04957754.1| outer membrane lipoprotein carrier protein LolA [gamma
           proteobacterium NOR51-B]
 gi|219678989|gb|EED35338.1| outer membrane lipoprotein carrier protein LolA [gamma
           proteobacterium NOR51-B]
          Length = 206

 Score = 61.9 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 29/163 (17%), Positives = 64/163 (39%), Gaps = 12/163 (7%)

Query: 41  EHFLSIQTMQGTFLQ--EDAGYVM----KGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
           +  L  + +QG+F Q   DA  V     +G F +  P  F ++ ++P S  +ISDG ++ 
Sbjct: 30  DRLLPSEGLQGSFQQQLVDADGVSLGSSEGRFAILTPHFFRWEITAPGSQLIISDGQDLW 89

Query: 95  VYNAKLDTWSVYPLR---YMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMI 151
             +  L+T +  PL         ++  +   + +  +     +N  +T           +
Sbjct: 90  QLDRDLETATRRPLDPEMLSPMQLLTRSRAQLSEHYVLEASLDNLVLTPKADFSAPFRRL 149

Query: 152 SVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
            + F+      +   ++DS  +   + +       + D  +F 
Sbjct: 150 RIHFEGDVPSSIE--VLDSLEQTISVDLT-PDVGELPDATLFV 189


>gi|58220685|gb|AAW67950.1| putative outer membrane lipoprotein carrier protein [Desulfovibrio
           gigas]
          Length = 224

 Score = 61.9 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 29/207 (14%), Positives = 59/207 (28%), Gaps = 15/207 (7%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ----- 55
           M  LL   V+   I           A+ P T    +    + + S+QT +  F Q     
Sbjct: 1   MQKLLIACVLVAGIALTMGFSMQSAASSPETN-ALLDAIQKQYESMQTFRAHFSQVLINS 59

Query: 56  -EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL-----R 109
                    G   M +P    ++   P    L++    +  Y     T   Y        
Sbjct: 60  ASREAERRTGRVSMKKPGLIRWETLEPEKELLVAAKDVVWDYFEAEKTAYKYKASEILDS 119

Query: 110 YMAFSVIFSNNQHVIQESIQRVESNNSFITIFF-KDDFMGNMI--SVTFDRLSYRLLNWK 166
                 +    +      +      +S   +     +    ++  S+  D  +  +    
Sbjct: 120 KTMLHFLAGTTRLDKDFEVVNAGREDSLTRLDLTPREPEPGLVQASIWADPATGLIQRIS 179

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVF 193
           ++D     +++       N  LD  +F
Sbjct: 180 MIDFYGNENVVAFTDMSLNPPLDEGLF 206


>gi|167041405|gb|ABZ06157.1| putative Outer membrane lipoprotein carrier protein LolA
           [uncultured marine microorganism HF4000_006O13]
          Length = 212

 Score = 61.9 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 33/205 (16%), Positives = 74/205 (36%), Gaps = 11/205 (5%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMK 63
           + V    F + I      +    ++S     ++   + ++Q  F Q       D     +
Sbjct: 4   LKVCASIFATLISLLAFDFTYASEESSFNVNDYLNEMLSLQANFKQTIFSPTNDVIDYSE 63

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSN 119
           G F + +P K  + ++ PS   +      I+ Y+A L+   + P          +++ +N
Sbjct: 64  GSFLLKKPGKIMWHFTVPSIKKITVQEQKISTYDANLNQVVIVPFSDRYQSSLANILLNN 123

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMGNMIS-VTFDRLSYRLLNWKIMDSSRRYSIIK 178
           +  +    I    +N +  ++        N+ + +    +   L   K+ D+S +   I 
Sbjct: 124 DSLMSYYQIHSETTNKNAYSVILVQKNSNNLFTRIKITIVEMLLTEIKLWDASGQSIGIS 183

Query: 179 ILKYKENTVLDPKVFEIPYDKIHNI 203
                 N  L    FE  + K  ++
Sbjct: 184 FDDVIINAPLADAFFEFSFPKGADV 208


>gi|91789642|ref|YP_550594.1| outer membrane lipoprotein carrier protein LolA [Polaromonas sp.
           JS666]
 gi|91698867|gb|ABE45696.1| outer membrane lipoprotein carrier protein LolA [Polaromonas sp.
           JS666]
          Length = 238

 Score = 61.9 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 33/215 (15%), Positives = 71/215 (33%), Gaps = 22/215 (10%)

Query: 11  GVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ----------EDAGY 60
             V L    A+    A+   T    +        + ++ + +F Q               
Sbjct: 21  ASVTLATLVAMISMAASAQTTGVTGLDSLENFIKTTKSGRASFTQVVTSPAKEGQTAKTK 80

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MA--FS 114
              G F   RP++F F Y  P   S+++DG  + +++  L+  +   L            
Sbjct: 81  TSSGSFEFLRPNRFKFIYKKPFEQSIVADGQTLWLHDVDLNQVTSRKLAQVLNGTPAAVV 140

Query: 115 VIFSNNQHVIQE-SIQRVESNNSFITIFFKDDFMGNM---ISVTF--DRLSYRLLNWKIM 168
              ++ + +  +  +  +        +             I V F        L   +I+
Sbjct: 141 AAAADLKGLEADFRLTPLPDKGGLQWVQAVPKTREGQLQSIQVGFRSTDKGSELAALEIL 200

Query: 169 DSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           DS  + S++   +++ N VL P  F+       ++
Sbjct: 201 DSFGQKSVMTFSQFEINPVLSPASFQFKPPSGADV 235


>gi|89901946|ref|YP_524417.1| outer membrane lipoprotein carrier protein LolA [Rhodoferax
           ferrireducens T118]
 gi|123091162|sp|Q21TL7|LOLA_RHOFD RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|89346683|gb|ABD70886.1| outer membrane lipoprotein carrier protein LolA [Rhodoferax
           ferrireducens T118]
          Length = 213

 Score = 61.9 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 28/188 (14%), Positives = 65/188 (34%), Gaps = 34/188 (18%)

Query: 44  LSIQTMQGTFLQE----------DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
            ++ T +  F Q                  G F  +RP++F F Y  P   ++++DG  +
Sbjct: 29  KTVNTGRADFTQVVTAPAKAGQAPRVKTSSGTFEFSRPNRFKFVYKKPFEQNIVADGQTL 88

Query: 94  AVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKD----- 144
            +Y+  L+  +       L     ++I           ++ ++++ +      KD     
Sbjct: 89  WLYDVDLNQVTARQQSKVLGSTPAALI------AAAPDLRALQADFTLADAPDKDGLQWA 142

Query: 145 ----DFMGNMISVT---F--DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
                     +      F     +  L   +I+DS  + S++   +++ N  L    F+ 
Sbjct: 143 AATPKSKDGQLQSVRVGFRAGEQAAELAALEILDSFGQRSVLSFSRFEVNPALPGNSFQF 202

Query: 196 PYDKIHNI 203
                 ++
Sbjct: 203 KPPAGADV 210


>gi|302035919|ref|YP_003796241.1| putative outer membrane lipoprotein carrier protein LolA
           [Candidatus Nitrospira defluvii]
 gi|300603983|emb|CBK40315.1| putative Outer membrane lipoprotein carrier protein LolA
           [Candidatus Nitrospira defluvii]
          Length = 240

 Score = 61.9 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 28/222 (12%), Positives = 70/222 (31%), Gaps = 31/222 (13%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITK-------DQSVKKAIEHFLSIQTMQGTF 53
           M   L  +V+  ++    +   P     P           + VK     +   + +Q +F
Sbjct: 2   MRIFLLVAVL--LMSGIPAVAQPVKPDEPAVDLQILKEVQEVVKNIQARYEKTKDLQASF 59

Query: 54  LQEDAGY------VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP 107
            Q+          +  G F++ +P +  + Y  P++  +  +  ++ +Y  +     V  
Sbjct: 60  TQKTRIEGFSTPVISTGHFYIKKPGRLRWDYIEPATEEIYVNKDDVKMYVPEHKQVLVGK 119

Query: 108 L-----RYMAFSVI-----FSNNQHVIQESIQ-RVESNNSFITIFFKDDFMG-----NMI 151
           L           ++           +   + + R       +++  K            I
Sbjct: 120 LTYMAASQAPLQLLQGVAKLDEEFDIEPTAAKDRGAGGILLVSLTPKQGRAEPERAIQKI 179

Query: 152 SVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
            +     +Y L    + + S   +  +  + K N+ L   +F
Sbjct: 180 VIEVQPKTYFLKTIALHEVSGNIATFEFSELKPNSGLKDDLF 221


>gi|226226596|ref|YP_002760702.1| outer-membrane lipoprotein carrier protein precursor [Gemmatimonas
           aurantiaca T-27]
 gi|226089787|dbj|BAH38232.1| outer-membrane lipoprotein carrier protein precursor [Gemmatimonas
           aurantiaca T-27]
          Length = 230

 Score = 61.5 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 36/220 (16%), Positives = 68/220 (30%), Gaps = 22/220 (10%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY 60
           M      SV+  V     +A+   +     T D S ++  + +    T++  F Q+    
Sbjct: 4   MTMTSRPSVVMAVTAACVAALMTTSVGAQGTADASYERVAKAWAGTHTLRADFEQKITNP 63

Query: 61  V------MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS 114
           +       KG F   RP K    ++ P+   ++ DG  + VY        V  L   A  
Sbjct: 64  LLARTVNSKGVFLQERPGKLSITFTQPAGDRIVGDGKWLWVYLPSSAPGQVLKLPADADG 123

Query: 115 VIFSNNQHVIQE------SIQRVESNN---------SFITIFFKDDFMGNMISVTFDRLS 159
            I ++    + +      +I   ES+            I            +    ++  
Sbjct: 124 AIVADLLSQLLDTPKKAFTISGGESSPVDGRAARRVQLIPKAAGTAPFQKAVLWLDEKDP 183

Query: 160 YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
             L   +++D       I +  +     L    F     K
Sbjct: 184 RPLRV-QVVDGQGVDRTITLTTWSPEATLPADAFRFNVPK 222


>gi|325578147|ref|ZP_08148282.1| outer membrane lipoprotein carrier protein LolA [Haemophilus
           parainfluenzae ATCC 33392]
 gi|301156049|emb|CBW15520.1| chaperone for lipoproteins [Haemophilus parainfluenzae T3T1]
 gi|325159883|gb|EGC72012.1| outer membrane lipoprotein carrier protein LolA [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 208

 Score = 61.5 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 33/193 (17%), Positives = 62/193 (32%), Gaps = 19/193 (9%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE--DAG----YVMKGEFFM 68
           L   +A+    +A       +  +       +  +   F Q    AG        G+  +
Sbjct: 5   LLKMTALTALLSASNFAFADAADELQNRLNQVTVLSADFSQTVTSAGGKNVQQGSGKLQI 64

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL----DTWSVYPLRYMAFSVIFSNNQHVI 124
            RP+ F     SP    +I+DG  +  Y+  +      W    +    F ++ SN     
Sbjct: 65  KRPNLFRMDTKSPQETQIIADGKTLWYYDPFVQQVTAQWVKDAVNNTPFVLLTSN--DKS 122

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFD---RLSYRLLNWKIMDSSRRYSIIKILK 181
             +   V  N    T   K     + I   FD     +  L N+   +   + ++  +  
Sbjct: 123 HWNQYSVTQNVD--TFVLKPKAKNSNIK-QFDIRVDANGVLKNFSTTEKDGQTNLYVLRN 179

Query: 182 YKENTVLDPKVFE 194
              N  L   +F+
Sbjct: 180 I-TNQTLADSLFQ 191


>gi|329910975|ref|ZP_08275422.1| Outer membrane lipoprotein carrier protein LolA [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327546034|gb|EGF31111.1| Outer membrane lipoprotein carrier protein LolA [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 222

 Score = 60.3 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/223 (15%), Positives = 69/223 (30%), Gaps = 38/223 (17%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ--------EDAG-- 59
              ++L       P      +    ++ +        Q+ +G F Q           G  
Sbjct: 8   FSRLVLIAGMFAAPL-----VLHAAALDQFKSFVAGTQSAKGEFSQRLVRSESAAKPGAT 62

Query: 60  --------YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY- 110
                       G F  ARP KF + Y  P    L +DG  + +Y+  L+  +   L   
Sbjct: 63  ATPAVKVSTPSTGTFLFARPGKFIWTYLKPYEQVLQADGDKLFIYDKDLNQVTSRKLGNA 122

Query: 111 ---MAFSVI-----FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFD-RLSYR 161
                 +++        N  + +   +        I       F    I +     ++  
Sbjct: 123 IGSSPAAILFGSNDLEKNFTLKEAGTREGVEWLDAIPKSKDTTFEHIGIGLRDGVPVAME 182

Query: 162 LLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
           L      D+  + S++   +++ N VL    F+    K  ++N
Sbjct: 183 LR-----DTFGQTSVLTFTRFERNPVLAADQFKFVIPKGADVN 220


>gi|242239685|ref|YP_002987866.1| outer-membrane lipoprotein carrier protein [Dickeya dadantii
           Ech703]
 gi|242131742|gb|ACS86044.1| outer membrane lipoprotein carrier protein LolA [Dickeya dadantii
           Ech703]
          Length = 204

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/164 (18%), Positives = 61/164 (37%), Gaps = 15/164 (9%)

Query: 41  EHFLSIQTMQGTFLQ----EDAGYVMKGE--FFMARPSKFYFKYSSPSSVSLISDGSNIA 94
                + +    F Q     D G V +G+   ++ RP+ F +K ++P    L+SDG  + 
Sbjct: 30  SRLSKVNSFHAGFTQKVSGSDGGTVQEGQGELWVKRPNLFNWKTTAPDESLLVSDGKTLW 89

Query: 95  VYNA----KLDTWSVYPLRYMAFSVIFSNN-QHVIQESIQRVESNNSFITIFFKDDFMGN 149
            YN        TW         F +I  N+ +   + ++ R   +   +      +    
Sbjct: 90  FYNPFVEQATATWVKDATGNTPFILITRNDPKDWSKYNVTRNGDDFQLVPRAASGNLKQF 149

Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
            ISVT       +  +   +   + S+  +   ++N  +D   F
Sbjct: 150 AISVT---GDGTIKGFTATEQDGQRSVYTLKN-QQNGDVDSAKF 189


>gi|327314294|ref|YP_004329731.1| outer membrane lipoprotein carrier protein LolA [Prevotella
           denticola F0289]
 gi|326946379|gb|AEA22264.1| outer membrane lipoprotein carrier protein LolA [Prevotella
           denticola F0289]
          Length = 208

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/203 (12%), Positives = 79/203 (38%), Gaps = 18/203 (8%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGE 65
           +++L  +       +A    + +  ++       ++TMQ  F+Q       +   V  G 
Sbjct: 6   LLVLMAFCIATASVSAQSAGEARIRQQIEAAAAGMRTMQCDFVQTKYLRMLNDRMVSHGR 65

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAV-----YNA-KLDTWSVYP-LRYMAFSVIFS 118
            +  +  K  ++Y+SP S + + +G  + +      +   ++    +  +  +  + +  
Sbjct: 66  MYYQQRDKLRWEYTSPYSYAFVLNGPRVLISKGSRNDVINVNQSKFFKEIARIMMNSVVG 125

Query: 119 NNQHVIQE-SIQRVESNNSFITIFFK----DDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
              +  ++  +    S   ++ + +        M   I + F R    +   ++++    
Sbjct: 126 KALNDRRDFKVTLSSSAAEYVAVLYPQQKQMQQMFQKIVLHFSRQHAMVAKVELVEKRGD 185

Query: 174 YSIIKILKYKENTVLDPKVFEIP 196
            ++I++   K N+ ++ KVF + 
Sbjct: 186 RTVIEMKNVKVNSPVNAKVFSVN 208


>gi|315633926|ref|ZP_07889215.1| outer membrane lipoprotein carrier protein LolA [Aggregatibacter
           segnis ATCC 33393]
 gi|315477176|gb|EFU67919.1| outer membrane lipoprotein carrier protein LolA [Aggregatibacter
           segnis ATCC 33393]
          Length = 223

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/182 (17%), Positives = 62/182 (34%), Gaps = 19/182 (10%)

Query: 26  AAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---DAGYVMK---GEFFMARPSKFYFKYS 79
           A   +    +  +       + T+   F Q      G  ++   G+  + RP+ F     
Sbjct: 33  AMATLAWANADIELQNRLNKVDTLSADFAQTVSSANGKNVQQGNGKLQIKRPNLFRMDTK 92

Query: 80  SPSSVSLISDGSNIAVYNAKLDT----WSVYPLRYMAFSVIFSNNQHVIQESIQRVESNN 135
           SP    +I+DG  +  Y+  ++     W    +    F ++ SN       +   VE  +
Sbjct: 93  SPQETQIIADGQTLWFYDPFVEQVTANWVKEAVNNTPFVLLTSN--DKSHWAQYSVEQKD 150

Query: 136 SFITIFFKDDFMGNMISVTFD---RLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
              T   K     + I   FD     +  L  +  ++   + +   +     N  LD  +
Sbjct: 151 D--TFVLKPKAKNSNIK-QFDIRIDQNGVLKGFSTIEKDGQSNQYILRNI-TNQHLDGGL 206

Query: 193 FE 194
           F+
Sbjct: 207 FK 208


>gi|317402129|gb|EFV82721.1| outer-membrane lipoprotein carrier protein [Achromobacter
           xylosoxidans C54]
          Length = 211

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 57/172 (33%), Gaps = 17/172 (9%)

Query: 37  KKAIEHFLSIQTMQGTF------LQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           ++      ++    GTF       Q        G F   RP KF +    P    +ISDG
Sbjct: 31  EQLRAFVSTVTAATGTFSQYTVSTQGRTQPAQTGVFSFQRPGKFKWAVQKPYDQLVISDG 90

Query: 91  SNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFK--- 143
             +  ++  L   +       +     +++F +        +  + S +    +  K   
Sbjct: 91  KQVFQFDPDLAQVTERKVDAAIGTSPAAILFGSGSLEQSFDVSALPSKDGVDWLRAKPRT 150

Query: 144 DDFMGNMISV-TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
            D   + + +   D L  R+    ++DS  + + + +     N  L    F 
Sbjct: 151 ADAGFSRVDIGMKDNLPVRVE---LLDSFGQTTRVDLSGIVPNPKLGEGEFR 199


>gi|212635391|ref|YP_002311916.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           piezotolerans WP3]
 gi|226737656|sp|B8CP85|LOLA_SHEPW RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|212556875|gb|ACJ29329.1| Outer membrane lipoprotein carrier protein LolA [Shewanella
           piezotolerans WP3]
          Length = 208

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/193 (13%), Positives = 71/193 (36%), Gaps = 21/193 (10%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSPSS 83
             +  + ++       I  ++  F Q             +G F +A+P++FY+  ++P  
Sbjct: 19  SAQADASEQLKVKLAEIDNLKANFSQTVTDINDKVIQTGEGVFALAQPNQFYWHLTAPDE 78

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFIT 139
             +++DG+++ +YN   +  SV  +         +++  ++     +           I+
Sbjct: 79  SLIVADGTDVWIYNPFNEEVSVMDVNQAISASPIALLVHDDAKTWAQYQVTNTDQCFAIS 138

Query: 140 IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE----- 194
              KD  + + + V F+  +  L    + D     S   + +       +  +F+     
Sbjct: 139 PIDKDAGV-SEVEVCFNETT--LTEMVLKDQQGNTSSFLLSEQTTLDKSEKNLFKFVVPE 195

Query: 195 ---IPYDKIHNIN 204
              I   ++ + N
Sbjct: 196 DVDIDDQRLKSPN 208


>gi|153002969|ref|YP_001377294.1| outer membrane lipoprotein carrier protein LolA [Anaeromyxobacter
           sp. Fw109-5]
 gi|152026542|gb|ABS24310.1| outer membrane lipoprotein carrier protein LolA [Anaeromyxobacter
           sp. Fw109-5]
          Length = 207

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/179 (15%), Positives = 60/179 (33%), Gaps = 11/179 (6%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYFKYSSPSSV 84
              Q  +K    +   + ++  F Q           V  G   + +P    + Y +P+  
Sbjct: 18  DAGQLARKVQTFYERTRDLEARFQQTYTYSGFGRRQVSAGTLKVKKPGMMRWDYETPAPK 77

Query: 85  SLISDGSNIAVYNAKLDTWSV-YPLRYMAFSV---IFSNNQHVIQESIQRVESNNSFITI 140
           ++   GS +  +  + +   V       A S           + +E     +   + +  
Sbjct: 78  TVAVKGSRLVQFEPEENQAYVDERFDATAMSAAVTFLLGKGDLAREFGLSTDGTGALVLR 137

Query: 141 FFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
             ++D     I++T       +   +++D +   + I+  K K N  L    FE+   K
Sbjct: 138 PKEEDPRVESIALT-VGPDGEVRATRVVDGAGNVNEIRFEKVKRNAGLPDGAFEVKLPK 195


>gi|254246063|ref|ZP_04939384.1| Outer membrane lipoprotein-sorting protein [Burkholderia
           cenocepacia PC184]
 gi|124870839|gb|EAY62555.1| Outer membrane lipoprotein-sorting protein [Burkholderia
           cenocepacia PC184]
          Length = 145

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 49/142 (34%), Gaps = 11/142 (7%)

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQ 125
           RP KF + Y  P    L +DG  + VY+  L+  +   L         +++F +N  + +
Sbjct: 4   RPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLNGALGASPAAILFGSN-DLDK 62

Query: 126 ESIQRVESNNSFI----TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
               R       I     +    D     I + F   +   +   + D     +++    
Sbjct: 63  NYTLRDAGEKGGIEWLEMLPKAQDTQFQRIGIGFRNGTLAAME--LHDVFGNVTLLTFTN 120

Query: 182 YKENTVLDPKVFEIPYDKIHNI 203
            + N  L    F+    K  ++
Sbjct: 121 IQTNPPLKGDTFKFVVPKGADV 142


>gi|322421213|ref|YP_004200436.1| outer membrane lipoprotein carrier protein LolA [Geobacter sp. M18]
 gi|320127600|gb|ADW15160.1| outer membrane lipoprotein carrier protein LolA [Geobacter sp. M18]
          Length = 236

 Score = 59.2 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 32/233 (13%), Positives = 65/233 (27%), Gaps = 49/233 (21%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED------AGY 60
             + G V +         ++A      Q V+   + + S+  +Q  F Q           
Sbjct: 1   MKLAGTVAMCIALIALSVSSALCAELSQVVRTLEQGYASLNDLQADFSQRSSIRALKREE 60

Query: 61  VMKGEFFMARPS----KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVI 116
              GE F+ +       F F Y  P    ++S+G  +  Y        V  L       +
Sbjct: 61  KGGGELFIKKGGGKDSMFRFDYKKP-KQQIVSNGKTVWYYIPDQKQVMVMDLAQ-----L 114

Query: 117 FSNNQHVIQESIQRVESNNSFITI----FFKDDFMGNMISVT------------------ 154
           F     +    +  +   +   +I      KD      + +                   
Sbjct: 115 FEAGNGIAMNYLAGLGQVSKDFSIAFAAEQKDKSGNYQLELIPHKKSPAMAKLQLTISGD 174

Query: 155 ----FDRL-----SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPK--VFEIP 196
               F         + +++  ++D     + +     K N  +      F+IP
Sbjct: 175 AVESFIAKGRASTPFPVVSSTVIDQVGNATRMDFSDVKTNRGISSGKFTFKIP 227


>gi|119503242|ref|ZP_01625326.1| probable outer membrane lipoprotein carrier [marine gamma
           proteobacterium HTCC2080]
 gi|119460888|gb|EAW41979.1| probable outer membrane lipoprotein carrier [marine gamma
           proteobacterium HTCC2080]
          Length = 205

 Score = 59.2 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 23/114 (20%), Positives = 48/114 (42%), Gaps = 11/114 (9%)

Query: 37  KKAIEHFLSIQTMQGTFLQ---EDAGY---VMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
            KA     +I++++G+F Q     +G       G F + RP  F ++ +SP    L+SDG
Sbjct: 29  AKADGLLGNIESIEGSFTQEIINASGTLTAQSSGVFALLRPHFFKWQITSPGKQLLVSDG 88

Query: 91  SNIAVYNAKLDTWSVYPLR---YMAFSVIFSNNQHVIQESIQRVESNNSFITIF 141
                ++  L T    PL+        ++ ++ + +       V    +++ + 
Sbjct: 89  EFFWQHDEDLATVVRRPLQGQLNSPLGILLADEEVLGGH--YTVTREPTYLQLV 140


>gi|94265788|ref|ZP_01289522.1| Outer membrane lipoprotein carrier protein LolA [delta
           proteobacterium MLMS-1]
 gi|93453680|gb|EAT04064.1| Outer membrane lipoprotein carrier protein LolA [delta
           proteobacterium MLMS-1]
          Length = 218

 Score = 59.2 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 29/197 (14%), Positives = 71/197 (36%), Gaps = 26/197 (13%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFM 68
           +   +A  P   A  +   Q V +A      +++M   F Q+      D   V +G+  +
Sbjct: 23  VTGKAATEPGELAAFL---QEVDRAAA---EVRSMSCAFTQKKELAMFDRPVVFRGKLDL 76

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN--------- 119
            RP +  ++++SP +  LI  G +    +        + L+      + +          
Sbjct: 77  VRPDRLRWEFASPVNSVLIFKGDSGLRCDGNSPPV-RFDLQKDPVMRLVARQLWLWLGGE 135

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMG---NMISVTFDRLSYRLLNWKIMDSSRRYSI 176
           +  + ++    +    +   I  KD  M      +++ FD  + +    +I ++    + 
Sbjct: 136 HDRLAEDYHLSLAGEATLF-IEPKDPGMAEFITSLTIVFDPETLQPRQVEIKEAEGDLTR 194

Query: 177 IKILKYKENTVLDPKVF 193
           +     + +   D  +F
Sbjct: 195 LTFHDCQPDPDPDEALF 211


>gi|254252992|ref|ZP_04946310.1| Outer membrane lipoprotein-sorting protein [Burkholderia dolosa
           AUO158]
 gi|124895601|gb|EAY69481.1| Outer membrane lipoprotein-sorting protein [Burkholderia dolosa
           AUO158]
          Length = 145

 Score = 59.2 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 22/142 (15%), Positives = 49/142 (34%), Gaps = 9/142 (6%)

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVI 124
           +RP KF + Y  P    L +DG  + VY+  L+  +   L         +++F +N    
Sbjct: 3   SRPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLNGALGASPAAILFGSNDLDK 62

Query: 125 QESIQRVESNNSFITIFFKDDFMGN---MISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
             +++          +  +          I + F   +   +   + D     +++    
Sbjct: 63  SYTLRDAGEKGGIEWLEMQPKAQDTQFQRIGIGFRNGTLAAME--LHDVFGNVTLLTFTN 120

Query: 182 YKENTVLDPKVFEIPYDKIHNI 203
            + N  L    F+    K  ++
Sbjct: 121 IQTNPPLKSDTFKFVVPKGADV 142


>gi|118581495|ref|YP_902745.1| outer membrane lipoprotein carrier protein LolA [Pelobacter
           propionicus DSM 2379]
 gi|118504205|gb|ABL00688.1| outer membrane lipoprotein carrier protein LolA [Pelobacter
           propionicus DSM 2379]
          Length = 242

 Score = 59.2 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 34/230 (14%), Positives = 68/230 (29%), Gaps = 46/230 (20%)

Query: 6   YKSVIGVVILFF---YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED----- 57
              +   +   F    ++     A +P T    V    + + ++Q +Q  F Q       
Sbjct: 4   RSRMFSSLFALFLLVMTSYPALAAEHPATLSDVVSALEKGYATLQDVQADFSQRTSVAGM 63

Query: 58  -AGYVMKGEFFMARPSK----FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA 112
                  GE  + RP      F F Y+ P    ++S+G  +  Y    +   V  +  M 
Sbjct: 64  KREQRGNGEMLLKRPGSSTAMFRFNYARP-KQQIVSNGKQVWFYLPDSNQVMVSSMEAMF 122

Query: 113 FSVIFSNNQHVI-QESIQRVESNNSFITIFFKDDFMGN---------------MISVTFD 156
                 N+  +     +  V  + S      + D  GN                +S++  
Sbjct: 123 KG---GNSIALSYLTGMGHVSRDFSISFARERQDKNGNYQLELLPKKPTAVLARLSLSVS 179

Query: 157 RLSYR--LLNW-----------KIMDSSRRYSIIKILKYKENTVLDPKVF 193
             +    L               ++D+    + I   + + N  +    F
Sbjct: 180 GEAVARYLRQGNVRDIFPIVSSVVVDAGGNQTRIDYGRARVNRGISSSKF 229


>gi|90407804|ref|ZP_01215981.1| outer-membrane lipoprotein carrier protein precursor [Psychromonas
           sp. CNPT3]
 gi|90311069|gb|EAS39177.1| outer-membrane lipoprotein carrier protein precursor [Psychromonas
           sp. CNPT3]
          Length = 203

 Score = 59.2 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 37/198 (18%), Positives = 76/198 (38%), Gaps = 19/198 (9%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKK---AIEHFLSIQTMQGTFLQEDAGYVMK 63
           K VI V++ F + +I P +A       + + K      HF  +       +    G V+ 
Sbjct: 2   KKVILVLLSFLFFSITPAHADDSQILQEKLAKLKIINAHFSQV-------VSNADGKVIN 54

Query: 64  ---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVI 116
              G   + RP KF +  ++P    ++S+G  + +Y+  ++  ++  L        F V+
Sbjct: 55  ESIGTLSVLRPGKFIWHVTAPDEQMIVSNGLLMWIYDPFIEQVTILNLDDTITETPF-VL 113

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
            + N     +    V+  + F     +D          F   S  +  + I+D   + S 
Sbjct: 114 LAGNASEQWKYYNVVQKGDQFTLTSNRDTDSERYFIFEFS-KSGEISKFMIVDEQGQRSA 172

Query: 177 IKILKYKENTVLDPKVFE 194
             ++ +     L+  +FE
Sbjct: 173 FTLVPFALKAPLNVSMFE 190


>gi|118594712|ref|ZP_01552059.1| Outer membrane lipoprotein carrier protein LolA [Methylophilales
           bacterium HTCC2181]
 gi|118440490|gb|EAV47117.1| Outer membrane lipoprotein carrier protein LolA [Methylophilales
           bacterium HTCC2181]
          Length = 203

 Score = 59.2 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 30/173 (17%), Positives = 69/173 (39%), Gaps = 19/173 (10%)

Query: 46  IQTMQGTFLQ---EDAGYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +++++G F Q   +  G VM+   G F   +P+ F + Y  P    +ISDG  + +Y+  
Sbjct: 32  MKSVEGNFSQQVIDQRGSVMQEVSGNFLFKKPNLFKWNYIDPIQSQIISDGELLYLYDPD 91

Query: 100 LDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG-----NM 150
           L    +  L+         ++ S++    +  I +       I+I+            + 
Sbjct: 92  LKQVVISSLKKLGGVSPAMLLVSSSA--SEHFIVKSIRATDLISIYEAIPKNPQEASFSK 149

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           + + F++    L    I+D+    + I       N +++   F   + +  ++
Sbjct: 150 VLIHFNQG--LLSQMHIIDNFNHKTKIYFDSIVNNRLINDAAFLFNFPEGVDV 200


>gi|189426246|ref|YP_001953423.1| outer membrane lipoprotein carrier protein LolA [Geobacter lovleyi
           SZ]
 gi|189422505|gb|ACD96903.1| outer membrane lipoprotein carrier protein LolA [Geobacter lovleyi
           SZ]
          Length = 237

 Score = 58.8 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 36/235 (15%), Positives = 79/235 (33%), Gaps = 37/235 (15%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DA 58
           + + +I + +            A   T  Q +    + + S+Q +Q +F Q         
Sbjct: 1   MKQRIITIFLSLALGGTISSAQAAEATLQQVIATLEQGYASLQDLQASFNQSTTLAGFPK 60

Query: 59  GYVMKGEFFMARP----SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-- 112
                GE  + RP    ++F F Y+ P   S+IS+G  +  Y  +     V  L  M   
Sbjct: 61  PQKGHGELALRRPPQGTAQFRFDYAVP-KQSIISNGKQVWFYQPENRQVLVSSLEGMMKG 119

Query: 113 -----FSVI-----FSNNQHVIQESIQRVESNNSFITIFFKDD-FMGNMISVTF------ 155
                 + +      S + +       R +  N  + +  +    + + + +T       
Sbjct: 120 GNSIGMAYLTGLGNVSKDFNAAFAKPSRDKQGNYLLELTPRKPTPVLSRLRLTIHEEAVN 179

Query: 156 -------DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
                   +  + ++   ++D S   + I   + + N+ L    F     +  +I
Sbjct: 180 ALLADGQTKEPFPVVASTVVDGSGTETRISYSRIRTNSGLSAAKFNFKVPQGVDI 234


>gi|258626329|ref|ZP_05721176.1| outer-membrane lipoprotein carrier protein precursor [Vibrio
           mimicus VM603]
 gi|258581381|gb|EEW06283.1| outer-membrane lipoprotein carrier protein precursor [Vibrio
           mimicus VM603]
          Length = 198

 Score = 58.8 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 37/202 (18%), Positives = 75/202 (37%), Gaps = 22/202 (10%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVM---KGEF 66
           + L F S      +A    KD   ++        +    TF Q      G V+    G  
Sbjct: 5   LALLFCSF-----SAIAAPKDTLSER----LAMSEGFSATFNQQVLSPEGKVIITGHGTV 55

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQH 122
            +ARPS F ++  +P    L+SDG+++  ++  ++  ++Y     L    F V+ + N+ 
Sbjct: 56  DIARPSLFRWETQAPDENLLVSDGTSLWHFDPFVEQVTLYRAEEALEQTPF-VLLTRNKA 114

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              ++    E  + F       D       +T       +  +K+++   + S     K 
Sbjct: 115 SDWDAYHVEEKGDVFTLTPTALDSNQGRFQITISDKGV-VQGFKVIEQDGQQSEFTFSKV 173

Query: 183 KENTVLDPKVFEIPYDKIHNIN 204
           K+    +  +F     K   ++
Sbjct: 174 KQ-QKPNASLFNYKVPKGVEVD 194


>gi|161510974|ref|YP_088644.2| outer-membrane lipoprotein carrier protein [Mannheimia
           succiniciproducens MBEL55E]
          Length = 208

 Score = 58.8 bits (141), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 73/207 (35%), Gaps = 21/207 (10%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLS-----IQTMQGTFLQEDAGYV 61
           K +   +   F  A+     A    + Q     + +F +     + +  G  +Q  +   
Sbjct: 2   KKIALKMTALFALALSSTAWADAAGELQQRLAQVNYFSADFNQNVSSANGKNVQTGS--- 58

Query: 62  MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT----WSVYPLRYMAFSVIF 117
             G+  + RP+ F     +P    +ISDG  +  Y+  ++     W    +    F V+ 
Sbjct: 59  --GKLQIKRPNLFRMDNKAPQETQIISDGKTLWFYDPFVEQVTANWVENAVNNTPF-VLL 115

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYR--LLNWKIMDSSRRYS 175
           ++N          V++ ++F+    K     + I     R+  +  L  +  ++   + +
Sbjct: 116 TSNDSANWNQYTVVQNGDTFV---LKPKAKNSNIKQFDIRIDNQGVLKGFSTIEKDGQTN 172

Query: 176 IIKILKYKENTVLDPKVFEIPYDKIHN 202
           +  +     N  L   +F+    K   
Sbjct: 173 LYILRNI-TNQPLADSLFKFTVPKGAE 198


>gi|146328695|ref|YP_001209396.1| LolA family outer membrane lipoprotein carrier protein
           [Dichelobacter nodosus VCS1703A]
 gi|146232165|gb|ABQ13143.1| LolA family outer membrane lipoprotein carrier protein
           [Dichelobacter nodosus VCS1703A]
          Length = 230

 Score = 58.8 bits (141), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 44/104 (42%), Gaps = 8/104 (7%)

Query: 10  IGVVILFFYSAIF---PFNAAYPITKDQSVKK-AIEHFLSIQTMQGTFLQ--EDAGY--V 61
           +G+++ F   A           P  K ++  +    +    + +  +F Q   + G    
Sbjct: 8   MGLLLTFTAQAQLFQTAEQTQSPAPKAETRARDLASYLDETRDLHASFTQLVANKGRYNQ 67

Query: 62  MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV 105
             GE ++A+  KF++ Y  P    +IS+G  +  Y+  L+  SV
Sbjct: 68  SSGEMWLAKSGKFFWDYQYPERQKIISNGKIVYQYDIDLEQISV 111


>gi|258621725|ref|ZP_05716756.1| outer-membrane lipoprotein carrier protein precursor [Vibrio
           mimicus VM573]
 gi|258585956|gb|EEW10674.1| outer-membrane lipoprotein carrier protein precursor [Vibrio
           mimicus VM573]
          Length = 198

 Score = 58.4 bits (140), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 37/202 (18%), Positives = 75/202 (37%), Gaps = 22/202 (10%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVM---KGEF 66
           + L F S      +A    KD   ++        +    TF Q      G V+    G+ 
Sbjct: 5   LALLFCSF-----SAIAAPKDTLSER----LAMSEGFSATFNQQVLSPEGKVILTGNGKV 55

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQH 122
            +ARPS F ++  +P    L+SDG+ +  ++  ++  ++Y     L    F V+ + N+ 
Sbjct: 56  DIARPSLFRWETETPDENLLVSDGTTLWHFDPFVEQVTLYRAEEALEQTPF-VLLTRNKA 114

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              ++    E  + F       D       +T       +  +K+++   + S     K 
Sbjct: 115 SDWDAYHVEEKGDVFTLTPTALDSNQGRFQITISDKGV-VQGFKVIEQDGQQSEFTFSKV 173

Query: 183 KENTVLDPKVFEIPYDKIHNIN 204
           K+    +  +F     K   ++
Sbjct: 174 KQ-QKPNASLFNYKVPKGVEVD 194


>gi|325858495|ref|ZP_08172599.1| outer membrane lipoprotein carrier protein LolA [Prevotella
           denticola CRIS 18C-A]
 gi|325482992|gb|EGC85981.1| outer membrane lipoprotein carrier protein LolA [Prevotella
           denticola CRIS 18C-A]
          Length = 208

 Score = 58.4 bits (140), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 84/210 (40%), Gaps = 20/210 (9%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DA 58
           + K ++ V++ FF +      +A    + +  ++       ++TMQ  F+Q       + 
Sbjct: 1   MMKRLLLVLMAFFIA--TASVSAQSAGEARIRQQIEAAAAGMRTMQCDFVQTKYLRMLND 58

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAV-----YNA-KLDTWSVYP-LRYM 111
             V +G  +  +  K  ++Y+SP S + + +G  + +      +   ++    +  +  +
Sbjct: 59  RMVSRGRMYYQQRDKLRWEYTSPYSYAFVLNGPRVLISKGSRNDVINVNQSKFFKEIARI 118

Query: 112 AFSVIFSNNQHVIQESIQRVESNNSFITIFF-----KDDFMGNMISVTFDRLSYRLLNWK 166
             + +     +  ++    + S+ +           +   M   I + F R    +   +
Sbjct: 119 MMNSVVGKALNDRRDFKVALSSSAAEYVAVLYPQQKQMQQMFQKIVLHFSRQHAMVAKVE 178

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
           +++     ++I++   K N+ ++ KVF + 
Sbjct: 179 LVEKRGDRTVIEMKNVKVNSPVNAKVFSVN 208


>gi|156974087|ref|YP_001444994.1| outer-membrane lipoprotein carrier protein [Vibrio harveyi ATCC
           BAA-1116]
 gi|166230503|sp|A7MSW6|LOLA_VIBHB RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|156525681|gb|ABU70767.1| hypothetical protein VIBHAR_01798 [Vibrio harveyi ATCC BAA-1116]
          Length = 208

 Score = 58.4 bits (140), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 37/207 (17%), Positives = 71/207 (34%), Gaps = 20/207 (9%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---ED 57
           M  L    +   ++L F        A+    KD+  K+              F Q     
Sbjct: 1   MKKLFSAKLFSALVLSFSLFSTAHAAS---PKDELNKRLS--MNG--GFSADFSQQVISP 53

Query: 58  AGYVM---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRY 110
            G  +   +G   +ARPS F +  +SP    L+SDG  +  Y+  ++  S+Y        
Sbjct: 54  EGETVMEGEGTVEIARPSLFRWSTTSPDENLLVSDGKTLWYYSPFIEQVSIYWQEQATEQ 113

Query: 111 MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
             F V+ + N+    ++ +  +  + F  I    D       +  D     +  + +++ 
Sbjct: 114 TPF-VLLTRNRASDWDNYKISQKGDQFTLIPTAVDSTQGQFQINIDAKGV-VKGFNVVEQ 171

Query: 171 SRRYSIIKILKYKENTVLDPK-VFEIP 196
             +  +      K       +  F IP
Sbjct: 172 DGQKGLFTFNNVKLGKPKADRFTFTIP 198


>gi|321472927|gb|EFX83896.1| hypothetical protein DAPPUDRAFT_239451 [Daphnia pulex]
          Length = 642

 Score = 58.0 bits (139), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 37/99 (37%), Gaps = 7/99 (7%)

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI-QRVESNNSFI-- 138
             + ++S    + V N K  T   +PL      V+      +   +I + ++  +  I  
Sbjct: 494 VPLEIVSVNGTVYVANHKTQTLETHPLSSTPLFVLLRPEIRLGDLAIEKELKEEDGLIYW 553

Query: 139 TIFFKDDFMGNM--ISVTFDRLSYRLLNWKIM--DSSRR 173
           T+  ++D  G    I++ F R S     W  +  D    
Sbjct: 554 TLTKEEDTGGEQPEITLIFKRGSLDFQGWAHLKADRQGL 592


>gi|262171857|ref|ZP_06039535.1| outer membrane lipoprotein carrier protein LolA [Vibrio mimicus
           MB-451]
 gi|261892933|gb|EEY38919.1| outer membrane lipoprotein carrier protein LolA [Vibrio mimicus
           MB-451]
          Length = 198

 Score = 58.0 bits (139), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 37/202 (18%), Positives = 74/202 (36%), Gaps = 22/202 (10%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVM---KGEF 66
           + L F S      +A    KD   ++        +    TF Q      G V+    G  
Sbjct: 5   LALLFCSF-----SAIAAPKDTLSER----LAMSEGFSATFNQQVLSPEGKVIITGHGTV 55

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQH 122
            +ARPS F ++  +P    L+SDG+ +  ++  ++  ++Y     L    F V+ + N+ 
Sbjct: 56  DIARPSLFRWETQAPDENLLVSDGTTLWHFDPFVEQVTLYRAEEALEQTPF-VLLTRNKA 114

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              ++    E  + F       D       +T       +  +K+++   + S     K 
Sbjct: 115 SDWDAYHVEEKGDVFTLTPTALDSNQGRFQITISDKGI-VQGFKVIEQDGQQSEFTFSKV 173

Query: 183 KENTVLDPKVFEIPYDKIHNIN 204
           K+    +  +F     K   ++
Sbjct: 174 KQ-QKPNASLFNYKVPKGVEVD 194


>gi|153828118|ref|ZP_01980785.1| outer membrane lipoproteins carrier protein [Vibrio cholerae
           623-39]
 gi|148876360|gb|EDL74495.1| outer membrane lipoproteins carrier protein [Vibrio cholerae
           623-39]
          Length = 198

 Score = 58.0 bits (139), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 39/202 (19%), Positives = 75/202 (37%), Gaps = 22/202 (10%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVM---KGEF 66
           + L F S      +A    KD   ++        +    TF Q      G V+    G+ 
Sbjct: 5   LALLFCSF-----SAIAAPKDTLSER----LAMSEGFSATFNQQVLSPEGKVILTGNGKV 55

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQH 122
            +ARPS F ++  +P    L+SDG+ +  ++  ++  ++Y     L    F V+ + N+ 
Sbjct: 56  DIARPSLFRWETETPDENLLVSDGTTLWHFDPFVEQVTLYRAEEALEQTPF-VLLTRNKA 114

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              ++    E  + F       D       +T       +  +K+++   + S     K 
Sbjct: 115 SDWDAYHVEEKGDVFTLTPTALDSNQGRFQITISEKGV-VQGFKVIEQDGQQSEFTFSKV 173

Query: 183 KENTVLDPKVFEIPYDKIHNIN 204
           K+    +  VF     K   I+
Sbjct: 174 KQ-QKPNASVFNYKVPKGVEID 194


>gi|284007598|emb|CBA73188.1| outer-membrane lipoprotein carrier protein [Arsenophonus nasoniae]
          Length = 206

 Score = 58.0 bits (139), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 35/197 (17%), Positives = 77/197 (39%), Gaps = 24/197 (12%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAG---YVM 62
           ++G++ + F+ +    +AA  +               I +    F Q      G      
Sbjct: 7   MLGLLAISFHISQVWADAAAELQMR---------LNKINSFHANFAQKVTSIDGDLIQQG 57

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFS 118
           +G+ ++ RP+ F +   SP    L+SDG+N+  YN  ++  +V  L        F +I  
Sbjct: 58  EGQLWIKRPNLFNWHMVSPDESWLVSDGTNLWFYNPFVEQVTVTLLSEATTDTPFMLITR 117

Query: 119 NN-QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
           N+ Q   +  I +   +        K +     I+V   +    +  +  ++   + S  
Sbjct: 118 NDPQDWKRYHISQNGDDFLLTATQNKGNLKHFSITV---QPDGTIQQFTAVEQDGQMSAY 174

Query: 178 KILKYKENTVLDPKVFE 194
           ++   ++N+ +D   F+
Sbjct: 175 QLKG-QQNSQVDDDKFK 190


>gi|87122211|ref|ZP_01078094.1| outer-membrane lipoprotein carrier protein precursor [Marinomonas
           sp. MED121]
 gi|86162531|gb|EAQ63813.1| outer-membrane lipoprotein carrier protein precursor [Marinomonas
           sp. MED121]
          Length = 207

 Score = 58.0 bits (139), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 26/166 (15%), Positives = 71/166 (42%), Gaps = 24/166 (14%)

Query: 47  QTMQGTFLQE---DAGYVM---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL 100
           + ++G F Q    + G  +   +G F +A P++F +   +P    +IS+G  I +++  L
Sbjct: 32  RNIEGEFRQVTYDEQGEQLQANEGVFLLAEPNRFVWDTITPFPQRIISNGEWITIWDVDL 91

Query: 101 DTWSVYP----LRYMAFSVI------FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNM 150
           +  +  P    L     +++         + ++ Q   QR            ++  + + 
Sbjct: 92  EQATQKPLEGALGNSPAALLGQPANEVLPHYNISQLGEQRFRLEPK------EEVDLFST 145

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
           ++++F + +   ++  I DS  + ++I+    + +  +    F++ 
Sbjct: 146 LTLSFRQNAIEAMS--IQDSLGQTTVIEFKNVESHDGVADGNFQVD 189


>gi|88703366|ref|ZP_01101082.1| Outer membrane lipoprotein carrier protein LolA [Congregibacter
           litoralis KT71]
 gi|88702080|gb|EAQ99183.1| Outer membrane lipoprotein carrier protein LolA [Congregibacter
           litoralis KT71]
          Length = 194

 Score = 58.0 bits (139), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 26/181 (14%), Positives = 60/181 (33%), Gaps = 13/181 (7%)

Query: 24  FNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---DAGY---VMKGEFFMARPSKFYFK 77
            NAA  + + +S         S    +G+F+QE   + G      +G + + RP  F ++
Sbjct: 2   LNAAPGLARSES-DDVWALLASQSQARGSFVQELSDEDGELLERTRGRYAVLRPGFFRWE 60

Query: 78  YSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVES 133
              P    ++  G+++  Y+  L   +              ++  ++  + +E       
Sbjct: 61  IQEPDQQLIVVSGTDLWHYDRDLAAATRRDTSQTNEFTPLELLAGDSDEL-REKFTTQVL 119

Query: 134 NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
               + +           SV        ++   ++D S +   + +        L    F
Sbjct: 120 GPGQVRLV-PTFPQAGFASVDITWKDEAVVAMAVVDRSGQTIDLALTPDAAPAALTAGDF 178

Query: 194 E 194
           E
Sbjct: 179 E 179


>gi|262394649|ref|YP_003286503.1| outer membrane lipoprotein carrier protein LolA [Vibrio sp. Ex25]
 gi|262338243|gb|ACY52038.1| outer membrane lipoprotein carrier protein LolA [Vibrio sp. Ex25]
          Length = 208

 Score = 58.0 bits (139), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 37/196 (18%), Positives = 67/196 (34%), Gaps = 19/196 (9%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVM---KGEFF 67
           ++   S     NAA P  +        E F         F Q      G  +   +G   
Sbjct: 13  LVLSVSFFSAANAASPKDELNKRLAMNEGFS------ADFSQQVISPEGETVMEGEGTVE 66

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHV 123
           +ARPS F +  + P    L+SDG  +  Y+  ++  S+Y          F V+ + N+  
Sbjct: 67  IARPSLFRWSTTFPDENLLVSDGKTLWYYSPFIEQVSIYWQEQATEQTPF-VLLTRNRAS 125

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
             ++ +  +  N F  I    D       +  D     +  + +++   +  +      K
Sbjct: 126 DWDNYKISQKGNEFTLIPTAIDSTQGQFQINIDAKGV-VKGFNVIEQDGQKGLFTFSNVK 184

Query: 184 ENT-VLDPKVFEIPYD 198
                +D   F IP  
Sbjct: 185 LGKPKVDRFTFTIPDG 200


>gi|15606644|ref|NP_214024.1| hypothetical protein aq_1483 [Aquifex aeolicus VF5]
 gi|14916866|sp|O67459|Y1483_AQUAE RecName: Full=Uncharacterized protein aq_1483; Flags: Precursor
 gi|2983872|gb|AAC07425.1| putative protein [Aquifex aeolicus VF5]
          Length = 208

 Score = 58.0 bits (139), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 27/171 (15%), Positives = 62/171 (36%), Gaps = 14/171 (8%)

Query: 37  KKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           ++  E + + +T++ +F+Q+          V KG F+ ++  K    Y SP  VS+  D 
Sbjct: 26  QRLKELYENTKTIKVSFVQKVKYEWYPKADVSKGIFYASKGGKVRIDYYSPDRVSIFVDR 85

Query: 91  SNIAVYNAKLDTWSVYPLRY--MAF---SVIFSNNQHVIQESIQRVESNNSFITIF--FK 143
             + + N +     +  ++             S     + + I   +  +  + +    K
Sbjct: 86  KKVVLVNFEEKVVYIESIKRNTSPVIASLFFLSEQPEKVFKPIGEFKEGDKTVLLLKPLK 145

Query: 144 DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
            D     + + F      +L  K  D+      I  ++   N     ++F+
Sbjct: 146 KDENVKEVKIYFS-KDGEILGLKTYDAQGSEISINFIEVVRNYTPTDELFK 195


>gi|119945375|ref|YP_943055.1| outer membrane lipoprotein carrier protein LolA [Psychromonas
           ingrahamii 37]
 gi|189028556|sp|A1SVE1|LOLA_PSYIN RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|119863979|gb|ABM03456.1| outer membrane lipoprotein carrier protein LolA [Psychromonas
           ingrahamii 37]
          Length = 205

 Score = 58.0 bits (139), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 49/120 (40%), Gaps = 13/120 (10%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGE 65
           V+++      F  +A    T  Q +K+ +  F  I      F Q      G +    +G 
Sbjct: 5   VIVISILLTSFLSSAVSAATDSQLLKEKLAKFSFIN---AEFSQQVSSPEGKILDDSQGM 61

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQ 121
             ++RP KF ++   P    ++SDG  + +Y+  ++  ++  L        F ++   N+
Sbjct: 62  LAISRPGKFRWEVLMPEEELIVSDGQTMWMYSPFIEQVTLLNLSDAIQGTPFILLSGANE 121


>gi|262274500|ref|ZP_06052311.1| outer membrane lipoprotein carrier protein LolA [Grimontia hollisae
           CIP 101886]
 gi|262221063|gb|EEY72377.1| outer membrane lipoprotein carrier protein LolA [Grimontia hollisae
           CIP 101886]
          Length = 198

 Score = 58.0 bits (139), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 26/167 (15%), Positives = 62/167 (37%), Gaps = 14/167 (8%)

Query: 37  KKAIEHFLSIQTMQGTFLQE---DAGYVM---KGEFFMARPSKFYFKYSSPSSVSLISDG 90
           ++       + +   +F Q      G V+   +G+  + RP+ F ++  +P    LISDG
Sbjct: 21  QELNTRLSKLNSFTASFEQTVTSPDGDVISEGEGKLAVKRPNLFNWETVTPDENYLISDG 80

Query: 91  SNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDF 146
             +  Y+  ++  +   L        F ++  NN      +   V+      T+  K+  
Sbjct: 81  KTLWYYSPFIEQVTAMWLDDATSQTPFVLLTRNNPD--DWNNYNVKQEGDTFTLSPKEAS 138

Query: 147 MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
                 V   +   ++  + +++   + S  ++   + N +     F
Sbjct: 139 NHGE-FVVSVKPDGKITEFAVVEQDGQQSRFELENVQ-NVLPAASTF 183


>gi|153835804|ref|ZP_01988471.1| outer membrane lipoprotein carrier protein LolA [Vibrio harveyi
           HY01]
 gi|148867451|gb|EDL66840.1| outer membrane lipoprotein carrier protein LolA [Vibrio harveyi
           HY01]
          Length = 208

 Score = 57.6 bits (138), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 37/207 (17%), Positives = 71/207 (34%), Gaps = 20/207 (9%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---ED 57
           M  L    +   ++L F S     +AA P  +        + F         F Q     
Sbjct: 1   MKKLFSAKLFSALVLSF-SLFSTAHAASPKDELNKRLSMNDGFS------ADFSQQVISP 53

Query: 58  AGYVM---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRY 110
            G  +   +G   +ARPS F +  + P    L+SDG  +  Y+  ++  S+Y        
Sbjct: 54  EGETVMEGEGTVEIARPSLFRWSTTFPDENLLVSDGKTLWYYSPFIEQVSIYWQEQATEQ 113

Query: 111 MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
             F V+ + N+    ++ +  +  + F  I    D       +  D     +  + +++ 
Sbjct: 114 TPF-VLLTRNRASDWDNYKISQKGDQFTLIPTAVDSTQGQFQINIDAKGV-VKGFNVVEQ 171

Query: 171 SRRYSIIKILKYKENTVLDPK-VFEIP 196
             +  +      K       +  F IP
Sbjct: 172 DGQKGLFTFNNVKLGKPKADRFTFTIP 198


>gi|261210731|ref|ZP_05925023.1| outer membrane lipoprotein carrier protein LolA [Vibrio sp. RC341]
 gi|260840216|gb|EEX66796.1| outer membrane lipoprotein carrier protein LolA [Vibrio sp. RC341]
          Length = 198

 Score = 57.6 bits (138), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 38/202 (18%), Positives = 75/202 (37%), Gaps = 22/202 (10%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVM---KGEF 66
           + L F S      +A    KD   ++        +    TF Q      G V+    G+ 
Sbjct: 5   LALLFCSF-----SAIAAPKDTLSER----LAMSEGFSATFNQQVLSPEGKVILIGNGKV 55

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQH 122
            +ARPS F ++  +P    L+SDG+ +  ++  ++  ++Y     L    F V+ + N+ 
Sbjct: 56  DIARPSLFRWETETPDENLLVSDGTTLWHFDPFVEQVTLYRAEEALEQTPF-VLLTRNKA 114

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              ++    E  + F       D       +T       +  +K+++   + S     K 
Sbjct: 115 SDWDAYHVEEKGDVFTLTPTALDSNQGRFQITISEKGV-VQGFKVIEQDGQQSEFTFSKV 173

Query: 183 KENTVLDPKVFEIPYDKIHNIN 204
           K+    +  VF     K   ++
Sbjct: 174 KQ-QKPNASVFNYKVPKGVEVD 194


>gi|53728834|ref|ZP_00134877.2| COG2834: Outer membrane lipoprotein-sorting protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126207958|ref|YP_001053183.1| outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae L20]
 gi|190149821|ref|YP_001968346.1| outer-membrane lipoprotein carrier protein precursor
           [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|303250268|ref|ZP_07336468.1| outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303252144|ref|ZP_07338312.1| outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307247480|ref|ZP_07529525.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307249713|ref|ZP_07531692.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|307252033|ref|ZP_07533933.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307256529|ref|ZP_07538310.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307260959|ref|ZP_07542641.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|307263142|ref|ZP_07544763.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|166230489|sp|A3MZJ2|LOLA_ACTP2 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229485821|sp|B3GX52|LOLA_ACTP7 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|126096750|gb|ABN73578.1| outer-membrane lipoprotein carrier protein precursor
           [Actinobacillus pleuropneumoniae serovar 5b str. L20]
 gi|189914952|gb|ACE61204.1| Outer-membrane lipoprotein carrier protein precursor
           [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|302648927|gb|EFL79115.1| outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302650884|gb|EFL81040.1| outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306855983|gb|EFM88141.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306858221|gb|EFM90298.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306860502|gb|EFM92515.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306864939|gb|EFM96841.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306869261|gb|EFN01056.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306871504|gb|EFN03227.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 213

 Score = 57.6 bits (138), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 38/218 (17%), Positives = 77/218 (35%), Gaps = 29/218 (13%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---D 57
           M  LL +S++G  ++    A F           QSV +       +      F Q     
Sbjct: 1   MKKLLKQSLLGFALVSMTGAAF--------ADAQSVAELQRRLEQVSQYSADFDQTVRSS 52

Query: 58  AGYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRY 110
            G  ++   G+F + RP+ F     SP    ++SDG+N+  Y+  +   +V      +  
Sbjct: 53  KGKQIQSGKGKFQVKRPNLFRMDTKSPQENLIVSDGANLWFYDPFVSQVTVNTVQDAVNN 112

Query: 111 MAFSVIF-SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFD---RLSYRLLNWK 166
             F ++  S+  H  Q  + +        T   K     + +   FD     S  L  + 
Sbjct: 113 TPFVLLTSSDKSHWDQYDVTQNAD-----TFVLKPKSKKSNLK-QFDVRIDQSGMLKGFS 166

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
            ++   + ++  +        +   +F+    K   ++
Sbjct: 167 TIERDGQSNLYVLRNI-TGGGVSSDLFKFSVPKGAELD 203


>gi|15641120|ref|NP_230752.1| outer-membrane lipoprotein carrier protein [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121591282|ref|ZP_01678577.1| outer membrane lipoproteins carrier protein [Vibrio cholerae
           2740-80]
 gi|121726295|ref|ZP_01679585.1| outer membrane lipoproteins carrier protein [Vibrio cholerae V52]
 gi|147675332|ref|YP_001216576.1| outer-membrane lipoprotein carrier protein [Vibrio cholerae O395]
 gi|153213531|ref|ZP_01948821.1| outer membrane lipoproteins carrier protein [Vibrio cholerae 1587]
 gi|153802142|ref|ZP_01956728.1| outer membrane lipoproteins carrier protein [Vibrio cholerae MZO-3]
 gi|153816938|ref|ZP_01969605.1| outer membrane lipoproteins carrier protein [Vibrio cholerae NCTC
           8457]
 gi|153823887|ref|ZP_01976554.1| outer membrane lipoproteins carrier protein [Vibrio cholerae B33]
 gi|153824914|ref|ZP_01977581.1| outer membrane lipoproteins carrier protein [Vibrio cholerae MZO-2]
 gi|227081280|ref|YP_002809831.1| outer membrane lipoproteins carrier protein [Vibrio cholerae M66-2]
 gi|229505297|ref|ZP_04394807.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae BX
           330286]
 gi|229511033|ref|ZP_04400512.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           B33]
 gi|229515490|ref|ZP_04404949.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           TMA 21]
 gi|229518154|ref|ZP_04407598.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           RC9]
 gi|229520460|ref|ZP_04409885.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae TM
           11079-80]
 gi|229529803|ref|ZP_04419193.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           12129(1)]
 gi|229608316|ref|YP_002878964.1| outer-membrane lipoprotein carrier protein [Vibrio cholerae
           MJ-1236]
 gi|254225501|ref|ZP_04919111.1| outer membrane lipoproteins carrier protein [Vibrio cholerae V51]
 gi|254291531|ref|ZP_04962322.1| outer membrane lipoproteins carrier protein [Vibrio cholerae
           AM-19226]
 gi|254848237|ref|ZP_05237587.1| outer membrane lipoproteins carrier protein [Vibrio cholerae MO10]
 gi|255745520|ref|ZP_05419468.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholera
           CIRS 101]
 gi|262158406|ref|ZP_06029522.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           INDRE 91/1]
 gi|262170268|ref|ZP_06037955.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           RC27]
 gi|262402532|ref|ZP_06079093.1| outer membrane lipoprotein carrier protein LolA [Vibrio sp. RC586]
 gi|297578709|ref|ZP_06940637.1| outer-membrane lipoprotein carrier protein [Vibrio cholerae RC385]
 gi|298498788|ref|ZP_07008595.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           MAK 757]
 gi|9977683|sp|P57069|LOLA_VIBCH RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|172047402|sp|A5F2G9|LOLA_VIBC3 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|254809233|sp|C3LU04|LOLA_VIBCM RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|9655577|gb|AAF94266.1| outer membrane lipoproteins carrier protein [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121546866|gb|EAX57024.1| outer membrane lipoproteins carrier protein [Vibrio cholerae
           2740-80]
 gi|121631241|gb|EAX63614.1| outer membrane lipoproteins carrier protein [Vibrio cholerae V52]
 gi|124115867|gb|EAY34687.1| outer membrane lipoproteins carrier protein [Vibrio cholerae 1587]
 gi|124122335|gb|EAY41078.1| outer membrane lipoproteins carrier protein [Vibrio cholerae MZO-3]
 gi|125621971|gb|EAZ50295.1| outer membrane lipoproteins carrier protein [Vibrio cholerae V51]
 gi|126512525|gb|EAZ75119.1| outer membrane lipoproteins carrier protein [Vibrio cholerae NCTC
           8457]
 gi|126518590|gb|EAZ75813.1| outer membrane lipoproteins carrier protein [Vibrio cholerae B33]
 gi|146317215|gb|ABQ21754.1| outer membrane lipoproteins carrier protein [Vibrio cholerae O395]
 gi|149741426|gb|EDM55456.1| outer membrane lipoproteins carrier protein [Vibrio cholerae MZO-2]
 gi|150422595|gb|EDN14551.1| outer membrane lipoproteins carrier protein [Vibrio cholerae
           AM-19226]
 gi|227009168|gb|ACP05380.1| outer membrane lipoproteins carrier protein [Vibrio cholerae M66-2]
 gi|227012922|gb|ACP09132.1| outer membrane lipoproteins carrier protein [Vibrio cholerae O395]
 gi|229333577|gb|EEN99063.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           12129(1)]
 gi|229342558|gb|EEO07551.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae TM
           11079-80]
 gi|229344869|gb|EEO09843.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           RC9]
 gi|229347259|gb|EEO12219.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           TMA 21]
 gi|229350998|gb|EEO15939.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           B33]
 gi|229357520|gb|EEO22437.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae BX
           330286]
 gi|229370971|gb|ACQ61394.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           MJ-1236]
 gi|254843942|gb|EET22356.1| outer membrane lipoproteins carrier protein [Vibrio cholerae MO10]
 gi|255736595|gb|EET91992.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholera
           CIRS 101]
 gi|262021283|gb|EEY39997.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           RC27]
 gi|262029847|gb|EEY48495.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           INDRE 91/1]
 gi|262351314|gb|EEZ00447.1| outer membrane lipoprotein carrier protein LolA [Vibrio sp. RC586]
 gi|297536303|gb|EFH75136.1| outer-membrane lipoprotein carrier protein [Vibrio cholerae RC385]
 gi|297543121|gb|EFH79171.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           MAK 757]
 gi|327483812|gb|AEA78219.1| Outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           LMA3894-4]
          Length = 198

 Score = 57.6 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 38/202 (18%), Positives = 75/202 (37%), Gaps = 22/202 (10%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVM---KGEF 66
           + L F S      +A    KD   ++        +    TF Q      G V+    G+ 
Sbjct: 5   LALLFCSF-----SAIAAPKDTLSER----LAMSEGFSATFNQQVLSPEGKVILTGNGKV 55

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQH 122
            +ARPS F ++  +P    L+SDG+ +  ++  ++  ++Y     L    F V+ + N+ 
Sbjct: 56  DIARPSLFRWETETPDENLLVSDGTTLWHFDPFVEQVTLYRAEEALEQTPF-VLLTRNKA 114

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              ++    E  + F       D       +T       +  +K+++   + S     K 
Sbjct: 115 SDWDAYHVEEKGDVFTLTPTALDSNQGRFQITISEKGV-VQGFKVIEQDGQQSEFTFSKV 173

Query: 183 KENTVLDPKVFEIPYDKIHNIN 204
           K+    +  VF     K   ++
Sbjct: 174 KQ-QKPNASVFNYKVPKGVEVD 194


>gi|281425204|ref|ZP_06256117.1| outer membrane lipoprotein carrier protein LolA [Prevotella oris
           F0302]
 gi|281400670|gb|EFB31501.1| outer membrane lipoprotein carrier protein LolA [Prevotella oris
           F0302]
          Length = 205

 Score = 57.6 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 76/202 (37%), Gaps = 18/202 (8%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEF 66
           ++LFF         A    +    ++      +++TMQ  F+Q       +   V +G+ 
Sbjct: 4   LLLFFMVLCIANANAQSFNETTVRQQIENAAANMKTMQCDFVQTKTLRMLNDKMVSQGKM 63

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW------------SVYPLRYMAFS 114
           +  +  K  ++Y+SP   + I +GS + +   K +              +   +  +   
Sbjct: 64  YYQQSDKLRWEYTSPYLYTFILNGSKVLISKGKRNDVINVEQSKFFKEIARIMMNSVVGK 123

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
            +       +  S    E   +      +   M   I + F+R    +   ++++    +
Sbjct: 124 CLNDKKDFKVSLSATPTEYIATLFPQQKQMQQMFQKIILHFNRQRAMVAKVELVEKRGDH 183

Query: 175 SIIKILKYKENTVLDPKVFEIP 196
           ++I++   K N+ ++ KVF I 
Sbjct: 184 TVIEMKNVKVNSPINAKVFTIN 205


>gi|167854724|ref|ZP_02477503.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           parasuis 29755]
 gi|219870512|ref|YP_002474887.1| outer-membrane lipoprotein carrier protein [Haemophilus parasuis
           SH0165]
 gi|254809231|sp|B8F3N7|LOLA_HAEPS RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|167854138|gb|EDS25373.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           parasuis 29755]
 gi|219690716|gb|ACL31939.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           parasuis SH0165]
          Length = 209

 Score = 57.6 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 57/127 (44%), Gaps = 12/127 (9%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITK---DQSVKKAIEHFLSIQTMQGTFLQED 57
           M  LL KS++G+  L      F    A    +   D++++ + +   ++++ +G  +Q+ 
Sbjct: 1   MKNLLKKSLLGLAFLSLNGFAFADAQAVAELQQRLDKAMQYSADFEQTVRSSKGKEIQKG 60

Query: 58  AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT----WSVYPLRYMAF 113
                +G+F + RP+ F     SP    ++SDG  +  Y+  +      W    +    F
Sbjct: 61  -----QGKFQVKRPNLFRMDTQSPQENLIVSDGKTLWFYDPFVSQVTANWVKDAVSNTPF 115

Query: 114 SVIFSNN 120
            ++ SN+
Sbjct: 116 VLLTSND 122


>gi|153003061|ref|YP_001377386.1| outer membrane lipoprotein carrier protein LolA [Anaeromyxobacter
           sp. Fw109-5]
 gi|152026634|gb|ABS24402.1| outer membrane lipoprotein carrier protein LolA [Anaeromyxobacter
           sp. Fw109-5]
          Length = 231

 Score = 57.6 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/167 (8%), Positives = 51/167 (30%), Gaps = 18/167 (10%)

Query: 45  SIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNA 98
           +  T++  F+Q              G  +  +P +  ++YS+P     +  G        
Sbjct: 53  ATTTLRARFVQTKGFTAIGEEDRSSGVLYYRKPDRLRWEYSAPDRAWTVIAGDRGWAVFP 112

Query: 99  KLDTWSVYPLRYMAFSVIF---------SNNQHVIQESIQRVESNNSFITIFFKDDFMG- 148
           ++     + +       I          +      + ++         +++  +   +  
Sbjct: 113 RIRQVQRFTVGRSRAEGILSTIGFGACGAALADAFETTLAFGAGGAPVLSLTPRGPELAA 172

Query: 149 --NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
               + +T D   +   +  + ++S   +   +   +    ++  +F
Sbjct: 173 SFTRVELTLDPKDHLPRDILLHETSGDTTRFVLSDVQRGVAIEGSLF 219


>gi|229525719|ref|ZP_04415124.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           bv. albensis VL426]
 gi|229339300|gb|EEO04317.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           bv. albensis VL426]
          Length = 198

 Score = 57.2 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 37/202 (18%), Positives = 74/202 (36%), Gaps = 22/202 (10%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVM---KGEF 66
           + L F S      +A    KD   ++        +    TF Q      G V+    G+ 
Sbjct: 5   LALLFCSF-----SAIAAPKDTLSER----LAMSEGFSATFNQQVLSPEGKVILTGNGKV 55

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQH 122
            +ARPS   ++  +P    L+SDG+ +  ++  ++  ++Y     L    F V+ + N+ 
Sbjct: 56  DIARPSLLRWETETPDENLLVSDGTTLWHFDPFVEQVTLYRAEEALEQTPF-VLLTRNKA 114

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
              ++    E  + F       D       +T       +  +K+++   + S     K 
Sbjct: 115 SDWDAYHVEEKGDVFTLTPTALDSNQGRFQITISEKGV-VQGFKVIEQDGQQSEFTFSKV 173

Query: 183 KENTVLDPKVFEIPYDKIHNIN 204
           K+    +  VF     K   ++
Sbjct: 174 KQ-QKPNASVFNYKVPKGVEVD 194


>gi|262200011|ref|YP_003271220.1| outer membrane lipoprotein carrier protein LolA [Haliangium
           ochraceum DSM 14365]
 gi|262083358|gb|ACY19327.1| outer membrane lipoprotein carrier protein LolA [Haliangium
           ochraceum DSM 14365]
          Length = 258

 Score = 57.2 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/215 (11%), Positives = 62/215 (28%), Gaps = 20/215 (9%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYV 61
               V             ++      Q V +  E ++  Q +   F Q           V
Sbjct: 27  RAAQVQAASAGDKATATKSSKLSDPAQVVARVQEFYIDTQRLTALFRQIYTNTTFGKKSV 86

Query: 62  MKGEFFMARPSKFYFKY---SSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSV--- 115
             G+ ++ +P K  + Y         S ISDG+ +              L      V   
Sbjct: 87  SDGKLWVKKPGKMRWDYRGSQKKVKKSFISDGTTLWAVEHDNQQVFKKNLEDDMLPVAVS 146

Query: 116 IFSNNQHVIQESIQRVESNNSF-------ITIFFKDDFMG-NMISVTFDRLSYRLLNWKI 167
                  + ++    ++++N +       + +  +        + +  D  ++R+    +
Sbjct: 147 FLYGKGDLARDFRPALDTSNKYGKKSDYVLELTPRKPSAQYKTLYLVVDPGNFRVKESVV 206

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
           +++S   +  +         +    F     +  N
Sbjct: 207 IEASGNTNHFRFFSPDTRAGIQDAWFFFNEKRFKN 241


>gi|299142671|ref|ZP_07035801.1| outer membrane lipoprotein carrier protein LolA [Prevotella oris
           C735]
 gi|298575886|gb|EFI47762.1| outer membrane lipoprotein carrier protein LolA [Prevotella oris
           C735]
          Length = 205

 Score = 57.2 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 76/202 (37%), Gaps = 18/202 (8%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEF 66
           ++LFF         A    +    ++      +++TMQ  F+Q       +   V +G+ 
Sbjct: 4   LLLFFMVLCIANANAQSFNETTVRQQIENAAANMKTMQCDFVQTKTLRVLNDKMVSRGKM 63

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW------------SVYPLRYMAFS 114
           +  +  K  ++Y+SP   + I +GS + +   K +              +   +  +   
Sbjct: 64  YYQQSDKLRWEYTSPYLYTFILNGSKVLISKGKRNDVINVEQSKFFKEIARIMMNSVVGK 123

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
            +       +  S    E   +      +   M   I + F+R    +   ++++    +
Sbjct: 124 CLNDKKDFKVSLSATPTEYIATLFPQQRQMQQMFQKIILHFNRQRAMVAKVELVEKRGDH 183

Query: 175 SIIKILKYKENTVLDPKVFEIP 196
           ++I++   K N+ ++ KVF I 
Sbjct: 184 TVIEMKNVKVNSPINAKVFTIN 205


>gi|240949359|ref|ZP_04753701.1| outer-membrane lipoprotein carrier protein [Actinobacillus minor
           NM305]
 gi|240296209|gb|EER46862.1| outer-membrane lipoprotein carrier protein [Actinobacillus minor
           NM305]
          Length = 213

 Score = 57.2 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 51/130 (39%), Gaps = 18/130 (13%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---D 57
           M  ++ KS+ G+ +     + F           Q+V +       +      F Q     
Sbjct: 1   MKQIMKKSLFGLALFSLAGSAF--------ADAQAVAELQNRLEKVSQYSADFDQTVRSS 52

Query: 58  AGYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRY 110
            G  ++   G+F + RP+ F     SP    ++SDG+N+  Y+  +   +V      +  
Sbjct: 53  KGKQIQSGQGKFQVKRPNLFRMDTKSPQENLIVSDGANLWFYDPFVSQVTVNTVQDAVNN 112

Query: 111 MAFSVIFSNN 120
             F ++ SNN
Sbjct: 113 TPFVLLTSNN 122


>gi|239994322|ref|ZP_04714846.1| outer membrane lipoprotein carrier protein LolA [Alteromonas
           macleodii ATCC 27126]
          Length = 274

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/200 (13%), Positives = 71/200 (35%), Gaps = 32/200 (16%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV------MKGEFFMARPSKFYFKYSSP 81
             +  D +         +++  + +F Q             +G   M RP+K  ++ + P
Sbjct: 65  SSLINDSASTSLQALLSNMKLFRASFAQTVVDAQQNVVHEAQGTLTMTRPNKLRWETTFP 124

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHV-IQESIQRVESNNS 136
               L++DG  +   +  ++  +V      ++     ++ S ++    + SI ++ S +S
Sbjct: 125 DETLLVADGEAVWNVDTFVEQVTVLSQDNAIKDNPIVLLTSTDEATWSKFSISQLNSGSS 184

Query: 137 FITIF--FKDDFMGN------------------MISVTFDRLSYRLLNWKIMDSSRRYSI 176
            +T      D+  G                    +++TF      L +  ++D+ ++ S 
Sbjct: 185 AVTPENGAADNINGGSATKSYQITPKEQGGQIATLTLTF-NQDSELASLNMLDAQQQIST 243

Query: 177 IKILKYKENTVLDPKVFEIP 196
           +     +    +    F + 
Sbjct: 244 LVFSNIETRFPVPADTFLVD 263


>gi|307258726|ref|ZP_07540458.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306867077|gb|EFM98933.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 213

 Score = 56.8 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 38/218 (17%), Positives = 77/218 (35%), Gaps = 29/218 (13%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---D 57
           M  LL +S++G  ++    A F           QSV +       +      F Q     
Sbjct: 1   MKKLLKQSLLGFALVSMTGAAF--------ADAQSVAELQRRLEQVSQYSADFDQTVRSS 52

Query: 58  AGYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRY 110
            G  ++   G+F + RP+ F     SP    ++SDG+N+  Y+  +   +V      +  
Sbjct: 53  KGKQIQSGKGKFQVKRPNLFRMDTKSPQENLIVSDGANLWFYDPFVSQVTVNTVQDAVNN 112

Query: 111 MAFSVIF-SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFD---RLSYRLLNWK 166
             F ++  S+  H  Q  + +        T   K     + +   FD     S  L  + 
Sbjct: 113 TPFVLLTSSDKSHWDQYDVTQNAD-----TFVLKPKSKKSNLK-QFDVRIDQSGMLKGFS 166

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
            ++   + ++  +        +   +F+    K   ++
Sbjct: 167 TIERDGQSNLYVLRNI-TGGGVSSDLFKFSVPKGTELD 203


>gi|227112003|ref|ZP_03825659.1| outer-membrane lipoprotein carrier protein [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 203

 Score = 56.8 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 28/188 (14%), Positives = 55/188 (29%), Gaps = 13/188 (6%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVM---KGEFFMA 69
           +   +              + K        + +    F Q      G  +   +GE ++ 
Sbjct: 4   WLAISCLIAGVTSTAVYADAAKDLQGRLNKVNSFHANFSQKVTSADGAAVQEGEGELWLK 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQ 125
           RP+ F +K +SP   +LISDG  +  YN  ++  +   L           I         
Sbjct: 64  RPNLFNWKTTSPDESTLISDGKTLWFYNPFVEQVTATWLKDATGNTP--FILITRNDASD 121

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
            +   V        +  K               S  +  +   +   + S   +   ++N
Sbjct: 122 WNKYDVRQKGDDFELTPKSASGNLKQFAINVTTSGTIKQFTATEQDGQRSTYVLKN-QQN 180

Query: 186 TVLDPKVF 193
             +D   F
Sbjct: 181 GAVDAAQF 188


>gi|297569091|ref|YP_003690435.1| outer membrane lipoprotein carrier protein LolA [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296925006|gb|ADH85816.1| outer membrane lipoprotein carrier protein LolA [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 215

 Score = 56.8 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 28/192 (14%), Positives = 74/192 (38%), Gaps = 23/192 (11%)

Query: 23  PFNAAYPITKDQS---VKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARPSK 73
           P N A    +++    ++K       +++M   F QE      D   V +G   + RP +
Sbjct: 19  PINGAAGEKQEELAAFLQKIDRSAAEMRSMSCAFTQEKELAMFDRPVVFRGRLDLVRPDR 78

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA--------FSVIF-SNNQHVI 124
             ++++SP +  LI  G +    +        + L+             +     ++ + 
Sbjct: 79  LRWEFASPINSVLIFKGDSGMRCDGNSPPV-RFDLQQDPIMRMVARQLWLWLGGEHERLA 137

Query: 125 QESIQRVESNNSFITIFFKDDFMG---NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
            E    + ++ + + I  KD  +    + +++ F+  +++    +I ++    + +    
Sbjct: 138 AEYHLSLAADATLL-IEPKDPAVAEFVSSLTIAFNPETHQPRQVEIKEAGGDLTRLTFHD 196

Query: 182 YKENTVLDPKVF 193
            + +  LD  +F
Sbjct: 197 CQPDPDLDDALF 208


>gi|86156517|ref|YP_463302.1| outer membrane lipoprotein carrier protein LolA [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85773028|gb|ABC79865.1| outer membrane lipoprotein carrier protein LolA [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 228

 Score = 56.8 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/178 (11%), Positives = 60/178 (33%), Gaps = 15/178 (8%)

Query: 34  QSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYFKYSSPSSVSLI 87
              +K    +   + ++  F Q              G   + +P    + Y  P+  ++ 
Sbjct: 43  ALARKVQAFYERTRDLEARFRQTYVYAGFGRRQTSSGTLRVKKPGMMRWDYEKPAPKTVA 102

Query: 88  SDGSNIAVYNAKLDT------WSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIF 141
             GS +  Y  + +       +    +   A + +      +++E    ++   + +   
Sbjct: 103 VKGSRLVQYEPEENQAYVDEAFDSSAMSA-AVTFLLGKG-DLLREFDVSLDGAGALLLRP 160

Query: 142 FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            + D     I++T      ++   +++D +   + I+    + N  L    FE+   +
Sbjct: 161 KEADPRVESIALT-VAADGQVTATRVVDGAGNANEIRFEDVRRNVGLPDAAFEVKLPR 217


>gi|283851735|ref|ZP_06369013.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio sp.
           FW1012B]
 gi|283572855|gb|EFC20837.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio sp.
           FW1012B]
          Length = 208

 Score = 56.8 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 63/180 (35%), Gaps = 18/180 (10%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQEDAGYV------MKGEFFMARPSKFYFKYSSPSSVSLIS 88
           ++ +       ++++Q  F QE    +       KGEF   RP    ++Y  P     I 
Sbjct: 29  TLLRLAAKAGQVRSIQTEFTQEKRLSIFKQILLSKGEFAFQRPRSLRWEYLEPVRSGFIL 88

Query: 89  DGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQ---------HVIQESIQRVESNNSFIT 139
            G +   +N        + +R      + S+            + +     V+S+   + 
Sbjct: 89  HGDSGKRWNELAGETQDFSVRKDPIMQLVSSQILLWTTLDLKALSRTYTIAVKSDAPAVL 148

Query: 140 IFFKDDFMGNMIS---VTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
           +F         I+   +TF      +   +I++     + I+    + N  +DP VF  P
Sbjct: 149 LFTPRAAEVGPIAGLCITFTPDDAAIAVIEILEGQGDSTTIRFHGTRLNDDIDPGVFTRP 208


>gi|253699277|ref|YP_003020466.1| outer membrane lipoprotein carrier protein LolA [Geobacter sp. M21]
 gi|251774127|gb|ACT16708.1| outer membrane lipoprotein carrier protein LolA [Geobacter sp. M21]
          Length = 236

 Score = 56.8 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 32/223 (14%), Positives = 68/223 (30%), Gaps = 37/223 (16%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED------AGY 60
             +I V +L           ++     Q V+   + + S+  +Q  F Q           
Sbjct: 1   MKLIRVSMLVMALVALSATVSFAAELSQVVRTLEQGYASLNDLQADFSQRSVIRAMRREE 60

Query: 61  VMKGEFFMARP-SK---FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL-------R 109
              GE  + +   K   F F Y  P    ++S+G  +  Y        V  L        
Sbjct: 61  KGGGELLIKKGSGKDSMFRFNYKKP-KQQIVSNGKTVWYYIPDQKQVMVMDLAHLFEAGN 119

Query: 110 YMAFSVI-----FSNNQHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDRL----- 158
            +A + +      S +  +     QR +S N  + +   +       + +  D       
Sbjct: 120 AIAMNYLAGLGQVSRDFKISFAGQQRDKSGNYQLELTPNRKSPAMAKLMLVIDGKAVETF 179

Query: 159 --------SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
                    + +++  ++D +   + +     K N  +    F
Sbjct: 180 LAKGRPGTPFPVVSSTVVDQAGNSTRMDFSAVKTNRGISDGKF 222


>gi|269967797|ref|ZP_06181844.1| outer-membrane lipoprotein carrier protein precursor [Vibrio
           alginolyticus 40B]
 gi|269827617|gb|EEZ81904.1| outer-membrane lipoprotein carrier protein precursor [Vibrio
           alginolyticus 40B]
          Length = 208

 Score = 56.8 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 37/207 (17%), Positives = 70/207 (33%), Gaps = 20/207 (9%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---ED 57
           M  L    +   ++L F S     +AA P  +        + F         F Q     
Sbjct: 1   MKKLFSAKLFSALVLSF-SLFSTAHAASPKDELNKRLSMNDGFS------ADFSQQVISP 53

Query: 58  AGYVM---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRY 110
            G  +   +G   +ARPS F +  + P    L+SDG  +  Y+  ++  S+Y        
Sbjct: 54  EGETVMEGEGTVEIARPSLFRWSTTFPDENLLVSDGKTLWYYSPFIEQVSIYWQEQATEQ 113

Query: 111 MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
             F V+ + N+     + +  +  + F  I    D       +  D     +  + +++ 
Sbjct: 114 TPF-VLLTRNRASDWNNYKISQKGDQFTLIPTAVDSTQGQFQINIDAKGV-VKGFNVVEQ 171

Query: 171 SRRYSIIKILKYKENTVLDPK-VFEIP 196
             +  +      K       +  F IP
Sbjct: 172 DGQKGLFTFNNVKLGKPKADRFTFTIP 198


>gi|158520397|ref|YP_001528267.1| outer membrane lipoprotein carrier protein LolA [Desulfococcus
           oleovorans Hxd3]
 gi|158509223|gb|ABW66190.1| outer membrane lipoprotein carrier protein LolA [Desulfococcus
           oleovorans Hxd3]
          Length = 229

 Score = 56.5 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/206 (11%), Positives = 65/206 (31%), Gaps = 24/206 (11%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVM 62
           ++ V +    +     +   P+  ++ + +    +    T    F Q       D     
Sbjct: 14  LLCVTLWIGLAGAQASDMQLPV--EEILSRVEARYD-CDTFAADFFQTSTLKAMDITDTA 70

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSV------- 115
           +G     RP++F + Y  P    +ISDG  + ++    +  +V                 
Sbjct: 71  EGSVLFKRPNRFRWSYEKPEKQYIISDGDRLWIFKPDENQVTV---GSAPALFGDGRGAS 127

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNM-----ISVTFDRLSYRLLNWKIMDS 170
            F++ + +  +    +  +    T   K            I +  +  ++ +   + +++
Sbjct: 128 FFTDIKRLRTDYEIGLSPDTDGETYMLKLAPKKKTMDVAAIYLVVNADTFEVTAVETVNA 187

Query: 171 SRRYSIIKILKYKENTVLDPKVFEIP 196
               + I+    + +      +F   
Sbjct: 188 YDDATRIEFTNRRFDLPAADTLFVFD 213


>gi|165975935|ref|YP_001651528.1| outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|229485822|sp|B0BU79|LOLA_ACTPJ RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|165876036|gb|ABY69084.1| outer membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
          Length = 213

 Score = 56.5 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 38/218 (17%), Positives = 78/218 (35%), Gaps = 29/218 (13%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---D 57
           M  LL +S++G  ++    A F           QSV +       +      F Q     
Sbjct: 1   MKKLLKQSLLGFALVSMTGAAF--------ADAQSVAELQRRLEQVSQYSADFDQTVRSS 52

Query: 58  AGYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRY 110
            G  ++   G+F + RP+ F     SP    ++SDG+N+  Y++ +   +V      +  
Sbjct: 53  KGKQIQSGKGKFQVKRPNLFRMDTKSPQENLIVSDGANLWFYDSFVSQVTVNTVQDAVNN 112

Query: 111 MAFSVIF-SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFD---RLSYRLLNWK 166
             F ++  S+  H  Q  + +        T   K     + +   FD     S  L  + 
Sbjct: 113 TPFVLLTSSDKSHWDQYDVTQNAD-----TFVLKPKSKKSNLK-QFDVRIDQSGMLKGFS 166

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
            ++   + ++  +        +   +F+    K   ++
Sbjct: 167 TIERDGQSNLYVLRNI-TGGGVSSDLFKFSVPKGAELD 203


>gi|307254264|ref|ZP_07536105.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306862811|gb|EFM94764.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
          Length = 207

 Score = 56.5 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 38/218 (17%), Positives = 77/218 (35%), Gaps = 29/218 (13%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---D 57
           M  LL +S++G  ++    A F           QSV +       +      F Q     
Sbjct: 1   MKKLLKQSLLGFALVSMTGAAF--------ADAQSVAELQRRLEQVSQYSADFDQTVRSS 52

Query: 58  AGYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRY 110
            G  ++   G+F + RP+ F     SP    ++SDG+N+  Y+  +   +V      +  
Sbjct: 53  KGKQIQSGKGKFQVKRPNLFRMDTKSPQENLIVSDGANLWFYDPFVSQVTVNTVQDAVNN 112

Query: 111 MAFSVIF-SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFD---RLSYRLLNWK 166
             F ++  S+  H  Q  + +        T   K     + +   FD     S  L  + 
Sbjct: 113 TPFVLLTSSDKSHWDQYDVTQNAD-----TFVLKPKSKKSNLK-QFDVRIDQSGMLKGFS 166

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
            ++   + ++  +        +   +F+    K   ++
Sbjct: 167 TIERDGQSNLYVLRNI-TGGGVSSDLFKFSVPKGTELD 203


>gi|260776358|ref|ZP_05885253.1| outer membrane lipoprotein carrier protein LolA [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607581|gb|EEX33846.1| outer membrane lipoprotein carrier protein LolA [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 198

 Score = 56.5 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 34/191 (17%), Positives = 68/191 (35%), Gaps = 17/191 (8%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVMK---GEFFMAR 70
             +  F   +     KD+  ++              F Q      G ++    G+  +AR
Sbjct: 4   LAALFFLSFSVIAAPKDELGQR----LQLTDGFSADFSQQLISPEGEMLTEGEGKVEIAR 59

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQE 126
           PS F +  +SP    L+SDG ++  Y+  ++  S+Y          F V+ + N+    E
Sbjct: 60  PSLFRWTTTSPDENVLVSDGESLWYYSPFIEQVSIYWQEQATEQTPF-VLLTRNRASDWE 118

Query: 127 SIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
           + +  +  + F  +    D       +  D     +  + +++   + S  K    K   
Sbjct: 119 NYKVSQQGDVFTLVPTAVDTNQGQFKLEIDGKG-AVKGFSVIEQDGQKSTFKFNNIKLAK 177

Query: 187 VLDPK-VFEIP 196
               +  F IP
Sbjct: 178 PSADRFTFTIP 188


>gi|227328171|ref|ZP_03832195.1| outer-membrane lipoprotein carrier protein [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 203

 Score = 56.5 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/188 (14%), Positives = 55/188 (29%), Gaps = 13/188 (6%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVM---KGEFFMA 69
           +   +              + K        + +    F Q      G  +   +GE ++ 
Sbjct: 4   WLAISCLIAGVTSTAVYADAAKDLQGRLNKVNSFHANFSQKVTSADGAAVQEGEGELWLK 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQ 125
           RP+ F +K +SP   +LISDG  +  YN  ++  +   L           I         
Sbjct: 64  RPNLFNWKTTSPDESTLISDGKTLWFYNPFVEQVTATWLKDATGNTP--FILITRNDASD 121

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
            +   V        +  K               +  +  +   +   + S   +   ++N
Sbjct: 122 WNKYDVRQKGDDFELTPKSASGNLKQFAINVTTNGTIKQFTATEQDGQRSTYVLKN-QQN 180

Query: 186 TVLDPKVF 193
             +D   F
Sbjct: 181 GAVDAAQF 188


>gi|240851532|ref|ZP_04752283.1| outer-membrane lipoprotein carrier protein precursor
           [Actinobacillus minor 202]
 gi|240310050|gb|EER48342.1| outer-membrane lipoprotein carrier protein precursor
           [Actinobacillus minor 202]
          Length = 220

 Score = 56.5 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 51/130 (39%), Gaps = 18/130 (13%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---D 57
           M  ++ KS+ G+ +     + F           Q+V +       +      F Q     
Sbjct: 8   MKQIMKKSLFGLALFSLAGSAF--------ADAQAVAELQNRLDKVSQYSADFDQTVRSS 59

Query: 58  AGYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRY 110
            G  ++   G+F + RP+ F     SP    ++SDG+N+  Y+  +   +V      +  
Sbjct: 60  KGKQIQSGQGKFQVKRPNLFRMDTKSPQENLIVSDGANLWFYDPFVSQVTVNTVQDAVNN 119

Query: 111 MAFSVIFSNN 120
             F ++ SNN
Sbjct: 120 TPFVLLTSNN 129


>gi|145627718|ref|ZP_01783519.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae 22.1-21]
 gi|145639903|ref|ZP_01795503.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae PittII]
 gi|144979493|gb|EDJ89152.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae 22.1-21]
 gi|145270994|gb|EDK10911.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae PittII]
 gi|309751082|gb|ADO81066.1| Outer membrane lipoprotein carrier protein [Haemophilus influenzae
           R2866]
          Length = 205

 Score = 56.5 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 30/203 (14%), Positives = 71/203 (34%), Gaps = 21/203 (10%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---DAGY---VMKGEFFM 68
           L F +      + + +    S  +       +  +   F+Q     +G       G+  +
Sbjct: 6   LKFAALTLLGLSNFALADAASELQMR--LAKVDVLSAEFVQTVTSGSGKNVQQGSGKLQI 63

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL----DTWSVYPLRYMAFSVIFSNNQHVI 124
            RP+ F  +  +P    +ISDG  +  Y+  +      W    +    F ++ S+++   
Sbjct: 64  KRPNLFRMETKTPQETQIISDGKTLWFYDPFVQQVTAQWVKDAVNNTPFVLLTSDDKTHW 123

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFD---RLSYRLLNWKIMDSSRRYSIIKILK 181
            +     +++    T   K     + I   FD     +  L N+   +   + ++  +  
Sbjct: 124 HQYTVTQQAD----TFVLKPTLSTSNIK-QFDIRVDANGILRNFSTTEKDGQTNLYVLRN 178

Query: 182 YKENTVLDPKVFEIPYDKIHNIN 204
              N  L   +F+   +K   ++
Sbjct: 179 I-TNQALSDSLFQFKSEKGVEVD 200


>gi|319943869|ref|ZP_08018150.1| outer membrane lipoprotein carrier protein LolA [Lautropia
           mirabilis ATCC 51599]
 gi|319743102|gb|EFV95508.1| outer membrane lipoprotein carrier protein LolA [Lautropia
           mirabilis ATCC 51599]
          Length = 232

 Score = 56.5 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 29/183 (15%), Positives = 59/183 (32%), Gaps = 18/183 (9%)

Query: 26  AAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-------DAGYVMKGEFFMARPSKFYFKY 78
           +     + Q + +            GTF+Q               G F  ARP  F ++ 
Sbjct: 41  SRMTAAQGQGIAQLRRFATRTPAATGTFVQTQLAGGGRGGAARSSGSFAFARPGNFRWEI 100

Query: 79  SSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESIQRVESN 134
             P    +++DG  +  Y+  L   +V      ++    +V+F          +  V   
Sbjct: 101 DKPDPQLIVTDGKKLYFYDEGLRQVTVREASEAIQATPAAVLFGVGDLDEAFKLSEVGQY 160

Query: 135 NSFI---TIFFKDDFMGNMISV-TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
           N       +    D   + I +   D L   +    ++D+  + +  +  K   N  +  
Sbjct: 161 NGVAWVEAVPRSADSGFDRIRIGMRDGLPVVME---VVDAFGQINRFEFSKLATNERIPA 217

Query: 191 KVF 193
           + F
Sbjct: 218 ERF 220


>gi|117920495|ref|YP_869687.1| outer membrane lipoprotein carrier protein LolA [Shewanella sp.
           ANA-3]
 gi|166230501|sp|A0KWW2|LOLA_SHESA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|117612827|gb|ABK48281.1| outer membrane lipoprotein carrier protein LolA [Shewanella sp.
           ANA-3]
          Length = 206

 Score = 56.5 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/190 (14%), Positives = 72/190 (37%), Gaps = 14/190 (7%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFM 68
           L     + P   +  +  D + K+  E     ++++  F Q              G F +
Sbjct: 4   LLCAVLLSPLLYSNAVLADDA-KQLRETLNGTESLKADFKQTVTDINKKVIQTGAGVFAL 62

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVI 124
           A P++FY+  ++P    +++DG ++ +YN   +   +      +     +++   +    
Sbjct: 63  AHPNQFYWHLTAPDESQIVADGKDLWIYNPFAEEVVIMDFAEAINASPIALLVHRDDATW 122

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
            +     + +   I     D  + + ++V F++ +  L  + ++D     S   +     
Sbjct: 123 SQYSVAKKQDCYEIKPKATDAGI-SSVNVCFNKGT--LNKFNVLDDKGNQSQFDLSNQHS 179

Query: 185 NTVLDPKVFE 194
            +  D  +F+
Sbjct: 180 ISAADKALFK 189


>gi|16273485|ref|NP_439736.1| outer-membrane lipoprotein carrier protein [Haemophilus influenzae
           Rd KW20]
 gi|260580370|ref|ZP_05848199.1| outer membrane lipoprotein carrier protein LolA [Haemophilus
           influenzae RdAW]
 gi|1170807|sp|P45263|LOLA_HAEIN RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|1574436|gb|AAC23239.1| outer membrane lipoproteins carrier protein (lolA) [Haemophilus
           influenzae Rd KW20]
 gi|260093047|gb|EEW76981.1| outer membrane lipoprotein carrier protein LolA [Haemophilus
           influenzae RdAW]
          Length = 205

 Score = 56.1 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 32/203 (15%), Positives = 70/203 (34%), Gaps = 21/203 (10%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---DAGY---VMKGEFFM 68
           L F +      +   +    S  +       +  +   F+Q     +G       G+  +
Sbjct: 6   LKFAALTLLGLSNLALADAASELQMR--LAKVDVLSAEFVQTVTSGSGKNVQQGSGKLQI 63

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL----DTWSVYPLRYMAFSVIFSNNQHVI 124
            RP+ F  +  +P    +ISDG  +  Y+  +      W    +    F ++ SN++   
Sbjct: 64  KRPNLFRMETKTPQETQIISDGKTLWFYDPFVQQVTAQWVKNAVNNTPFVLLTSNDKSHW 123

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFD---RLSYRLLNWKIMDSSRRYSIIKILK 181
            +     +S+    T   K     + I   FD     +  L N+   +   + ++  +  
Sbjct: 124 HQYTVTQQSD----TFVLKPTLSTSNIK-QFDIRVDANGILRNFSTTEKDGQTNLYVLRN 178

Query: 182 YKENTVLDPKVFEIPYDKIHNIN 204
              N  L   +F+   +K   ++
Sbjct: 179 I-TNQTLSDSLFQFKPEKGVEVD 200


>gi|163801974|ref|ZP_02195870.1| outer-membrane lipoprotein carrier protein precursor [Vibrio sp.
           AND4]
 gi|159174115|gb|EDP58923.1| outer-membrane lipoprotein carrier protein precursor [Vibrio sp.
           AND4]
          Length = 208

 Score = 56.1 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 37/209 (17%), Positives = 72/209 (34%), Gaps = 20/209 (9%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---ED 57
           M  L    +   ++L F S     +AA P  +        + F         F Q     
Sbjct: 1   MKKLFSVKLFSALVLSF-SLFSTAHAASPKDEFNKRLSMNDGFS------ADFSQQVISP 53

Query: 58  AGYVM---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRY 110
            G  +   KG   +ARPS F +  + P    L+S+G  +  Y+  ++  S+Y        
Sbjct: 54  EGETVMEGKGTVEIARPSLFRWSTTLPDENLLVSNGKTLWYYSPFIEQVSIYWQEQATEQ 113

Query: 111 MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
             F V+ + N+    ++ +  +  + F  I    D       ++ D     +  + +++ 
Sbjct: 114 TPF-VLLTRNRASDWDNYKISQKGDQFTLIPTALDSTQGQFQISIDAKGV-VKGFNVVEQ 171

Query: 171 SRRYSIIKILKYKENTVLDPK-VFEIPYD 198
             +  +      K       +  F IP  
Sbjct: 172 DGQKGLFTFNNVKLGKPKADRFTFTIPDG 200


>gi|319790157|ref|YP_004151790.1| outer membrane lipoprotein carrier protein LolA [Thermovibrio
           ammonificans HB-1]
 gi|317114659|gb|ADU97149.1| outer membrane lipoprotein carrier protein LolA [Thermovibrio
           ammonificans HB-1]
          Length = 196

 Score = 56.1 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 36/206 (17%), Positives = 75/206 (36%), Gaps = 27/206 (13%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-------ED 57
           + KS I + +L    A     +  P+ +              ++++  F Q        D
Sbjct: 1   MRKSTIALTLLITIPAA-AHPSETPLKE----------LSGAESLKIEFRQKTKLPVAGD 49

Query: 58  AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AF 113
              + +G  +  RP KF ++Y+  S++ +IS+G  +           V PL         
Sbjct: 50  EVTLYRGVIYYKRPLKFLWEYTRGSNLRIISNGKEVETRFGD-GQCQVEPLNPENALFPL 108

Query: 114 SVIFSNNQHVIQ--ESIQRVESNNSFITIFFKDDFM-GNMISVTFDRLSYRLLNWKIMDS 170
            ++ + N    +   +++  +   +  T   +  F       +TF     +L   K + +
Sbjct: 109 -LLLAENYKTFKKYYTVKEEKEGKNLQTFTVEPKFKDPFFTKITFTFFKGKLKEVKTVQA 167

Query: 171 SRRYSIIKILKYKENTVLDPKVFEIP 196
               S   I   K+N  L   +F++P
Sbjct: 168 DGTESTYLIDSVKKNPKLPDSLFKLP 193


>gi|307245313|ref|ZP_07527401.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306853654|gb|EFM85871.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 213

 Score = 56.1 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 37/218 (16%), Positives = 77/218 (35%), Gaps = 29/218 (13%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---D 57
           M  L+ +S++G  ++    A F           QSV +       +      F Q     
Sbjct: 1   MKKLIKQSLLGFALVSMTGAAF--------ADAQSVAELQRRLEQVSQYSADFDQTVRSS 52

Query: 58  AGYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRY 110
            G  ++   G+F + RP+ F     SP    ++SDG+N+  Y+  +   +V      +  
Sbjct: 53  KGKQIQSGKGKFQVKRPNLFRMDTKSPQENLIVSDGANLWFYDPFVSQVTVNTVQDAVNN 112

Query: 111 MAFSVIF-SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFD---RLSYRLLNWK 166
             F ++  S+  H  Q  + +        T   K     + +   FD     S  L  + 
Sbjct: 113 TPFVLLTSSDKSHWDQYDVTQNAD-----TFVLKPKSKKSNLK-QFDVRIDQSGMLKGFS 166

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
            ++   + ++  +        +   +F+    K   ++
Sbjct: 167 TIERDGQSNLYVLRNI-TGGGVSSDLFKFSVPKGTELD 203


>gi|253688107|ref|YP_003017297.1| outer membrane lipoprotein carrier protein LolA [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|259491788|sp|C6DF52|LOLA_PECCP RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|251754685|gb|ACT12761.1| outer membrane lipoprotein carrier protein LolA [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 203

 Score = 56.1 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 27/188 (14%), Positives = 55/188 (29%), Gaps = 13/188 (6%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVM---KGEFFMA 69
           +   +              + K        + +    F Q      G  +   +GE ++ 
Sbjct: 4   WLAISCLIAGMTSTAVYADAAKDLQGRLNKVNSFHANFSQKVTSADGAAVQEGEGELWLK 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQ 125
           RP+ F +K +SP   +LISDG  +  YN  ++  +   L           I         
Sbjct: 64  RPNLFNWKTTSPDESTLISDGKTLWFYNPFVEQVTATWLKDATGNTP--FILITRNDASD 121

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
            +   V        +  K               +  +  +   +   + S   +   ++N
Sbjct: 122 WNKYDVRQKGDDFELTPKSASGNLKQFAINVTTNGTIKQFTATEQDGQRSTYVLKN-QQN 180

Query: 186 TVLDPKVF 193
             +D   F
Sbjct: 181 AAVDAAQF 188


>gi|145637469|ref|ZP_01793127.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae PittHH]
 gi|145269275|gb|EDK09220.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae PittHH]
          Length = 205

 Score = 56.1 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 32/203 (15%), Positives = 69/203 (33%), Gaps = 21/203 (10%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---DAGY---VMKGEFFM 68
           L F +      +   +    S  +       +  +   F+Q     +G       G+  +
Sbjct: 6   LKFAALTLLGLSNLALADAASELQMR--LAKVDVLSAEFVQTVTSGSGKNVQQGSGKLQI 63

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL----DTWSVYPLRYMAFSVIFS-NNQHV 123
            RP+ F  +  +P    +ISDG  +  Y+  +      W    +    F ++ S +N H 
Sbjct: 64  KRPNLFRMETKTPQETQIISDGKTLWFYDPFVQQVTAQWVKDAVNNTPFVLLTSNDNSHW 123

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYR--LLNWKIMDSSRRYSIIKILK 181
            Q ++ +        T   K     + I     R+     L N+   +   + ++  +  
Sbjct: 124 HQYTVTQQAD-----TFVLKPTLSTSNIKQFDIRVDVNGILRNFSTTEKDGQTNLYVLRN 178

Query: 182 YKENTVLDPKVFEIPYDKIHNIN 204
              N  L   +F+   +K   ++
Sbjct: 179 I-TNQTLSDSLFQFKPEKGIEVD 200


>gi|68249822|ref|YP_248934.1| outer-membrane lipoprotein carrier protein [Haemophilus influenzae
           86-028NP]
 gi|145635700|ref|ZP_01791395.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae PittAA]
 gi|148826112|ref|YP_001290865.1| outer-membrane lipoprotein carrier protein [Haemophilus influenzae