BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780798|ref|YP_003065211.1| possible lolA type protein
[Candidatus Liberibacter asiaticus str. psy62]
         (204 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|226940195|ref|YP_002795268.1| NadE [Laribacter hongkongensis HLHK9]
 gi|226715121|gb|ACO74259.1| NadE [Laribacter hongkongensis HLHK9]
          Length = 739

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 32/177 (18%), Positives = 67/177 (37%), Gaps = 7/177 (3%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQEDAG---YVMKGEFFMARPSKFYFKYSSPSSVSL 86
             +  ++    +     ++M+  F Q  +G       G   ++RP KF + YS P    +
Sbjct: 556 AAQADAIASLKQFVGQTRSMKAEFTQVVSGRQTQTASGSLELSRPGKFRWTYSQPYPQLI 615

Query: 87  ISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQESIQRVESNNSFITIFF 142
           + DG  + VY++ L   +   L         +++  +N+      ++ +   N F  +  
Sbjct: 616 VGDGQRLWVYDSDLAQVTSKKLDDALGSSPAALLAGSNEIERDYRLKNLGMQNGFDWLEA 675

Query: 143 KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                G+  SV        L    + DS  + + +   + ++N  +DP  F     K
Sbjct: 676 TPKKEGSFNSVRMGFKGSELAGMVLTDSFGQTTTLTFSQVQKNPKIDPDRFRFTPPK 732


>gi|92115723|ref|YP_575452.1| outer membrane lipoprotein carrier protein LolA [Nitrobacter
           hamburgensis X14]
 gi|91798617|gb|ABE60992.1| outer membrane lipoprotein carrier protein LolA [Nitrobacter
           hamburgensis X14]
          Length = 339

 Score =  114 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 40/187 (21%), Positives = 82/187 (43%), Gaps = 5/187 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSP 81
              A +   +  +  +   +  S++T+ G F+Q    G    GEF++ +P K  F+Y  P
Sbjct: 152 NIFATFSADQKAAAARVSAYLSSLRTLAGNFVQVGPDGSRSTGEFYIQKPGKVRFEYDPP 211

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIF 141
           S +++ISDGS++ V + KL T  +YPL       + S+   +++++     +++      
Sbjct: 212 SPIAMISDGSSLVVRDTKLATQDIYPLSQTPLRYLLSDRIDLMKDTNVVSVTSDDLYISV 271

Query: 142 FKDDFM----GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
             ++       + + +       +L  W + D     + + I        LDP +F+I Y
Sbjct: 272 TIEEKQALIGTSRLMLMVGAKDGKLKQWTVTDPQGYDTTVAIYNLNTTAKLDPALFKIDY 331

Query: 198 DKIHNIN 204
            +    N
Sbjct: 332 TRYPTSN 338


>gi|163757410|ref|ZP_02164499.1| hypothetical protein HPDFL43_18407 [Hoeflea phototrophica DFL-43]
 gi|162284912|gb|EDQ35194.1| hypothetical protein HPDFL43_18407 [Hoeflea phototrophica DFL-43]
          Length = 233

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 54/182 (29%), Positives = 90/182 (49%), Gaps = 3/182 (1%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSP 81
                       + ++  +HF S++TM G F+Q    G    G+FF+ RP K  F Y +P
Sbjct: 45  LLAFPGGARGADAAQRVADHFASVKTMTGEFIQFGPNGEQTGGKFFIDRPGKLRFNYEAP 104

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIF 141
           SSV +I+DG  + + N KL TW +YPL      ++ ++   +  + ++ V  +   ITI 
Sbjct: 105 SSVRVIADGKAVVIGNRKLRTWDLYPLNKTPLKLLLADRIDLSADMVRSVTEDPDLITIV 164

Query: 142 --FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
              K  F  + IS+ FD  S+ L  W I D+  + + + I   +        VF++PYD+
Sbjct: 165 LGNKTIFGDSTISLMFDPKSFELRQWTIRDAQGKDTSVMIFNVRTGVTFASNVFKVPYDQ 224

Query: 200 IH 201
           +H
Sbjct: 225 VH 226


>gi|227823662|ref|YP_002827635.1| putative outer membrane lipoproteins carrier protein [Sinorhizobium
           fredii NGR234]
 gi|227342664|gb|ACP26882.1| putative outer membrane lipoproteins carrier protein [Sinorhizobium
           fredii NGR234]
          Length = 220

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 55/168 (32%), Positives = 88/168 (52%), Gaps = 3/168 (1%)

Query: 38  KAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY 96
           K  +HF S++TM G F+Q    G    G+F++ RP +  F Y +PS + +I+DG ++ + 
Sbjct: 49  KIADHFSSVKTMAGEFVQFGPRGEQTGGKFYIRRPGRIRFNYEAPSPMRVIADGRSVVIG 108

Query: 97  NAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGN--MISVT 154
           N KL TW +YPL     +++ S    +    ++ V      ITI   D  +     I++ 
Sbjct: 109 NMKLKTWDIYPLSKTPLNLLLSERIDLSSRMVRDVRVEPDLITIVLGDRSIFGDSTITMM 168

Query: 155 FDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
           FD  SY L  W I D+ ++ + + I   +    LD KVF IPYD++ N
Sbjct: 169 FDPKSYNLRQWTITDAQKKDTSVMIFNVQTGIALDDKVFRIPYDEVRN 216


>gi|85714110|ref|ZP_01045099.1| Outer membrane lipoprotein carrier protein LolA [Nitrobacter sp.
           Nb-311A]
 gi|85699236|gb|EAQ37104.1| Outer membrane lipoprotein carrier protein LolA [Nitrobacter sp.
           Nb-311A]
          Length = 413

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 40/182 (21%), Positives = 81/182 (44%), Gaps = 5/182 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSP 81
            F A +   +  +  +   +  S++T+ G F+Q    G    GEF++ +P K  F+Y  P
Sbjct: 225 NFFATFSADQKAAAARVSAYLSSLRTLAGNFVQVGPDGSRSTGEFYIQKPGKVRFEYDPP 284

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIF 141
           S +++ISDGS++ V + +L T  VYPL       + S+   +++++     +++      
Sbjct: 285 SPIAMISDGSSLVVRDTRLATQDVYPLSQTPLRYLLSDRLDLMKDTNVVAVTSDDLYISV 344

Query: 142 FKDDFM----GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
             ++       + + +       +L  W + D     + + I        LDP +F+I Y
Sbjct: 345 IIEEKQALVGTSRLMLMVGVKDGKLKQWTVTDPQGYDTTVAIYNLNSTAKLDPALFKIDY 404

Query: 198 DK 199
             
Sbjct: 405 TN 406


>gi|299133178|ref|ZP_07026373.1| outer membrane lipoprotein carrier protein LolA [Afipia sp. 1NLS2]
 gi|298593315|gb|EFI53515.1| outer membrane lipoprotein carrier protein LolA [Afipia sp. 1NLS2]
          Length = 285

 Score =  113 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/182 (20%), Positives = 78/182 (42%), Gaps = 5/182 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSP 81
           P   A+   +     K   +  S+Q + G F+Q    G    G F++ +P K  F+Y  P
Sbjct: 98  PKLQAFDANQRALADKVSAYLSSLQNLSGNFVQVGPDGSRTTGNFYLQKPGKIRFEYDDP 157

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIF 141
           S ++L++DG+++ V + +L T  VYPL       + ++   +++++     S +      
Sbjct: 158 SPIALVADGTSVIVRDRRLATQDVYPLSQTPLRYLLASKLDLLRDTNVTSISADDLYISI 217

Query: 142 FKDDFM----GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
             ++       + +++       +L  W + D     + + +        LDP +F+I Y
Sbjct: 218 TIEEKQAVTGTSRLTLMVGAKDGKLKQWTVTDPQGYDTTVAVYNLDTTKKLDPALFKIDY 277

Query: 198 DK 199
             
Sbjct: 278 TN 279


>gi|154245784|ref|YP_001416742.1| outer membrane lipoprotein carrier protein LolA [Xanthobacter
           autotrophicus Py2]
 gi|154159869|gb|ABS67085.1| outer membrane lipoprotein carrier protein LolA [Xanthobacter
           autotrophicus Py2]
          Length = 312

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/183 (21%), Positives = 76/183 (41%), Gaps = 5/183 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSP 81
                       +V +   ++ S+Q++ G F Q D  G    G+ +M +P +  F+Y +P
Sbjct: 128 AAANPDGRAPRATVDRVTNYYNSVQSLTGNFTQIDPDGTRRTGDVYMQKPGRVRFEYDAP 187

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSF---- 137
           S V LI++G ++AV + KL+T  + PL       + +    +  +        +      
Sbjct: 188 SPVELIANGQSVAVRDRKLNTQDITPLSQTPLRFLLAERIDLATDQHVAGVFQDDKFISV 247

Query: 138 ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
           I            + + FD  +  L  W I D     + + +   + N   DPK+F I +
Sbjct: 248 IIQEQVPMMGTYRLLILFDAKTSALKQWIITDPQGYDTQVTLSNVQVNKKPDPKLFVINF 307

Query: 198 DKI 200
           +++
Sbjct: 308 ERM 310


>gi|254780798|ref|YP_003065211.1| possible lolA type protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040475|gb|ACT57271.1| possible lolA type protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 204

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 204/204 (100%), Positives = 204/204 (100%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY 60
           MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY
Sbjct: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY 60

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
           VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN
Sbjct: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
           QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL
Sbjct: 121 QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180

Query: 181 KYKENTVLDPKVFEIPYDKIHNIN 204
           KYKENTVLDPKVFEIPYDKIHNIN
Sbjct: 181 KYKENTVLDPKVFEIPYDKIHNIN 204


>gi|71906931|ref|YP_284518.1| Outer membrane lipoprotein carrier protein LolA [Dechloromonas
           aromatica RCB]
 gi|123746928|sp|Q47GI3|LOLA_DECAR RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|71846552|gb|AAZ46048.1| Outer membrane lipoprotein carrier protein LolA [Dechloromonas
           aromatica RCB]
          Length = 208

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 64/205 (31%), Gaps = 16/205 (7%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED------A 58
           +  +++  ++     A+ P      +    +V +  +   + +T++  F Q         
Sbjct: 1   MRMNIVQKILSATCFALLPL-----LAHAGAVDQLHDFLKNTRTLKAEFSQAVISRNGRK 55

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----F 113
                G   ++RP K  ++   P    ++ DG  I +++ +L   +V             
Sbjct: 56  PQQSSGTIAISRPGKLRWEIVKPFPQLVVGDGEKIWIHDPELQQVTVRKAGQAIGSSPAA 115

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
            +  +N+           E+                   V        L   ++ DS  +
Sbjct: 116 LLSGNNDLEKNFTLKDAGEAEGMAWVDATPKAGDSGFEKVRLGFSGGDLRAMELFDSFGQ 175

Query: 174 YSIIKILKYKENTVLDPKVFEIPYD 198
            + I+  K + N  L    F+    
Sbjct: 176 TTQIRFSKIERNPALPAATFKFTPP 200


>gi|163734297|ref|ZP_02141737.1| outer membrane lipoprotein carrier protein, putative [Roseobacter
           litoralis Och 149]
 gi|161392305|gb|EDQ16634.1| outer membrane lipoprotein carrier protein, putative [Roseobacter
           litoralis Och 149]
          Length = 200

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 39/197 (19%), Positives = 85/197 (43%), Gaps = 7/197 (3%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEF 66
           S+I  ++L    ++ P  AA    +   + +   +  S++T++G F Q  D G V  G+ 
Sbjct: 2   SLISRILLVACLSLVP--AASGAAEQLKLAEISAYLNSLETLKGDFRQINDDGSVSTGQL 59

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL-RYMAFSVIFSNNQHVIQ 125
           +M RP +  F+Y  P    +I+  S + + + K +  S          S++   +  + +
Sbjct: 60  YMRRPGRMRFEYDPPEQALVIAAASAVVIIDRKSNQPSETYPLSRTPLSLLLGRDIDLTR 119

Query: 126 ESIQR---VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
            ++ R    +   + +T    D+     + + F     RL  W I D+S   + + + ++
Sbjct: 120 AAMVRNARFDGTWTIVTAEDPDNLENGYLEMYFTDQPTRLEQWVIHDASGGRTRVVLGEF 179

Query: 183 KENTVLDPKVFEIPYDK 199
           +    L   +F+   +K
Sbjct: 180 ETGINLPNSLFDPDREK 196


>gi|15966945|ref|NP_387298.1| hypothetical protein SMc03809 [Sinorhizobium meliloti 1021]
 gi|307301718|ref|ZP_07581477.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium
           meliloti BL225C]
 gi|307316258|ref|ZP_07595702.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium
           meliloti AK83]
 gi|15076218|emb|CAC47771.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306898098|gb|EFN28840.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium
           meliloti AK83]
 gi|306903416|gb|EFN34005.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium
           meliloti BL225C]
          Length = 220

 Score =  111 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 54/168 (32%), Positives = 88/168 (52%), Gaps = 3/168 (1%)

Query: 38  KAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY 96
           +  +HF S++TM G F+Q    G    G+F++ RP +  F Y +PS + +I+DG ++ + 
Sbjct: 48  RIADHFSSVKTMAGEFVQFGPRGEQTGGKFYIRRPGRIRFNYEAPSPMRVIADGKSVVIG 107

Query: 97  NAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGN--MISVT 154
           N KL TW +YPL     +++ S    +    ++ V      ITI   D  +     I++ 
Sbjct: 108 NMKLKTWDIYPLSKTPLNLLLSERIDLRSRMVRDVRVEADLITIVLGDRSIFGDSTITMM 167

Query: 155 FDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
           FD  SY L  W I D+ ++ + + I   +    LD KVF IPYD++ N
Sbjct: 168 FDPKSYNLRQWTITDAQKKDTSVMIFNVRTGIALDDKVFRIPYDEVRN 215


>gi|149915476|ref|ZP_01904003.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseobacter sp. AzwK-3b]
 gi|149810765|gb|EDM70606.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseobacter sp. AzwK-3b]
          Length = 202

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 40/192 (20%), Positives = 74/192 (38%), Gaps = 5/192 (2%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFM 68
           +  + +    A+    A     +  S+     +   +QT QG F Q  D G +  G  ++
Sbjct: 1   MKALAILTSIALSVAMALPAAAEKLSLGAISGYLNGLQTAQGAFTQINDDGTISTGRIYI 60

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQES 127
            RP +  F+Y  P    +++DG  + + + K +T    YPL      +I + N  + +E 
Sbjct: 61  KRPGRVRFEYDPPDQTLVVADGDTVGIVDPKSNTGPEAYPLHRTPLKIILARNVDLTRER 120

Query: 128 IQRVESNNSF---ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           +    +++     I     D+     I + F      L  W I DS    + + +   + 
Sbjct: 121 MVTGHASDGTSTTIRAQDPDNPEYGSIDLVFTADPIELRQWVINDSGGGRTTVVLGDLRT 180

Query: 185 NTVLDPKVFEIP 196
              L    F IP
Sbjct: 181 GMQLANDRFVIP 192


>gi|83855249|ref|ZP_00948779.1| outer membrane lipoprotein carrier protein LolA, putative
           [Sulfitobacter sp. NAS-14.1]
 gi|83843092|gb|EAP82259.1| outer membrane lipoprotein carrier protein LolA, putative
           [Sulfitobacter sp. NAS-14.1]
          Length = 201

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/203 (17%), Positives = 75/203 (36%), Gaps = 8/203 (3%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMK 63
           + + V   V+                     +     +   ++T +G F Q  D G +  
Sbjct: 1   MMRFVTTTVLAIGLGL---AAVMPAAADKLPLNAISGYLNDLKTAKGEFTQINDDGSIST 57

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW-SVYPLRYMAFSVIFSNNQH 122
           G  ++ RP K  F+Y++P S  +++  + + +Y+ K +     YPL     S+I + N +
Sbjct: 58  GTIYIKRPGKVRFEYNAPDSGIVVAGSNTVVIYDKKSNQPAETYPLSKTPLSIILAANVN 117

Query: 123 VIQESIQRVESNNSF---ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
           + Q  +    + +     +            I + F      L  W I D +   + + +
Sbjct: 118 LGQAKMVTGHNYDGTATTVRAQDPAHPEYGNIELKFTGNPVELRQWIINDGNGTKTTVVL 177

Query: 180 LKYKENTVLDPKVFEIPYDKIHN 202
              ++   L  K+F++      N
Sbjct: 178 GDLQKGGSLPNKLFDVGSPGQVN 200


>gi|53804159|ref|YP_114221.1| outer membrane lipoprotein carrier protein LolA [Methylococcus
           capsulatus str. Bath]
 gi|81681833|sp|Q607H7|LOLA_METCA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|53757920|gb|AAU92211.1| outer membrane lipoprotein carrier protein LolA [Methylococcus
           capsulatus str. Bath]
          Length = 208

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/194 (15%), Positives = 59/194 (30%), Gaps = 11/194 (5%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------VMKGEFFMA 69
           +               +     +      S +T+Q  F Q              G F++ 
Sbjct: 6   YLIVLPLLCWGFASQAETTPQSRLKSFLDSARTLQADFTQVRLDESGRPRQESGGSFYLQ 65

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQ 125
           RP KF + Y+ P    ++S G  +  Y+  L+  +   L          ++         
Sbjct: 66  RPGKFRWDYTKPYRQQIVSSGGKVWFYDVDLEQVTAKRLGQAVGSTPALLLSGEMALEDN 125

Query: 126 ESIQRVESNNSFITIF-FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
            +I+   +      I        G    V       +L   ++ D+  + + I     + 
Sbjct: 126 FTIEDQGTEEGMYWIKLVPKSEEGGFRYVLIGLEGDKLAGMELSDNFGQLTRIYFANLRT 185

Query: 185 NTVLDPKVFEIPYD 198
              LDPK+F+    
Sbjct: 186 GITLDPKLFQFSPP 199


>gi|253998903|ref|YP_003050966.1| outer membrane lipoprotein carrier protein LolA [Methylovorus sp.
           SIP3-4]
 gi|253985582|gb|ACT50439.1| outer membrane lipoprotein carrier protein LolA [Methylovorus sp.
           SIP3-4]
          Length = 209

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/201 (14%), Positives = 67/201 (33%), Gaps = 14/201 (6%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            +S +  ++L F SA      A  + +    ++    + +   ++  F Q  +       
Sbjct: 1   MRSFLNTLLLAFSSASML---APALAQADGPERLKAFYQNTVGLKAQFKQTVSDAQGRKV 57

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FS 114
             + G+  + RP KF + Y  P    ++ DG  + +Y+ +L+  +V  L           
Sbjct: 58  QEVTGDMQLQRPGKFRWDYQKPYVQQIVGDGQKVWLYDPELNQVTVRSLSKAIGSSPAAM 117

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +  S                          +       +       +L   +++DS    
Sbjct: 118 LAGSKEMEKSFALQDGGNQGGLEWVKATPREKESGFEQIMIGFKGDQLAQMELLDSFGHR 177

Query: 175 SIIKILKYKENTVLDPKVFEI 195
           ++I+  + + N  L  + F  
Sbjct: 178 TLIEFSQIERNPTLAAQAFRF 198


>gi|74317515|ref|YP_315255.1| outer membrane lipoprotein carrier protein LolA [Thiobacillus
           denitrificans ATCC 25259]
 gi|123731796|sp|Q3SIS5|LOLA_THIDA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|74057010|gb|AAZ97450.1| outer membrane lipoprotein carrier protein LolA [Thiobacillus
           denitrificans ATCC 25259]
          Length = 202

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 31/192 (16%), Positives = 61/192 (31%), Gaps = 11/192 (5%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPS 72
             +              V++        +T +  F Q  A           G+   ARP 
Sbjct: 4   LFLLFALVLTHAAHAGGVERLKAFIAGAKTAEADFTQTVADRNNRVTQEASGKMAFARPG 63

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS-----VIFSNNQHVIQES 127
           KF + Y +P    ++ DG+ + +Y+A LD  +V PL  +        +   +        
Sbjct: 64  KFRWDYRAPYEQVIVGDGAKLWLYDADLDQVTVKPLGEVIAGTPAALLAGDDAIEKYFSL 123

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
               ES               +   +        L+  ++ D+  + + +K+  +  N  
Sbjct: 124 KNAGESGGLEWLEATPKSRDTSFERIRMGFKGDVLVQMELFDTFGQRTTLKLSNFARNPR 183

Query: 188 LDPKVFEIPYDK 199
           + P  F     K
Sbjct: 184 IAPSRFVFTPPK 195


>gi|257093875|ref|YP_003167516.1| outer membrane lipoprotein carrier protein LolA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257046399|gb|ACV35587.1| outer membrane lipoprotein carrier protein LolA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 204

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 27/206 (13%), Positives = 68/206 (33%), Gaps = 21/206 (10%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED------ 57
           ++ +++   + L                   ++ K  +   S +TM+  F Q        
Sbjct: 1   MMRRTLFAAICLLI----------TQTVSAGAIDKLHQFLESTRTMRAEFAQSVAARNGR 50

Query: 58  AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAF 113
              +  G    ARP KF ++   P +  L+ DG  + +++  L   +V  +         
Sbjct: 51  KPQLSSGVMMFARPGKFRWEIEKPYAQLLVGDGERVWIHDPDLRQVTVRKVGSALGGTPA 110

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDRLSYRLLNWKIMDSSR 172
           +++   +      +++     +    +             V+       L   +++DS  
Sbjct: 111 ALLAGESTIEKNFTLREAGDKDGLEWVEATPRSPDSGFEKVSLGFAGSDLRAMELLDSLG 170

Query: 173 RYSIIKILKYKENTVLDPKVFEIPYD 198
           + + ++    + N  L P +F     
Sbjct: 171 QTTSLRFAHLERNPRLAPSLFRFTPP 196


>gi|83941771|ref|ZP_00954233.1| outer membrane lipoprotein carrier protein LolA, putative
           [Sulfitobacter sp. EE-36]
 gi|83847591|gb|EAP85466.1| outer membrane lipoprotein carrier protein LolA, putative
           [Sulfitobacter sp. EE-36]
          Length = 200

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 33/192 (17%), Positives = 71/192 (36%), Gaps = 5/192 (2%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKF 74
                +              +     +   ++T +G F Q  D G +  G  ++ RP K 
Sbjct: 8   VLAIGLGLAAVMPAAADKLPLNAISGYLNDLKTAKGEFTQINDDGSISTGTIYIKRPGKV 67

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTW-SVYPLRYMAFSVIFSNNQHVIQESIQRVES 133
            F+Y++P S  +++  + + +Y+ K +     YPL     S+I + N ++ Q  +    +
Sbjct: 68  RFEYNAPDSGIVVAGSNTVVIYDKKSNQPAETYPLSKTPLSIILAANVNLGQAKMVTGHN 127

Query: 134 NNSF---ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
            +     +            I + F      L  W I D +   + + +   ++   L  
Sbjct: 128 YDGTATTVRAQDPAHPEYGNIELKFTGNPVELRQWIINDGNGTKTTVVLGDLQKGGSLPN 187

Query: 191 KVFEIPYDKIHN 202
           K+F++      N
Sbjct: 188 KLFDVGSPGQVN 199


>gi|150398247|ref|YP_001328714.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium
           medicae WSM419]
 gi|150029762|gb|ABR61879.1| outer membrane lipoprotein carrier protein LolA [Sinorhizobium
           medicae WSM419]
          Length = 220

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 55/168 (32%), Positives = 90/168 (53%), Gaps = 3/168 (1%)

Query: 38  KAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY 96
           +  +HF S++TM G F+Q    G    G+F++ RP +  F Y +PS + +I+DG ++ + 
Sbjct: 48  RIADHFSSVKTMAGEFVQFGPRGEQTGGKFYIRRPGRIRFNYEAPSPMRVIADGKSVVIG 107

Query: 97  NAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGN--MISVT 154
           N KL TW +YPL     +++ S    +  + ++ V+     ITI   D  +     I++ 
Sbjct: 108 NMKLKTWDIYPLSKTPLNLLLSERIDLSSKMVRDVKVEADLITIVLGDRSIFGDSTITMM 167

Query: 155 FDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
           FD  SY L  W I D+ R+ + + I   +    LD KVF IPYD++ N
Sbjct: 168 FDPKSYNLRQWTITDAQRKDTSVMIFNVRTGIALDDKVFRIPYDEVRN 215


>gi|313201002|ref|YP_004039660.1| outer membrane lipoprotein carrier protein lola [Methylovorus sp.
           MP688]
 gi|312440318|gb|ADQ84424.1| outer membrane lipoprotein carrier protein LolA [Methylovorus sp.
           MP688]
          Length = 209

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 29/201 (14%), Positives = 67/201 (33%), Gaps = 14/201 (6%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            +S +  ++L F SA      A  + +    ++    + +   ++  F Q  +       
Sbjct: 1   MRSFLNTLLLAFSSASML---APTLAQADGPERLKAFYQNTVGLKAQFKQTVSDAQGRKV 57

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FS 114
             + G+  + RP KF + Y  P    ++ DG  + +Y+ +L+  +V  L           
Sbjct: 58  QEVTGDMQLQRPGKFRWDYQKPYVQQIVGDGQKVWLYDPELNQVTVRSLSKAIGSSPAAM 117

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +  S                          +       +       +L   +++DS    
Sbjct: 118 LAGSKEMEKSFALQDGGNQGGLEWVKATPREKESGFEQIMIGFKGDQLAQMELLDSFGHR 177

Query: 175 SIIKILKYKENTVLDPKVFEI 195
           ++I+  + + N  L  + F  
Sbjct: 178 TLIEFSQIERNPTLAAQAFRF 198


>gi|46201081|ref|ZP_00055780.2| COG2834: Outer membrane lipoprotein-sorting protein
           [Magnetospirillum magnetotacticum MS-1]
          Length = 209

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 39/200 (19%), Positives = 86/200 (43%), Gaps = 5/200 (2%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKG 64
             +V+  ++L    A  P            +++A ++   + T++  FLQ    G  ++G
Sbjct: 1   MAAVLCSLLLTTAQAAQPARLPLSAQDKADIERAEDYLNGVTTLKARFLQVSPNGASVEG 60

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
           + +++RP K   +Y  PS + +++DGS + V++ +L   S  PL      ++   N  + 
Sbjct: 61  DAYLSRPGKLRLQYDPPSPLLVVADGSFLIVHDQQLGEPSYIPLGSTPAGILVRPNVRLN 120

Query: 125 QESIQRVES----NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
              +             I++   +D     I++ F    + L  W++ D+  + + + + 
Sbjct: 121 GGDVAVTRVVRLPGVVRISVVEAEDPASGEITLVFSDKPFALRQWQVKDAQHQVTTVSLY 180

Query: 181 KYKENTVLDPKVFEIPYDKI 200
           + +    LD K+FE    K 
Sbjct: 181 QAQSGLTLDAKLFEFKNPKF 200


>gi|86359551|ref|YP_471443.1| putative outer membrane lipoproteins carrier protein [Rhizobium
           etli CFN 42]
 gi|86283653|gb|ABC92716.1| putative outer membrane lipoproteins carrier protein [Rhizobium
           etli CFN 42]
          Length = 222

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 54/203 (26%), Positives = 97/203 (47%), Gaps = 5/203 (2%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITK--DQSVKKAIEHFLSIQTMQGTFLQ-EDAGY 60
           +  + ++ V  +   ++  P +A          + +   +HF  + TMQG F+Q    G 
Sbjct: 13  MTRRDLLSVFTVAAMASAVPLSAIAQAAAPASGTAQAIADHFSGVTTMQGEFVQFGPRGE 72

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
              G+FF+ RP K  F Y  PS + +I+DG N+A+ N KL TW +YPL     S++ + +
Sbjct: 73  QTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNVAIGNTKLKTWDLYPLSKTPLSLLLAQH 132

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFMGNMISV--TFDRLSYRLLNWKIMDSSRRYSIIK 178
             +    ++ V+  +   TI   ++ +    ++   FD  +Y L  W I D+  + + + 
Sbjct: 133 IDLSAGMVKGVKEESDLTTIALGNNTVFGNSTITMMFDPKTYDLRQWTITDNQGKDTSVM 192

Query: 179 ILKYKENTVLDPKVFEIPYDKIH 201
           I   K     D +VF +PY+ I 
Sbjct: 193 IFNVKTGVQFDDRVFRVPYESIP 215


>gi|27375728|ref|NP_767257.1| hypothetical protein blr0617 [Bradyrhizobium japonicum USDA 110]
 gi|27348866|dbj|BAC45882.1| blr0617 [Bradyrhizobium japonicum USDA 110]
          Length = 251

 Score =  108 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 38/182 (20%), Positives = 78/182 (42%), Gaps = 5/182 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSP 81
                +   +     K   +  S+ T+ G F+Q    G   +G+F++ +P K  F+Y +P
Sbjct: 64  SIFQTFDANQKAQAAKVSAYLSSLSTLVGNFVQVGPDGSKTQGDFYIQKPGKVRFEYDAP 123

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIF 141
           S + +++DGS++ V + KL T  VYPL       + S+   +++++     S +      
Sbjct: 124 SPIDIVADGSSLVVRDRKLATQDVYPLSQTPLRFLLSDRIDLMKDTNVVNVSADDVFVSV 183

Query: 142 FKDDFM----GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
             ++       + + + F     +L  W + D     + I +        LDP +F+I +
Sbjct: 184 TIEEKQALVGTSRLLLMFGAKDGQLKQWTVTDPQGYDTTIAVYNLDATKKLDPGMFKIDF 243

Query: 198 DK 199
             
Sbjct: 244 TN 245


>gi|259417374|ref|ZP_05741293.1| outer membrane lipoprotein carrier protein LolA [Silicibacter sp.
           TrichCH4B]
 gi|259346280|gb|EEW58094.1| outer membrane lipoprotein carrier protein LolA [Silicibacter sp.
           TrichCH4B]
          Length = 198

 Score =  107 bits (267), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 35/198 (17%), Positives = 65/198 (32%), Gaps = 7/198 (3%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKG 64
            K     V      A    +      +  S+ +   +  S  T Q  F Q  D G +  G
Sbjct: 1   MKQ---FVFALALGATTLASTVATAAEKLSLNEISAYLNSFATAQADFTQVNDDGSLSTG 57

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
           + ++ RP K  F+Y++   + L   G+   +          YPL     S+I + N ++ 
Sbjct: 58  QLYLRRPGKVRFEYANNGGLVLAEAGTVAIMDPKSNQPPETYPLSRTPLSIILARNVNLG 117

Query: 125 QESIQRVESNNS---FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           + ++      +     +            I + F     +L  W I   S   + + +  
Sbjct: 118 RANMVVGHGFDGVSTIVRAHDPKAPENGSIEMMFTDNPVQLRKWVIHGGSGEETTVILGD 177

Query: 182 YKENTVLDPKVFEIPYDK 199
            K        +F I   K
Sbjct: 178 MKTGMSFPSSLFSISRPK 195


>gi|209883510|ref|YP_002287367.1| outer membrane lipoprotein carrier protein LolA [Oligotropha
           carboxidovorans OM5]
 gi|209871706|gb|ACI91502.1| outer membrane lipoprotein carrier protein LolA [Oligotropha
           carboxidovorans OM5]
          Length = 276

 Score =  107 bits (267), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 36/176 (20%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVS 85
           A+   +     K   +  S+Q + G F+Q    G    G F+M +P K  F+Y  PS ++
Sbjct: 93  AFDANQRALAAKVSAYLSSVQNLSGNFVQVGPDGSRTTGTFYMLKPGKIRFEYDDPSPIA 152

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD 145
           L++DG+++ V + +L T  VYPL       + +++  +++++     S +        ++
Sbjct: 153 LVADGTSVIVRDRRLATQDVYPLSQTPLRYLLASHIDLLKDTNVTGISADDLYISITIEE 212

Query: 146 FM----GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
                  + +++       +L  W + D     + + +     +   DP +F+I Y
Sbjct: 213 KQAVTGTSRLTLMVGAKDDKLKQWTVTDPQGYDTTVAVYNLDASKKPDPSLFKIDY 268


>gi|316931740|ref|YP_004106722.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris DX-1]
 gi|315599454|gb|ADU41989.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris DX-1]
          Length = 313

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/182 (21%), Positives = 78/182 (42%), Gaps = 5/182 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSP 81
                +   +     K   +  S+QT+ G F+Q    G  + G+F++ +P K  F+Y  P
Sbjct: 126 SIFTTFDSAQKAEAAKVSAYLSSLQTLVGQFVQVGPDGSKLTGDFYIVKPGKIRFEYDEP 185

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSF---- 137
           S VS+I+DG ++ V + KL T  VYPL       + S+   +++++     +++      
Sbjct: 186 SPVSMIADGQSVVVRDRKLATQDVYPLSQTPLRYLLSDRIDLLRDTNVVSITSDDLYSNI 245

Query: 138 ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
           I          + + + F     +L  W + D     + + +     +   DP +F+I Y
Sbjct: 246 IIEEKNAIIGTSRLLLMFGTKDGQLKQWTVTDPQGYDTTVAVYNLDTSRRPDPSMFKIDY 305

Query: 198 DK 199
             
Sbjct: 306 TN 307


>gi|119385396|ref|YP_916452.1| outer membrane lipoprotein carrier protein LolA [Paracoccus
           denitrificans PD1222]
 gi|119375163|gb|ABL70756.1| outer membrane lipoprotein carrier protein LolA [Paracoccus
           denitrificans PD1222]
          Length = 198

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/193 (15%), Positives = 69/193 (35%), Gaps = 4/193 (2%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFM 68
           + +  L     +    A   + +  S+ +   +  S++T +  F Q +  G +  G  ++
Sbjct: 1   MKLKTLALAPVLCLAMAFPALAEKISLNEISRYLNSLKTAKADFTQVNADGSISTGIVYI 60

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI 128
            RP +  F+Y    ++ + S G+              YPL     S+I + N  + +  +
Sbjct: 61  QRPQRVRFEYKGDRTLVMASAGNVAVFDGKTRGAPQQYPLSKTPLSLILAPNIDLSRARM 120

Query: 129 QR---VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
                 + N + +T           I + F     +L  W + D + + + + +   +  
Sbjct: 121 VTGYTEKKNTTVVTAQDPQHPEYGNIQMVFTANPTQLRQWVVTDDTGKRTTVILGDMQTG 180

Query: 186 TVLDPKVFEIPYD 198
                  F I  +
Sbjct: 181 MSFPASTFAIQNE 193


>gi|254449700|ref|ZP_05063137.1| twin-arginine translocation pathway signal [Octadecabacter
           antarcticus 238]
 gi|198264106|gb|EDY88376.1| twin-arginine translocation pathway signal [Octadecabacter
           antarcticus 238]
          Length = 205

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/203 (16%), Positives = 82/203 (40%), Gaps = 9/203 (4%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AG 59
           M  +  +    + ++    A+  F A+    +  S+ +   +  S  + +G F Q +  G
Sbjct: 1   MNMITRR----LCLMAVPLALAGFAASPSFAQQLSLGQVSGYLNSFTSAEGAFTQINADG 56

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFS 118
            +  G  F+ RP +  F+Y+ P    +++ G  +A+++ + +     YPL     S+I  
Sbjct: 57  TISTGTIFIKRPGRVRFEYNPPEESLVVAGGGQVAIFDPRSNNGPDRYPLNQTPLSIILE 116

Query: 119 NNQHVIQESIQRVESNNSF---ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
            N    +  +    +++     +T    D      I + +      L  W + D + + +
Sbjct: 117 RNIDFTRTDMVTGHTSDGTKTTVTAQDPDHPEYGSIQMVYTANPVELRQWIVTDDTGQQT 176

Query: 176 IIKILKYKENTVLDPKVFEIPYD 198
            + +   +++  +   +F I  +
Sbjct: 177 TVILGDLEKDGRVPDILFNIQRE 199


>gi|146337390|ref|YP_001202438.1| putative signal peptide [Bradyrhizobium sp. ORS278]
 gi|146190196|emb|CAL74188.1| conserved hypothetical protein; putative signal peptide
           [Bradyrhizobium sp. ORS278]
          Length = 255

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/182 (20%), Positives = 78/182 (42%), Gaps = 5/182 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSP 81
               ++   +     K   +  S+QT+ G F+Q    G   KG+F++ +P K  F+Y  P
Sbjct: 68  SIFTSFDANQKAVAAKVSAYLSSLQTLVGNFVQVGPDGSKTKGDFYIQKPGKVRFEYEPP 127

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIF 141
           + + +I+DGS++ V + KL T  VYPL       + S+   +++++     + +      
Sbjct: 128 TPIDIIADGSSLVVRDRKLATQDVYPLSQTPLRYLLSDRIDLLKDTNVIAVTADELYVTI 187

Query: 142 FKDDFM----GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
             ++       + + +       +L  W + D     + I +        LDP +F+I +
Sbjct: 188 TIEEKQALIGTSRLMLMLGAKDGQLKQWTVTDPQGYDTTIAVYNLDTTKKLDPAMFKIDF 247

Query: 198 DK 199
             
Sbjct: 248 TN 249


>gi|103488147|ref|YP_617708.1| outer membrane lipoprotein carrier protein LolA [Sphingopyxis
           alaskensis RB2256]
 gi|98978224|gb|ABF54375.1| outer membrane lipoprotein carrier protein LolA [Sphingopyxis
           alaskensis RB2256]
          Length = 206

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/200 (16%), Positives = 71/200 (35%), Gaps = 8/200 (4%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFM 68
              +I  F +A              ++     H  +  TM   F+Q D  G  + G+  +
Sbjct: 3   FHKMIAPFAAAGLALATPAIGQSASALSSVQAHLKASDTMTADFVQTDRNGQRLSGKLTL 62

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI 128
            RP K  F+Y     + ++ DGS + V + ++     +P++      +   ++ + + + 
Sbjct: 63  KRPGKIRFQYQKGVPMLIVGDGSRLTVIDYEVRQVQSWPVKNSPLGALLDPDRDLAKYAR 122

Query: 129 Q--RVESNNSFITIFFKDDFMGNMISVTFDRL-----SYRLLNWKIMDSSRRYSIIKILK 181
                  +   + +   +      I++ F R        RL  W  +DS    + I +  
Sbjct: 123 ILPTGNKDVLSVEVKDPERPEYGTITMVFVRDASAPAGLRLRGWVALDSQNNRTRIDLSN 182

Query: 182 YKENTVLDPKVFEIPYDKIH 201
            + N  +    F     + +
Sbjct: 183 QRFNVAVADSAFRWTDPRPN 202


>gi|163745445|ref|ZP_02152805.1| outer membrane lipoprotein carrier protein LolA [Oceanibulbus
           indolifex HEL-45]
 gi|161382263|gb|EDQ06672.1| outer membrane lipoprotein carrier protein LolA [Oceanibulbus
           indolifex HEL-45]
          Length = 201

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/194 (16%), Positives = 78/194 (40%), Gaps = 8/194 (4%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKG 64
            + +   ++      +          +  S+ +   +   ++T +G F Q  D G +  G
Sbjct: 1   MRKLTSAILAI---GLAVSAPLAAAAQQLSLNEISGYLNQLKTAKGDFTQINDDGSISTG 57

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW-SVYPLRYMAFSVIFSNNQHV 123
             ++ RP K  F+Y++P S  +++  + + +Y+ K +     YPL     S+I ++N ++
Sbjct: 58  TIYIKRPGKVRFEYNAPDSGLVVAGANTVVIYDKKSNQPAETYPLARTPLSIILADNVNL 117

Query: 124 IQESIQRVESNNSF---ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
            +  +    S +     +T     +     I + F     +L  W I D +   + + + 
Sbjct: 118 GRAKMVTGHSYDGTATTVTAQDPANPQYGNIQMKFTGNPVQLRQWVINDGNGSATTVVLG 177

Query: 181 KYKENTVLDPKVFE 194
             +    +   +F+
Sbjct: 178 DMQAGGNISNSLFD 191


>gi|148251753|ref|YP_001236338.1| hypothetical protein BBta_0134 [Bradyrhizobium sp. BTAi1]
 gi|146403926|gb|ABQ32432.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 257

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 78/179 (43%), Gaps = 5/179 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSP 81
               ++   +     K   +  S+QT+ G F+Q    G   KG+F++ +P K  F+Y  P
Sbjct: 69  SIFTSFDANQKAIAGKVSAYLSSLQTLVGNFVQVGPDGSKTKGDFYIQKPGKVRFEYDPP 128

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIF 141
           + + +I+DGS++ V + KL T  VYPL       + S+   +++++     +++      
Sbjct: 129 TPIDIIADGSSLVVRDRKLATQDVYPLSQTPLRYLLSDRIDLLKDTNVIAVASDDLYVTI 188

Query: 142 FKDDFM----GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
             ++       + + +       +L  W + D     + I +        LDP +F+I 
Sbjct: 189 TIEEKQALIGTSRLMLMLGAKDGQLKQWTVTDPQGYDTTIAVYNLDTTKKLDPAMFKID 247


>gi|13476677|ref|NP_108246.1| outer membrane lipoprotein carrier protein [Mesorhizobium loti
           MAFF303099]
 gi|14027438|dbj|BAB53707.1| outer membrane lipoprotein carrier protein [Mesorhizobium loti
           MAFF303099]
          Length = 210

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 48/196 (24%), Positives = 86/196 (43%), Gaps = 4/196 (2%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQ-SVKKAIEHFLSIQTMQGTFLQED-AGYVMK 63
            + ++    + F ++   F     ++          +HF S+++M G F+Q D  G    
Sbjct: 4   IRRLLAFCFVVFSASAINFELTPAVSAAPVDAVAIADHFSSVKSMSGNFVQSDPRGEKTS 63

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHV 123
           G FF+ RP K  F Y+  S +SLI+DG ++ +YN KL T  +Y L      ++  +    
Sbjct: 64  GRFFLQRPGKIRFNYTGQSGISLIADGQSVVIYNKKLKTSRLYALSKTPLKLLLDDKVEF 123

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISV--TFDRLSYRLLNWKIMDSSRRYSIIKILK 181
               ++ ++ + + +TI   D       ++   FDR S  L  W I D   + + + +  
Sbjct: 124 SGNRLKGIKDDGAQVTIKLADKSAFGNSNITMVFDRKSLDLRRWSITDERGQSTTVTLSN 183

Query: 182 YKENTVLDPKVFEIPY 197
            +E     P  F I Y
Sbjct: 184 VREGVRAPPGTFMIDY 199


>gi|75674283|ref|YP_316704.1| Outer membrane lipoprotein carrier protein LolA [Nitrobacter
           winogradskyi Nb-255]
 gi|74419153|gb|ABA03352.1| Outer membrane lipoprotein carrier protein LolA [Nitrobacter
           winogradskyi Nb-255]
          Length = 258

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/178 (22%), Positives = 78/178 (43%), Gaps = 5/178 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSP 81
              A +   +  +  +   +  S++T+ G F+Q    G    GEF++ +P K  F+Y  P
Sbjct: 70  SIFATFDANQKAAAARVSSYLSSLRTLAGKFVQVGPDGSRSTGEFYIQKPGKVRFEYDPP 129

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFIT-- 139
           S +++ISDGS++ + + +L T  VYPL       + S+   +++++     +++      
Sbjct: 130 SPIAMISDGSSLVIRDTRLATQDVYPLSQTPLRYLLSDRIDLMRDTNVVAVTSDDLYISV 189

Query: 140 IFFKDDFMGNMISVTF--DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
           I  +   +     + F       +L  W I D     + + I        LDP +F I
Sbjct: 190 IIEEKQALVGTSRLMFMVGVKDGKLKQWTITDPQGYDTTVAIYNLNPTAKLDPALFRI 247


>gi|254487598|ref|ZP_05100803.1| outer membrane lipoprotein carrier protein LolA [Roseobacter sp.
           GAI101]
 gi|214044467|gb|EEB85105.1| outer membrane lipoprotein carrier protein LolA [Roseobacter sp.
           GAI101]
          Length = 201

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/185 (17%), Positives = 74/185 (40%), Gaps = 5/185 (2%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKF 74
                +   +      +  S+    ++  +++T +G F Q  D G +  G  ++ RP K 
Sbjct: 8   VLALGLGLASVLPATAEQLSLGAISKYLNAMKTAKGDFTQINDDGSISTGTIYIKRPGKV 67

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTW-SVYPLRYMAFSVIFSNNQHVIQESIQRVES 133
            F+Y++P S  +I+  + + +Y+ K +     YPL     S+I + N ++ Q  +    S
Sbjct: 68  RFEYNAPDSGIVIAGSNTVVIYDKKSNQPAETYPLSKTPLSIILAANVNLGQARMVTGHS 127

Query: 134 NNSF---ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
            +     +            I + F      L  W I + +   + + +   ++   L  
Sbjct: 128 YDGTATTVRAQDPQHPEYGNIELKFTDNPIELRQWIINNGNGDQTTVVLGDMQKGVSLPN 187

Query: 191 KVFEI 195
            +F++
Sbjct: 188 SLFDV 192


>gi|148259434|ref|YP_001233561.1| outer membrane lipoprotein carrier protein LolA [Acidiphilium
           cryptum JF-5]
 gi|326402660|ref|YP_004282741.1| putative outer membrane lipoprotein carrier protein LolA
           [Acidiphilium multivorum AIU301]
 gi|146401115|gb|ABQ29642.1| outer membrane lipoprotein carrier protein LolA [Acidiphilium
           cryptum JF-5]
 gi|325049521|dbj|BAJ79859.1| putative outer membrane lipoprotein carrier protein LolA
           [Acidiphilium multivorum AIU301]
          Length = 206

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/199 (17%), Positives = 77/199 (38%), Gaps = 6/199 (3%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITK--DQSVKKAIEHFLSIQTMQGTFLQE-DAG 59
            +  ++++G+      ++  P  +A   +    Q + K +++  S++T+   F+Q    G
Sbjct: 1   MIARRALLGIAATCVAASFSPAWSAPLSSGHTQQVLGKVLDYLNSLKTVTARFMQVGPDG 60

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
            V  G   + RP K  F+Y  P    L++    +  ++ +LD  +  PL      ++ + 
Sbjct: 61  SVRTGTAIVQRPGKMRFEYDKPDPQLLVAGFGLLVYHDPQLDQTTNIPLSSTPLGILLAK 120

Query: 120 NQHV---IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
           +      ++            +T+          I++ F      L  W++ D+  R + 
Sbjct: 121 HITFGGDVKLLRVSTPPGEIQVTLTRAGREAQGHITLVFSTNPIELRQWRLTDAQDRVTQ 180

Query: 177 IKILKYKENTVLDPKVFEI 195
           + +   K       K FE 
Sbjct: 181 VSLYDLKPAAPFPDKTFEF 199


>gi|307297052|ref|ZP_07576868.1| outer membrane lipoprotein carrier protein LolA [Sphingobium
           chlorophenolicum L-1]
 gi|306877578|gb|EFN08806.1| outer membrane lipoprotein carrier protein LolA [Sphingobium
           chlorophenolicum L-1]
          Length = 212

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/206 (12%), Positives = 71/206 (34%), Gaps = 10/206 (4%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQ--SVKKAIEHFLSIQTMQGTFLQED-AGYVM 62
            K ++  + L   +            +     + K   +  ++ TM   F Q D  G  +
Sbjct: 1   MKRILAPLTLTLAAVPVVVPMIPAAAQADRSDLSKVNAYIRAVTTMTADFAQTDRNGQTL 60

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQH 122
            G+  + +P +  F+Y     + ++ DG  + + + ++     +P+       +   N+ 
Sbjct: 61  TGQLTIKQPGRIRFQYQKGVPLLIVGDGKALTMIDYEVRQVQRWPIGNSPLGALIDPNKD 120

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRL-------SYRLLNWKIMDSSRRYS 175
           + +        + + +++  +D       ++T             +L  W  +DS    +
Sbjct: 121 LSKFGKVIQTGDPTVLSVQARDPKRPEYGTITMIFKRDVGSPAGLQLYGWVALDSQNNRT 180

Query: 176 IIKILKYKENTVLDPKVFEIPYDKIH 201
            +K+   +    +   VF     +  
Sbjct: 181 AVKLSNQRYGVPVADSVFRWTDPRPK 206


>gi|89070981|ref|ZP_01158204.1| Putative outer membrane lipoprotein carrier protein [Oceanicola
           granulosus HTCC2516]
 gi|89043444|gb|EAR49659.1| Putative outer membrane lipoprotein carrier protein [Oceanicola
           granulosus HTCC2516]
          Length = 202

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/195 (18%), Positives = 73/195 (37%), Gaps = 7/195 (3%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKG 64
            K++  +++L     I    A     +  S+ +  ++  S  T QG F Q    G +  G
Sbjct: 1   MKTIRHLLLLIPL--IVAALATSGQAQQLSLAQISQYMNSFSTAQGEFTQINSDGTISTG 58

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL-DTWSVYPLRYMAFSVIFSNNQHV 123
              + RP +  F+Y+ P    +++ G ++AV++ +  +    YPL      +I   N   
Sbjct: 59  TLLIKRPGRIRFQYNPPDRSLVLAGGGSVAVFDPQSDNNPERYPLSETPLKIILEQNVDF 118

Query: 124 IQESIQRVESNNSF---ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
            +  +      +     +T           I + F      L  W I D + + + + + 
Sbjct: 119 TRAGMVTGHGYDGTATTVTAQDPQHPEYGSIQLKFTGSPVELRQWIITDDAGQQTTVVLG 178

Query: 181 KYKENTVLDPKVFEI 195
              +N  +    F I
Sbjct: 179 DLAKNVAIGDINFNI 193


>gi|84517261|ref|ZP_01004616.1| putative outer membrane lipoprotein carrier protein [Loktanella
           vestfoldensis SKA53]
 gi|84508936|gb|EAQ05398.1| putative outer membrane lipoprotein carrier protein [Loktanella
           vestfoldensis SKA53]
          Length = 202

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/191 (18%), Positives = 76/191 (39%), Gaps = 5/191 (2%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARP 71
           +I F  +     +      +  S+ +  ++   +QT QG F Q +  G +  G+ ++ RP
Sbjct: 5   IIPFLVAFAMSVHGVGVSAQQLSLPQISDYLNQLQTAQGGFTQVNGDGTLSTGQIYIKRP 64

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQR 130
            +  F+Y+ P    +++ G  +A+++ + +T    YPL     +VI   N  +    +  
Sbjct: 65  GRIRFEYNPPQESLVMAGGGQLAIFDPRSNTGPDRYPLSQTPLNVILQRNVDLTAARMVT 124

Query: 131 VESNNSFIT---IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
              ++  IT   +   D+     I + F      L  W I D     + + +        
Sbjct: 125 GSVSDGTITTVTVQDPDNPQYGDIQLVFTANPVELRQWIITDDLGNQTTMVLNDLTTGAP 184

Query: 188 LDPKVFEIPYD 198
           +   +F I  +
Sbjct: 185 IGDIMFNIAAE 195


>gi|83952503|ref|ZP_00961234.1| Putative outer membrane lipoprotein carrier protein [Roseovarius
           nubinhibens ISM]
 gi|83836176|gb|EAP75474.1| Putative outer membrane lipoprotein carrier protein [Roseovarius
           nubinhibens ISM]
          Length = 206

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/199 (18%), Positives = 67/199 (33%), Gaps = 8/199 (4%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYV 61
            +  + ++                     +  S+ +   +   I T  G F Q  D G V
Sbjct: 1   MMNRRQILAT---GAACVALAAPIPATAAEKLSLGEISRYLNGITTASGDFTQINDDGTV 57

Query: 62  MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN-AKLDTWSVYPLRYMAFSVIFSNN 120
            KG   + RP +  F+Y+ P    ++SDGS + V +    +    +PL     S+I + N
Sbjct: 58  SKGRVIIKRPGRVRFEYAPPDRTLVVSDGSTVGVIDGKSNEPPQGFPLNRTPLSIILARN 117

Query: 121 QHVIQESIQRVESNNSFITI---FFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             + +  +      +   TI             I + F      L  W I D     + +
Sbjct: 118 VDLTRARMVTGHRVDGAKTIVQAQDPAHPEYGNIELVFTGSPVELRQWIINDGDGARTTV 177

Query: 178 KILKYKENTVLDPKVFEIP 196
            +   ++        F IP
Sbjct: 178 VLGGLRKGGNFSNDKFVIP 196


>gi|159185367|ref|NP_355690.2| hypothetical protein Atu2760 [Agrobacterium tumefaciens str. C58]
 gi|159140618|gb|AAK88475.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 224

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 52/189 (27%), Positives = 89/189 (47%), Gaps = 3/189 (1%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKF 74
                      A       + +K   HF S++TM G F+Q    G    G+F++ RP K 
Sbjct: 33  VIAGLSPLNAFAQAAGNGATAQKIANHFSSVKTMMGEFVQFGPRGEQTGGKFYIERPGKL 92

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESN 134
            F Y  PS + +ISDG N+ + N KL TW +YPL     S++ S+   +  + ++ V+  
Sbjct: 93  RFNYEDPSPMRVISDGKNVVIGNMKLKTWDLYPLSKTPLSLLLSDKIDLGNQKVRDVKEE 152

Query: 135 NSF--ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
           +    I +  K  F  + I++ FD  ++ L  W   D+  + + + I   +    LD +V
Sbjct: 153 SDLTTIVLGDKSVFGDSTITLMFDPKTFDLRQWTTTDAQNKDTTVMIFNVQTGVNLDERV 212

Query: 193 FEIPYDKIH 201
           F I Y+++ 
Sbjct: 213 FNINYEEVR 221


>gi|254474341|ref|ZP_05087727.1| outer membrane lipoprotein carrier protein LolA [Ruegeria sp. R11]
 gi|214028584|gb|EEB69419.1| outer membrane lipoprotein carrier protein LolA [Ruegeria sp. R11]
          Length = 195

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/194 (19%), Positives = 75/194 (38%), Gaps = 11/194 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKG 64
            K +          A+   ++A    +  S+ +  ++   I T Q  F Q  D G +  G
Sbjct: 1   MKQI------ACALALTLCSSAAWAAEKLSLNEVSQYLNGITTAQAPFSQINDDGSLSTG 54

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK-LDTWSVYPLRYMAFSVIFSNNQHV 123
           + +M RP K  F+Y +P+S  +I+    + + + K       YPL+    S+I +    +
Sbjct: 55  KLYMHRPGKMRFEYDAPNSGVVIAGAGAVVIQDPKSNQPPETYPLKRTPLSLILARTVKL 114

Query: 124 IQESI---QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
            Q ++      +  ++ +      +     I + F      L  W I D S   + + + 
Sbjct: 115 GQANMVVGHDFDGTSTIVRAQDPKNPEYGSIEMMFTDSPVELRKWVIHDGSGGKTTVILG 174

Query: 181 KYKENTVLDPKVFE 194
             +    L  ++F 
Sbjct: 175 GLETGVTLSSRLFN 188


>gi|328541765|ref|YP_004301874.1| Outer membrane lipoprotein carrier protein LolA [polymorphum gilvum
           SL003B-26A1]
 gi|326411517|gb|ADZ68580.1| Outer membrane lipoprotein carrier protein LolA [Polymorphum gilvum
           SL003B-26A1]
          Length = 220

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 44/177 (24%), Positives = 88/177 (49%), Gaps = 4/177 (2%)

Query: 25  NAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSS 83
            A     + +++     +F S++TM G F+Q    G  ++G+F++ARP K  F YS P+ 
Sbjct: 34  AATLSGEQQKTLADVNAYFNSVKTMHGDFVQFGPEGDQVEGKFYLARPGKIRFYYSPPAQ 93

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRV---ESNNSFITI 140
           + +I+DG +++V + K+ T  ++PL       + ++N  + +++       E +   + I
Sbjct: 94  LDIIADGKSVSVKDRKMATQDIWPLSETPLRFLLADNIDLTKDTKVVGVMAEPDLVTVVI 153

Query: 141 FFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
             K  F    +++ FD  +Y L  W + D+    + + +     N   +PK+F I Y
Sbjct: 154 EDKTTFNSGKLTLIFDARTYELKQWTVTDAQGYDTSVAVYNVVANGPTNPKLFVIDY 210


>gi|260574467|ref|ZP_05842471.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter sp.
           SW2]
 gi|259023363|gb|EEW26655.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter sp.
           SW2]
          Length = 215

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 27/176 (15%), Positives = 64/176 (36%), Gaps = 5/176 (2%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSL 86
             + +   + K   +   + T +  F Q +  G +  G  ++ RP +  F+Y+ P    +
Sbjct: 34  PALAEKIPLAKISSYLNGLTTAEAEFTQINGDGSITSGRLYIKRPGRVRFEYAPPDKSLV 93

Query: 87  ISDGSNIAVYN-AKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSF---ITIFF 142
           ++ G  +A+++         YPL     ++I + N  + +  +    S +     +    
Sbjct: 94  MAGGGQVAIFDAKSNQPPEQYPLARTPLNLILAANVDLGRAKMVTGHSEDGTSTRVQAQD 153

Query: 143 KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
            +      I + F      L  W I D     + + + +  +       +F I  +
Sbjct: 154 PEHPEYGSIEMVFTANPTELRQWVITDDGGNQTTVILGEMSKGGSYPASLFNITTE 209


>gi|325294130|ref|YP_004279994.1| outer-membrane lipoprotein carrier protein [Agrobacterium sp.
           H13-3]
 gi|325061983|gb|ADY65674.1| outer-membrane lipoprotein carrier protein [Agrobacterium sp.
           H13-3]
          Length = 224

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 52/185 (28%), Positives = 89/185 (48%), Gaps = 3/185 (1%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKY 78
                  A       + +K   HF S++TM G F+Q    G    G+F++ RP K  F Y
Sbjct: 37  LSPLNAFAQAAGNSATAQKIANHFSSVKTMMGEFVQFGPRGEQTGGKFYIERPGKLRFNY 96

Query: 79  SSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSF- 137
             PS + +ISDG N+ + N KL TW +YPL     S++ S+   +  + ++ V+  +   
Sbjct: 97  EDPSPMRVISDGKNVVIGNMKLKTWDLYPLSKTPLSLLLSDKIDLSNQKVRNVKEESDLT 156

Query: 138 -ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
            I +  K  F  + I++ FD  ++ L  W   D+  + + + I   +    LD +VF I 
Sbjct: 157 TIVLGDKSVFGDSTITLMFDPKTFDLRQWTTTDAQNKDTTVMIFNVQTGVNLDERVFNIN 216

Query: 197 YDKIH 201
           Y+++ 
Sbjct: 217 YEEVR 221


>gi|89052920|ref|YP_508371.1| twin-arginine translocation pathway signal [Jannaschia sp. CCS1]
 gi|88862469|gb|ABD53346.1| Twin-arginine translocation pathway signal [Jannaschia sp. CCS1]
          Length = 203

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 29/189 (15%), Positives = 58/189 (30%), Gaps = 4/189 (2%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPS 72
           +L   +A      +        + +   +  ++QT +  F Q    G V  G  ++ RP 
Sbjct: 8   LLGATAAFILAGTSAAFANAIPLAQLSGYLNAMQTAESPFTQINSDGTVSTGTVYIHRPG 67

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVE 132
           +  F Y     + +                   YPL      +I   N  + Q  +    
Sbjct: 68  RVRFDYDGDDLLVMAGGSQVAIFDGRASGPPEQYPLDQTPLRIILQRNVDLGQSGMVSEH 127

Query: 133 SNNSF---ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLD 189
           S +     +            I++ F      L  W I D     + + +   ++   + 
Sbjct: 128 SFDGTSTRVVARDPQRPNIGSITLVFTPNPIELRQWVITDEGGAQTTVILGALEQGGRIP 187

Query: 190 PKVFEIPYD 198
            + F IP +
Sbjct: 188 ARFFSIPQE 196


>gi|154251752|ref|YP_001412576.1| outer membrane lipoprotein carrier protein LolA [Parvibaculum
           lavamentivorans DS-1]
 gi|154155702|gb|ABS62919.1| outer membrane lipoprotein carrier protein LolA [Parvibaculum
           lavamentivorans DS-1]
          Length = 243

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 79/173 (45%), Gaps = 3/173 (1%)

Query: 26  AAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSV 84
           A      ++++++A  +  +++ +QG FLQ    G V +G+F++ RP +  F+Y  P ++
Sbjct: 59  AQRSAEDEKALEQASAYLGALENLQGNFLQVGPDGSVAEGKFYLRRPGRLRFEYEPPENL 118

Query: 85  SLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNS--FITIFF 142
            +++DG+ +AV ++                ++  N        +  VE+      IT+  
Sbjct: 119 LVVADGTWVAVKDSSAPAQRYPMASTPLNLLLGKNVDLTESARVLNVETQPGALLITLAD 178

Query: 143 KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
           +       I++ FD+ + +L  W + D+    + + +   ++    D  +F +
Sbjct: 179 RSGEAPGKITLIFDQPALQLRQWVVTDAQGLQTTVALRNVQQGIRADNALFVL 231


>gi|114327250|ref|YP_744407.1| outer-membrane lipoproteins carrier protein [Granulibacter
           bethesdensis CGDNIH1]
 gi|114315424|gb|ABI61484.1| outer-membrane lipoproteins carrier protein [Granulibacter
           bethesdensis CGDNIH1]
          Length = 231

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 30/193 (15%), Positives = 78/193 (40%), Gaps = 5/193 (2%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKG 64
            + ++G ++     A+    A    + D  + +   +   I T++  F Q    G V +G
Sbjct: 32  RRQILGGILASLAGAVV-VPARAEESDDALLARIAAYLNGIHTLRARFRQTAPDGQVTQG 90

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
             ++ RP    F+Y  P+ + L++    +   + ++   S  PL     S++ S++    
Sbjct: 91  TVWLERPGHIRFQYDPPTPLLLVATNGEVIFQDFQVHQVSRIPLDRTPLSILLSDHIDFN 150

Query: 125 ---QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
                           +++  + D    ++++ F     +L+ W ++D   + + +++  
Sbjct: 151 GAAAVREISRTPGVIQLSVVRRTDPGAGLLAIVFSADPLKLIQWTVVDPQHKITRVELSN 210

Query: 182 YKENTVLDPKVFE 194
            +    +DP +F 
Sbjct: 211 IQTGIPVDPTLFS 223


>gi|86136933|ref|ZP_01055511.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseobacter sp. MED193]
 gi|85826257|gb|EAQ46454.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseobacter sp. MED193]
          Length = 224

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 27/195 (13%), Positives = 74/195 (37%), Gaps = 7/195 (3%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMK 63
           L K ++  + L   + +F  + A       S+ +   +   ++T   +F Q  D G +  
Sbjct: 24  LMKQILHAIALSCCALVF--STAAWAEGKLSLNEISGYLNGMKTATASFTQINDDGTLTT 81

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK-LDTWSVYPLRYMAFSVIFSNNQH 122
           G+ ++ RP +  F+Y      ++++    + +++ K       +PL+    S+I +    
Sbjct: 82  GKLYLHRPGRMRFEYDGKGGGTVVAGAGAVRIHDPKSNQPPETFPLKRTPLSIILAKQVD 141

Query: 123 VIQESIQRVESNNS---FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
           + + ++      +     +     ++     + + F      L  W + D +   + + +
Sbjct: 142 LGRANMVVGHGFDGTSTVVQAQDPENPDYGSLELMFTGEPVELRKWVVHDGAGGKTTVIL 201

Query: 180 LKYKENTVLDPKVFE 194
              +    L   +F 
Sbjct: 202 GALETGMRLPSTLFS 216


>gi|310817198|ref|YP_003965162.1| twin-arginine translocation pathway signal [Ketogulonicigenium
           vulgare Y25]
 gi|308755933|gb|ADO43862.1| twin-arginine translocation pathway signal [Ketogulonicigenium
           vulgare Y25]
          Length = 197

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 30/188 (15%), Positives = 69/188 (36%), Gaps = 5/188 (2%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKF 74
              SA     A     +  ++     +   + T +G F Q    G    G  ++ RP + 
Sbjct: 5   MALSAGTLGGALPAFAQQVTLNDISAYLNGLTTAEGRFTQANADGSQSAGAIYIKRPGRM 64

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLD-TWSVYPLRYMAFSVIFSNNQHVIQESIQRVES 133
            F+Y  P +  +++ G  +A+++ + +     YPL     ++I   N  + + ++ R   
Sbjct: 65  RFEYDPPDNGRMLASGGQLAIFDPRSNLPPDRYPLNQTPLNIILERNVDLGRRNMVRGMQ 124

Query: 134 NNS---FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
            +     +T           I + F      L  W ++D +   +   + + +    +  
Sbjct: 125 VDGNRAIVTAQDPSHPEYGAIELVFQISPMTLWQWTVIDQAGGRTTTTLSEIRIGGQISD 184

Query: 191 KVFEIPYD 198
            +F I  +
Sbjct: 185 SIFNIESE 192


>gi|255597485|ref|XP_002536785.1| conserved hypothetical protein [Ricinus communis]
 gi|223518556|gb|EEF25598.1| conserved hypothetical protein [Ricinus communis]
          Length = 222

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 55/183 (30%), Positives = 91/183 (49%), Gaps = 3/183 (1%)

Query: 22  FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSS 80
               A        + +   +HF S+ TMQG F+Q    G    G+FF+ RP K  F Y  
Sbjct: 33  VNVFAQAAAGGSATAQAIADHFSSVGTMQGEFVQFGPRGEQTGGKFFIQRPGKLRFNYDD 92

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITI 140
           PS + +I+DG N+AV N KL TW++YPL     S++ +   ++   S++ V+  +   TI
Sbjct: 93  PSPIRVIADGKNVAVGNLKLKTWNLYPLSKTPLSLLLAQKINLSDGSVKSVKEESDLTTI 152

Query: 141 FFKDDFMGNMISV--TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
              ++ +    ++   FD  +Y L  W I D+  + + + +   K     D KVF++PY+
Sbjct: 153 ALGNNTVFGNSTITMMFDPKTYDLRQWTITDNQGKDTSVMVFNVKTGVQFDDKVFKVPYE 212

Query: 199 KIH 201
            I 
Sbjct: 213 SIP 215


>gi|84500687|ref|ZP_00998936.1| outer membrane lipoprotein carrier protein LolA, putative
           [Oceanicola batsensis HTCC2597]
 gi|84391640|gb|EAQ03972.1| outer membrane lipoprotein carrier protein LolA, putative
           [Oceanicola batsensis HTCC2597]
          Length = 200

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 32/169 (18%), Positives = 62/169 (36%), Gaps = 5/169 (2%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           +   +     +   I T Q  F Q    G V  G  ++ RP K  F+Y  P+   +I+D 
Sbjct: 24  EKLPLSTLSAYLNGITTAQAKFTQIAGDGTVSTGTLYLKRPGKMRFEYDPPNKSYVIADH 83

Query: 91  SNIAVYN-AKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNS---FITIFFKDDF 146
             + +++    +T   YPLR    S+I   +  + + ++      +     +      + 
Sbjct: 84  GAVGIFDEKGDETVEQYPLRRTPLSIILDRHVDLGRANMVTGHREDGPSTIVRAQDPKNP 143

Query: 147 MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
               I + F      L  W + D S   + + + + K    L   +F  
Sbjct: 144 EYGFIELVFTGDPVELRQWVVHDDSGSATTVILGEMKTGIQLSQSLFNF 192


>gi|296532204|ref|ZP_06894956.1| LolA family outer membrane lipoprotein carrier protein [Roseomonas
           cervicalis ATCC 49957]
 gi|296267475|gb|EFH13348.1| LolA family outer membrane lipoprotein carrier protein [Roseomonas
           cervicalis ATCC 49957]
          Length = 268

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 31/175 (17%), Positives = 66/175 (37%), Gaps = 4/175 (2%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSL 86
               +   + +A  +   I T++  FLQ    G   +G  F+ARP +  F Y  P  + L
Sbjct: 86  QANNQQALLARAETYLNGITTLRARFLQIAQNGGSAEGTAFIARPGRMRFDYDPPEPLLL 145

Query: 87  ISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHV---IQESIQRVESNNSFITIFFK 143
           ++       Y+ +L   S+ P+     + +          I+    + +     +T+  +
Sbjct: 146 VASDGQFLYYDRELRQPSIVPVSSTPLAFLLRPRISFGGDIEVMGVQRQGGFLQVTVRRR 205

Query: 144 DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           D      +++ F      L  W ++DS  R + + +   +    L  ++F     
Sbjct: 206 DAPSEGSLTLVFAEEPMELRQWVVVDSQGRQTRVTLNAIETGMALPRRLFTFNDP 260


>gi|158421719|ref|YP_001523011.1| putative outer membrane lipoprotein-sorting protein [Azorhizobium
           caulinodans ORS 571]
 gi|158328608|dbj|BAF86093.1| putative outer membrane lipoprotein-sorting protein [Azorhizobium
           caulinodans ORS 571]
          Length = 357

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 40/170 (23%), Positives = 77/170 (45%), Gaps = 5/170 (2%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISD 89
               +++K   ++ S+QT+ GTF+Q D  G    G+F+M +P +  F+Y+ P+ + LIS+
Sbjct: 187 ASPATIEKLTTYWNSVQTLVGTFVQVDADGTRKTGDFYMQKPGRVRFEYNPPTQIQLISN 246

Query: 90  GSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG- 148
           G N+AV + +L+T  + PL       I +    + + S       ++        + +  
Sbjct: 247 GQNVAVRDRRLNTQDLTPLNQTPLRFILAERIDLTRNSNVLGVYQDNLYIQVIMQESVPM 306

Query: 149 ---NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
                + + FD   ++L  W + D     + + I         DP +F I
Sbjct: 307 MGTYRLQILFDAKDFQLRQWTVTDPQGYDTSVAIYDLNYTQRPDPSLFVI 356


>gi|182677441|ref|YP_001831587.1| outer membrane lipoprotein carrier protein LolA [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182633324|gb|ACB94098.1| outer membrane lipoprotein carrier protein LolA [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 268

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/177 (20%), Positives = 85/177 (48%), Gaps = 5/177 (2%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVSLI 87
           P+ +  +++KA  +F S  TM G F+Q    G   +G+ ++ RP +  F+Y++P+++ ++
Sbjct: 92  PLDQATAIQKANAYFSSAITMVGDFVQVGSDGRRTEGKLYVQRPGRLRFEYAAPATLEIV 151

Query: 88  SDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNN----SFITIFFK 143
           +DG ++AV++ +  T  VY +       +  +   + Q+       ++    + I     
Sbjct: 152 ADGLSLAVHDRRTATKDVYFISQTPLKFLLKDQVDLAQDVKVVEVQSDPSAVTIIIEDKA 211

Query: 144 DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
                + I++ FD + + L  WK+ D     +++ +         DP +F++  D +
Sbjct: 212 TFGGTSRINLVFDPVKFTLKQWKVTDPQGYETLVSLFNLDLTKKPDPALFQLTQDHL 268


>gi|148555456|ref|YP_001263038.1| outer membrane lipoprotein carrier protein LolA [Sphingomonas
           wittichii RW1]
 gi|148500646|gb|ABQ68900.1| outer membrane lipoprotein carrier protein LolA [Sphingomonas
           wittichii RW1]
          Length = 207

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/203 (15%), Positives = 74/203 (36%), Gaps = 7/203 (3%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKG 64
            + +   +     +      AA  + +  S+ +   H   I TM   F+Q D  G  + G
Sbjct: 1   MRPLFPFLAAALIAPAAIVMAAPAMAQTASLDEVAAHLRGITTMTADFVQTDRNGKSLSG 60

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
              + +P K  F+Y     + ++ DG  + + +  +   S +P+     SV+    + + 
Sbjct: 61  MLTLRQPGKVRFEYQKGVPLLIVGDGKALTMIDYSVRQVSRWPVGNSPLSVLIDPRRDMS 120

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTF------DRLSYRLLNWKIMDSSRRYSIIK 178
           + +     +    IT+  +D       ++T             L  W ++D+    S ++
Sbjct: 121 RFAKVVPSTIPGTITVEARDGKHPEFGTITIVFAKGAGPGGLALQGWTVLDAQNGRSTVR 180

Query: 179 ILKYKENTVLDPKVFEIPYDKIH 201
           +   +    +  K F+    +  
Sbjct: 181 LTNQRFGVAISDKAFKWDDPRPK 203


>gi|330719461|gb|EGG98090.1| Outer membrane lipoprotein carrier protein LolA [gamma
           proteobacterium IMCC2047]
          Length = 213

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/205 (15%), Positives = 68/205 (33%), Gaps = 12/205 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            ++V+ + ++F  S +             + ++  +   ++Q+ Q  F+Q          
Sbjct: 1   MRNVLKIKVVFCLSLLMLAFVGKANADVDASQRLHDLLKNMQSFQADFIQNVLNTNGVLQ 60

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
              +GE  + RP  FY++  +P   +L++DG  +  Y+  L+  +V  +           
Sbjct: 61  QSTQGEMAVKRPGLFYWQTFAPFEQTLVADGEQLWSYDPDLEQVTVQAVGQRLSDTPALL 120

Query: 120 NQHVIQESIQRVES------NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
               I               + S+               +        L    I+DS   
Sbjct: 121 FSGEIDGLTDSYAISAVQLKDESWQFRLLPKQPDSLFEELRLTFAFDTLTQMHILDSLGN 180

Query: 174 YSIIKILKYKENTVLDPKVFEIPYD 198
            S ++    + N  LD  +F+    
Sbjct: 181 RSSLEFRNVRVNGALDDALFQFTPP 205


>gi|110677451|ref|YP_680458.1| outer membrane lipoprotein carrier protein, putative [Roseobacter
           denitrificans OCh 114]
 gi|109453567|gb|ABG29772.1| outer membrane lipoprotein carrier protein, putative [Roseobacter
           denitrificans OCh 114]
          Length = 186

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/178 (19%), Positives = 75/178 (42%), Gaps = 5/178 (2%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVS 85
           A    +   + +   +  S++T++GTF Q  D G V  G+ ++ RP +  F+Y  P    
Sbjct: 5   ASAAAEQLKLAEISAYLNSLETLKGTFRQINDDGSVSTGQLYIRRPGRMRFEYDPPEQAL 64

Query: 86  LISDGSNIAVYNAKLDTWSVYPL-RYMAFSVIFSNNQHVIQESIQR---VESNNSFITIF 141
           +I+  S + + + K +  S          S++   +  + + ++ R    +   + +T  
Sbjct: 65  VIAAASAVVIIDRKSNQPSETYPLSRTPLSLLLGRDIDLTRAAMVRNARFDGTATIVTAE 124

Query: 142 FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
             D+     + + F     RL  W I D+S   + + +  ++    L   +F+   +K
Sbjct: 125 DPDNLENGFLEMYFTDQPTRLEQWVIHDASGAQTRVILDAFETGMELPNSLFDADREK 182


>gi|163739849|ref|ZP_02147256.1| outer membrane lipoprotein carrier protein LolA, putative
           [Phaeobacter gallaeciensis BS107]
 gi|161386883|gb|EDQ11245.1| outer membrane lipoprotein carrier protein LolA, putative
           [Phaeobacter gallaeciensis BS107]
          Length = 195

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/194 (18%), Positives = 73/194 (37%), Gaps = 11/194 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKG 64
            K +       +  A+   + A    +  S+ +  ++   I T    F Q  D G +  G
Sbjct: 1   MKQI------AYAIALTLCSPAAWAAEKLSLNEVSQYLNGISTATAPFSQINDDGSLSTG 54

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK-LDTWSVYPLRYMAFSVIFSNNQHV 123
           + +M RP +  F+Y  P+   +++    + + + K       YPL+    S+I + N  +
Sbjct: 55  KLYMHRPGRMRFEYDPPNKGVVVAGAGAVLIQDPKSNQPPETYPLKRTPLSLILARNVDL 114

Query: 124 IQESI---QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
            + ++      +  ++ I      +     I + F      L  W I D S   + + + 
Sbjct: 115 GRANMVVGHSFDGTSTIIRAQDPKNPEYGSIEMMFTGDPVELRKWVIHDGSGGRTTVILG 174

Query: 181 KYKENTVLDPKVFE 194
             K    L  K+F 
Sbjct: 175 GLKTGVKLPSKLFN 188


>gi|298293366|ref|YP_003695305.1| outer membrane lipoprotein carrier protein LolA [Starkeya novella
           DSM 506]
 gi|296929877|gb|ADH90686.1| outer membrane lipoprotein carrier protein LolA [Starkeya novella
           DSM 506]
          Length = 252

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/170 (22%), Positives = 73/170 (42%), Gaps = 5/170 (2%)

Query: 34  QSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSN 92
            +V++   +F S + M G F+Q D  G   +G+FF+ +P +  F+Y  PS + L++DG +
Sbjct: 83  DTVQRINTYFNSFKNMTGNFVQVDPDGTRRQGQFFILKPGRVLFEYDPPSRIELVADGRS 142

Query: 93  IAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFI----TIFFKDDFMG 148
           +AV + +L T  + PL       + S N  + + +       +           +     
Sbjct: 143 VAVRDKRLKTQDISPLSATPLRFLLSENFDLARNANVTGVYQDDLFATVVIEERQAMTGT 202

Query: 149 NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
             + + FD  + +L  W + D     + + +         DP +F I  D
Sbjct: 203 YKLMIMFDAKTMQLKQWTVTDPQGYDTTVAVSNLDTGERPDPMLFVINRD 252


>gi|217976523|ref|YP_002360670.1| outer membrane lipoprotein carrier protein LolA [Methylocella
           silvestris BL2]
 gi|217501899|gb|ACK49308.1| outer membrane lipoprotein carrier protein LolA [Methylocella
           silvestris BL2]
          Length = 227

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/175 (25%), Positives = 84/175 (48%), Gaps = 5/175 (2%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           +++KA ++F +  TM G F+Q    G   +G+ F+ RP K  F+Y+ P+++ +++DG ++
Sbjct: 52  AIQKANDYFNTATTMIGDFVQIGPDGRRAEGKIFVQRPGKLRFEYAPPATLEIVADGLSV 111

Query: 94  AVYNAKLDTWSVYPLRYMAFSVI-FSNNQHVIQESIQRVESNNSFITIFFKDDFMGN--- 149
           AV++ K  T  VY +       +   +        I  V S+ S + I  +D        
Sbjct: 112 AVHDRKTATKDVYFISQTPLKFLLKDHVDLNRDVKIVNVASDPSSVVIQVEDTATFGGTS 171

Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
            I + FD   + L  W++ D     ++I +         DP +F++  ++I N N
Sbjct: 172 EIKLIFDPAKFTLKQWQVTDPQGYETVISLFNIDLTKKPDPNIFQLTQERIPNTN 226


>gi|116254289|ref|YP_770127.1| hypothetical protein RL4562 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258937|emb|CAK10046.1| conserved hypothetical exported protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 222

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 51/170 (30%), Positives = 86/170 (50%), Gaps = 3/170 (1%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           + +   +HF  + TMQG F+Q    G    G+FF+ RP K  F Y +PS + +I+DG N+
Sbjct: 46  TAQAIADHFSGVTTMQGEFVQFGPRGEQTGGKFFIQRPGKLRFNYDAPSPMRVIADGRNV 105

Query: 94  AVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISV 153
           A+ N KL TW +YPL     S++ +    +    ++ V+  +   TI   ++ +    ++
Sbjct: 106 AIGNTKLKTWDLYPLSKTPLSLLLARRIDLSAGMVKGVKEESDLTTIALGNNTVFGNSTI 165

Query: 154 --TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIH 201
              FD  +Y L  W I D+  + + + I   K     D +VF +PY+ I 
Sbjct: 166 TMMFDPKTYDLRQWTITDNQGKDTSVMIFNVKTGMQFDDRVFRVPYETIP 215


>gi|77163879|ref|YP_342404.1| Outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           oceani ATCC 19707]
 gi|254435438|ref|ZP_05048945.1| outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           oceani AFC27]
 gi|76882193|gb|ABA56874.1| Outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           oceani ATCC 19707]
 gi|207088549|gb|EDZ65821.1| outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           oceani AFC27]
          Length = 236

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 64/193 (33%), Gaps = 11/193 (5%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------VMKGEFFMAR 70
               I     A+ ++ ++             +++  F Q             KG FF+ R
Sbjct: 33  ALLGIILSGLAFTLSAEEPGDHLETFLQKTHSLRAEFQQILLDERNQPLEESKGVFFLQR 92

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQE 126
           P KF + Y  P S ++++DG ++  Y+  L   +V             ++          
Sbjct: 93  PGKFRWDYHEPFSQTIVADGEHVWFYDPDLAQVTVKNQGLALGDTPALLLSGKRLPAENF 152

Query: 127 SIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           SI  + S+N          D       +        L   ++ DS  R + +   K + N
Sbjct: 153 SISNLPSDNHLAWVELRPRDKEAAFERLLLAFDDDGLRQMELHDSFGRTTRLVFSKLEIN 212

Query: 186 TVLDPKVFEIPYD 198
             LDP +F     
Sbjct: 213 LSLDPSLFVFTPP 225


>gi|83309116|ref|YP_419380.1| Outer membrane lipoprotein-sorting protein [Magnetospirillum
           magneticum AMB-1]
 gi|82943957|dbj|BAE48821.1| Outer membrane lipoprotein-sorting protein [Magnetospirillum
           magneticum AMB-1]
          Length = 218

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/183 (19%), Positives = 78/183 (42%), Gaps = 5/183 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSP 81
           P            + +A E+   + T++  FLQ    G  ++G+ +++RP K   +Y  P
Sbjct: 27  PARTPLTAQDKADIARAEEYLNGVTTLKARFLQVSPNGASVEGDAYLSRPGKLRLQYDPP 86

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVES----NNSF 137
           S + +++DGS + V++++L   S  PL      ++      +    +             
Sbjct: 87  SPLLVVADGSFLIVHDSQLGEPSYIPLGSTPAGILVRPGVKLDGADVAVTRVVRLPGVVR 146

Query: 138 ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
           I++   +D     I++ F    + L  W++ D+  + + + + + +    LD K+FE   
Sbjct: 147 ISVVEAEDPAAGEITLVFSDKPFALRQWQVKDAQHQVTTVSLYQSQSGLSLDSKLFEFKN 206

Query: 198 DKI 200
            K 
Sbjct: 207 PKF 209


>gi|163743406|ref|ZP_02150786.1| outer membrane lipoprotein carrier protein LolA, putative
           [Phaeobacter gallaeciensis 2.10]
 gi|161383400|gb|EDQ07789.1| outer membrane lipoprotein carrier protein LolA, putative
           [Phaeobacter gallaeciensis 2.10]
          Length = 195

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/194 (18%), Positives = 73/194 (37%), Gaps = 11/194 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKG 64
            K +       +  A+   + A    +  S+ +  ++   I T    F Q  D G +  G
Sbjct: 1   MKQI------AYAIALTLCSPAAWAAEKLSLNEVSQYLNGISTATAPFSQINDDGSLSTG 54

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK-LDTWSVYPLRYMAFSVIFSNNQHV 123
           + +M RP +  F+Y  P+   +++    + + + K       YPL+    S+I + N  +
Sbjct: 55  KLYMHRPGRMRFEYDPPNKGVVVAGAGAVLIQDPKSNQPPETYPLKRTPLSLILARNVDL 114

Query: 124 IQESI---QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
            + ++      +  ++ I      +     I + F      L  W I D S   + + + 
Sbjct: 115 GRANMVVGHSFDGTSTIIRAQDPKNPEYGSIEMMFTGDPVELRKWVIHDGSGGQTTVILG 174

Query: 181 KYKENTVLDPKVFE 194
             K    L  K+F 
Sbjct: 175 GLKTGVKLPSKLFN 188


>gi|115522425|ref|YP_779336.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris BisA53]
 gi|115516372|gb|ABJ04356.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris BisA53]
          Length = 282

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/182 (20%), Positives = 80/182 (43%), Gaps = 5/182 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSP 81
                +   +     +   +  S+QT+ G F+Q    G   +G+F++ +P K  F+Y  P
Sbjct: 95  SLFTTFDANQKAQAARVSSYLSSLQTLVGNFVQVGPDGSRTQGDFYVQKPGKMRFEYDDP 154

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIF 141
           S +++I+DGS++AV + KL T  +YPL       + S+   +++++     S++      
Sbjct: 155 SPIAIIADGSSVAVRDRKLATQDIYPLSQTPLRYLLSDRIDLLRDTNVVSVSSDELYISV 214

Query: 142 FKDDFM----GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
             ++       + + +       +L  W + D     + + +        LDP +F+I +
Sbjct: 215 IIEEKQVVVGTSRLLLMIGVKDGQLKQWTVTDPQGYDTTVAVYNLDATKKLDPGMFKIDF 274

Query: 198 DK 199
             
Sbjct: 275 TN 276


>gi|110635563|ref|YP_675771.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium sp.
           BNC1]
 gi|110286547|gb|ABG64606.1| outer membrane lipoprotein carrier protein LolA [Chelativorans sp.
           BNC1]
          Length = 216

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 46/200 (23%), Positives = 92/200 (46%), Gaps = 3/200 (1%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMK 63
           +   +    +L          A       Q+ ++  +HF +++TM G F+Q    G    
Sbjct: 10  MVLRLARRSLLATAILAVGLTAGSANAASQAAQRIAQHFSNVRTMTGEFVQFGPRGEQTG 69

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHV 123
           G+F++ RP K  F Y  P+   ++SDGS + + N K++T  +Y L      ++      +
Sbjct: 70  GKFYIERPGKIRFDYEPPAQFRVMSDGSTVVLENKKMNTVDIYRLSDTPLRLLLGERIDL 129

Query: 124 IQESIQRVESNNSF--ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
             +++++V+ +     +TI  +       I++ FD  +Y L  W + D+  R + + I  
Sbjct: 130 SADNVRQVKEDPDLTTVTIADRKLGNNATITMMFDSKTYDLRQWTVTDAQGRDTTVMIFN 189

Query: 182 YKENTVLDPKVFEIPYDKIH 201
            K+    DP VF I + +++
Sbjct: 190 VKQGVTFDPSVFYIDHRRVN 209


>gi|209551338|ref|YP_002283255.1| outer membrane lipoprotein carrier protein LolA [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209537094|gb|ACI57029.1| outer membrane lipoprotein carrier protein LolA [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 222

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 52/170 (30%), Positives = 87/170 (51%), Gaps = 3/170 (1%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           + +   +HF  + TMQG F+Q    G    G+FF+ RP K  F Y  PS + +I+DG N+
Sbjct: 46  TAQAIADHFSGVTTMQGEFVQFGPRGEQTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNV 105

Query: 94  AVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISV 153
           A+ N KL TW +YPL     S++ + +  +    ++RV+  +   TI   ++ +    ++
Sbjct: 106 AIGNTKLKTWDLYPLSKTPLSLLLAQHIDLSAGMVKRVKEESDLTTIALGNNTVFGNSTI 165

Query: 154 --TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIH 201
              FD  +Y L  W I D+  + + + I   K     D +VF +PY+ I 
Sbjct: 166 TMMFDPKTYDLRQWTITDNQGKDTSVMIFNVKTGMQFDDRVFRVPYESIP 215


>gi|294341020|emb|CAZ89415.1| putative Outer-membrane lipoprotein carrier protein precursor lolA
           [Thiomonas sp. 3As]
          Length = 221

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/213 (13%), Positives = 65/213 (30%), Gaps = 14/213 (6%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY 60
           M   +    +  ++  F +      +        SV+   +     +     F Q  +  
Sbjct: 1   MMMFMNARWLTTLMRLFLAGGLLGASLPAAFAANSVQLLEQWLQQTRGASAQFTQTVSNP 60

Query: 61  V------MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY---- 110
                    G+F   RP +F + Y+ P +  ++SDG  +  Y+  LD  ++ P+      
Sbjct: 61  KGPAQAPATGQFAFERPDRFRWDYTKPYAQVIVSDGKQLWTYDHDLDQVTITPVTQAFKG 120

Query: 111 MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTF----DRLSYRLLNWK 166
              ++    +   +     + ++               N   +            +   +
Sbjct: 121 TPAAIFAGTDLTRLFTLQAQADAGGLQWVQATPKAKDSNFDWIRIGLRSTAQGPEVAELQ 180

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           + D+  + S ++    K N    P  F     K
Sbjct: 181 LRDAFGQISTMRFTAIKHNPTFGPDSFRFTPPK 213


>gi|114767089|ref|ZP_01445972.1| outer membrane lipoprotein carrier protein LolA, putative
           [Pelagibaca bermudensis HTCC2601]
 gi|114540742|gb|EAU43808.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseovarius sp. HTCC2601]
          Length = 193

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/189 (19%), Positives = 68/189 (35%), Gaps = 6/189 (3%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPS 72
           IL          A     +  S+     +  SIQ+ +  F Q    G +  G+  + RP 
Sbjct: 4   ILTAALTALMLTALPAAAQQLSLNTLSNYLNSIQSAESPFTQINSDGSISTGKILIKRPG 63

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAK-LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRV 131
           K  F+Y+ P    +++    + V++ K       YPL     S+I   N ++ Q  +   
Sbjct: 64  KVRFEYNPPEQALVLAWSGAVYVFDRKVGGQPETYPLNQTPLSIILDRNVNLAQAGMVTG 123

Query: 132 ESNNS---FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
              +     +T           I + F      L  W I D +   + + +   ++ T L
Sbjct: 124 HQYDGTATIVTAQDPKRPEYGSIQMKFTGNPVELRQWVIRDGNGSTTTVVLGGLEK-TSL 182

Query: 189 DPKVFEIPY 197
              VF++  
Sbjct: 183 PNSVFDVNR 191


>gi|255263615|ref|ZP_05342957.1| outer membrane lipoprotein carrier protein LolA [Thalassiobium sp.
           R2A62]
 gi|255105950|gb|EET48624.1| outer membrane lipoprotein carrier protein LolA [Thalassiobium sp.
           R2A62]
          Length = 199

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 75/196 (38%), Gaps = 10/196 (5%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMK 63
           + +    +         FP        ++ S+     +   IQT    F Q +  G +  
Sbjct: 1   MNRRTFLMGTAVAGLVGFP-----AAAQELSLGDMSRYLNDIQTATAEFTQINADGTIST 55

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQH 122
           G+ ++ RP +  F+Y+ P    ++++G  +A+++ + +     +PL     S+I + N  
Sbjct: 56  GQLYIKRPGRIRFEYNPPEQSLVLANGGQVAIFDPRSNNGPERFPLSQTPLSIILARNVD 115

Query: 123 VIQESIQRVESNNSF---ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
           + +  +    +++     I     D      I + F      L  W + D++ + + I +
Sbjct: 116 LARSGMVSGRTSDGTTTTIRAQDPDRPDMGNIQLVFTGNPVELRQWVVTDNAGQQTTIIL 175

Query: 180 LKYKENTVLDPKVFEI 195
               +   +    F I
Sbjct: 176 GDLTQGGRVPNSQFNI 191


>gi|260425883|ref|ZP_05779862.1| outer membrane lipoprotein carrier protein LolA [Citreicella sp.
           SE45]
 gi|260420375|gb|EEX13626.1| outer membrane lipoprotein carrier protein LolA [Citreicella sp.
           SE45]
          Length = 193

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 70/191 (36%), Gaps = 6/191 (3%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPS 72
           ++                +  S+ +  ++  SIQ+ +  F Q +  G +  G   + RP 
Sbjct: 4   LITAALTALVLTTVSAAAQQLSLNQISQYLNSIQSAKSPFTQINGDGTISTGTISIKRPG 63

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLD-TWSVYPLRYMAFSVIFSNNQHVIQESIQRV 131
           K  F+Y+ P    +++    + V++ K+      YPL     S+I   N ++ Q  +   
Sbjct: 64  KVRFEYNPPEQALVLAWSGAVYVFDKKVRGQPETYPLSQTPLSIILERNVNLAQRGMVTG 123

Query: 132 ESNNSF---ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
            S +     +T           I + F      L  W I D +   + + +   ++   L
Sbjct: 124 HSYDGTATTVTAQDPRHPEYGSIQMKFTGNPVELRQWIIRDGNGNTTTVVLGGLQK-ANL 182

Query: 189 DPKVFEIPYDK 199
              +F++    
Sbjct: 183 PNSLFDVNRVN 193


>gi|300115267|ref|YP_003761842.1| outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           watsonii C-113]
 gi|299541204|gb|ADJ29521.1| outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           watsonii C-113]
          Length = 219

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 70/209 (33%), Gaps = 13/209 (6%)

Query: 4   LLYKSVIGVVILF--FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY- 60
           +  K+     + F      +   +  + +  ++   +         +++  F Q      
Sbjct: 1   MFIKNFYRSRLGFQGALLGMILGSLVFTLRAEEPGARLDTFLQKTHSLRAEFQQILLDER 60

Query: 61  -----VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----M 111
                  +G FF+ RP KF + Y  P S ++++DG ++  Y+  L   +V          
Sbjct: 61  NQPMEESRGVFFLQRPGKFRWDYHKPFSQTIVADGEHVWFYDPDLAQVTVKNQASALGDT 120

Query: 112 AFSVIFSNNQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
              ++      V   SI  + S N          D       +        L   ++ DS
Sbjct: 121 PALLLSGKRLPVENFSISNLPSGNHLAWVELRPRDKEAAFERLLLGFDDDGLRQMELHDS 180

Query: 171 SRRYSIIKILKYKENTVLDPKVFEIPYDK 199
             R + +   K + N  LDP +F     +
Sbjct: 181 FGRTTRLVFSKLEINPSLDPSLFVFTPPE 209


>gi|270159556|ref|ZP_06188212.1| outer membrane lipoprotein carrier protein LolA [Legionella
           longbeachae D-4968]
 gi|289165648|ref|YP_003455786.1| Outer-membrane lipoprotein carrier protein precursor [Legionella
           longbeachae NSW150]
 gi|269987895|gb|EEZ94150.1| outer membrane lipoprotein carrier protein LolA [Legionella
           longbeachae D-4968]
 gi|288858821|emb|CBJ12735.1| Outer-membrane lipoprotein carrier protein precursor [Legionella
           longbeachae NSW150]
          Length = 202

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/204 (12%), Positives = 66/204 (32%), Gaps = 19/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----- 60
            K +   ++L   + +F              +        I+ M   F Q          
Sbjct: 1   MKKIFIALLLSISTTVFC---------QTPGELLQAKLNGIRAMTANFKQSVKAKHRVVS 51

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSV 115
              G   + RP +F ++ + P +  +++DG  I VY+  L+  +V              +
Sbjct: 52  RSSGTMALQRPGRFRWQTAQPMAQLMVADGQRIWVYDKDLEQVTVKKQSKGLGGTAALFL 111

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
              ++      ++ +    +  +          +   +  +     L   ++ D   + +
Sbjct: 112 SGYDDTVTRDFNVSQTGVGDELVFDLKSKSSKASFQRIKLNFRQDLLTGLELYDQLGQVT 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
            +++ + K N  L   +F+    K
Sbjct: 172 TVQLSQIKLNPKLASNMFQFKTPK 195


>gi|114707342|ref|ZP_01440239.1| hypothetical protein FP2506_03950 [Fulvimarina pelagi HTCC2506]
 gi|114537223|gb|EAU40350.1| hypothetical protein FP2506_03950 [Fulvimarina pelagi HTCC2506]
          Length = 234

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 52/199 (26%), Positives = 91/199 (45%), Gaps = 5/199 (2%)

Query: 7   KSVIGVVILFFYSA-IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKG 64
           +S++ V++    +A          + +  + ++  +HF SI +M G F+Q D  G   +G
Sbjct: 31  RSILSVMLALGIAAPAVTAFNGPVLAQSGAAQRIADHFSSIPSMHGDFVQFDPNGRQSEG 90

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
           +F++ +P K  F Y +   + +I+DG+ +A+ N KL+TW  YPL      ++     ++ 
Sbjct: 91  KFYIEKPGKVRFDY-ASQPLRVIADGTTVAINNKKLNTWDTYPLSQTPLKLLLDRRINLS 149

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISV--TFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
             +I+ V       TI   D  +    ++   FD  S  L  W I D   R + + I   
Sbjct: 150 SANIRSVREEPDLTTIVMGDRSVFGNSTITMMFDPQSSDLKQWTIRDKQGRDTTVMIYNV 209

Query: 183 KENTVLDPKVFEIPYDKIH 201
           KE   +    F IPY  I 
Sbjct: 210 KEGGDIQNSAFNIPYTAIQ 228


>gi|161869555|ref|YP_001598722.1| periplasmic carrier protein [Neisseria meningitidis 053442]
 gi|161595108|gb|ABX72768.1| periplasmic carrier protein [Neisseria meningitidis 053442]
          Length = 256

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/202 (15%), Positives = 65/202 (32%), Gaps = 9/202 (4%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VM 62
           K ++    LF + A+     A    +  +V    +       + G+F Q           
Sbjct: 48  KIMMKPHNLFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTA 107

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFS 118
            G F + RP  F ++Y+SP   +++ DG  + +Y+  L   +             +++ +
Sbjct: 108 HGTFKILRPGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAILSN 167

Query: 119 NNQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                   +++   S+N     +            +        L   ++ DS    + I
Sbjct: 168 KTALESSYTLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQTSI 227

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
                  N  L    F+    K
Sbjct: 228 SFGGLNTNPQLSRGAFKFTPPK 249


>gi|241206775|ref|YP_002977871.1| outer membrane lipoprotein carrier protein LolA [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240860665|gb|ACS58332.1| outer membrane lipoprotein carrier protein LolA [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 222

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 50/170 (29%), Positives = 86/170 (50%), Gaps = 3/170 (1%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           + +   +HF  + TMQG F+Q    G    G+FF+ RP K  F Y  PS + +I+DG N+
Sbjct: 46  TAQAIADHFSGVTTMQGEFVQFGPRGEQTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNV 105

Query: 94  AVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISV 153
           A+ N KL TW +YPL     S++ + +  +    ++ V+  +   TI   ++ +    ++
Sbjct: 106 AIGNMKLKTWDLYPLSKTPLSLLLAQHIDLSAGMVKGVKEESDLTTIALGNNTVFGNSTI 165

Query: 154 --TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIH 201
              FD  +Y L  W I D+  + + + I   K     + +VF +PY+ I 
Sbjct: 166 TMMFDPKTYDLRQWTITDNQGKDTSVMIFNVKTGMQFEDRVFRVPYETIP 215


>gi|316985278|gb|EFV64229.1| outer membrane lipocarrier protein LolA [Neisseria meningitidis
           H44/76]
          Length = 235

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 30/202 (14%), Positives = 64/202 (31%), Gaps = 9/202 (4%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VM 62
           K ++    LF + A+     A    +  +V    +       + G+F Q           
Sbjct: 27  KIMMKPHNLFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTA 86

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFS 118
            G F + RP  F ++Y+ P   +++ DG  + +Y+  L   +             +++ +
Sbjct: 87  HGTFKILRPGLFKWEYTKPYRQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAILSN 146

Query: 119 NNQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                   +++   S+N     +            +        L   ++ DS    + I
Sbjct: 147 KTALESSYTLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQTSI 206

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
                  N  L    F+    K
Sbjct: 207 SFGGLNTNPQLSRGAFKFTPPK 228


>gi|327190168|gb|EGE57273.1| putative outer membrane lipoproteins carrier protein [Rhizobium
           etli CNPAF512]
          Length = 222

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 51/170 (30%), Positives = 86/170 (50%), Gaps = 3/170 (1%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           + +   +HF  + TMQG F+Q    G    G+FF+ RP K  F Y  PS + +I+DG N+
Sbjct: 46  TAQAIADHFSGVTTMQGEFVQFGPRGEQTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNV 105

Query: 94  AVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISV 153
           A+ N KL TW +YPL     S++ + +  +    ++ V+  +   TI   ++ +    ++
Sbjct: 106 AIGNTKLKTWDLYPLSKTPLSLLLAQHIDLSAGMVKGVKEESDLTTIALGNNTVFGNSTI 165

Query: 154 --TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIH 201
              FD  +Y L  W I D+  + + + I   K     D +VF +PY+ I 
Sbjct: 166 TMMFDPKTYDLRQWTITDNQGKDTSVMIFNVKTGMQFDDRVFRVPYESIP 215


>gi|126733903|ref|ZP_01749650.1| Putative outer membrane lipoprotein carrier protein [Roseobacter
           sp. CCS2]
 gi|126716769|gb|EBA13633.1| Putative outer membrane lipoprotein carrier protein [Roseobacter
           sp. CCS2]
          Length = 201

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 36/196 (18%), Positives = 80/196 (40%), Gaps = 9/196 (4%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMK 63
           + K  + ++     +      A+    +  S+ +   +   +QT QG F Q +  G +  
Sbjct: 1   MSKRFLSIIAAVALTL----YASAASAQQLSLGQISAYLNQLQTAQGGFTQINADGTLST 56

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN-AKLDTWSVYPLRYMAFSVIFSNNQH 122
           G+ ++ RP +  F+Y++PS   +++ G  +A+++         YPL     S+I   N +
Sbjct: 57  GQIYIKRPGRIRFEYNAPSDSLVLASGGQLAIFDARSNTGPERYPLNQTPLSIILQENVN 116

Query: 123 VIQESIQRVESNNSF---ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
           + +E +     ++     +T    D+     I + F      L  W + D     + + +
Sbjct: 117 LEREDMVTNVVSDGTTTTVTAQDPDNPNYGSIQMVFTANPVELRQWIVTDEFGAETTVIL 176

Query: 180 LKYKENTVLDPKVFEI 195
                 +V+   +F I
Sbjct: 177 NDLIAGSVIRDILFNI 192


>gi|126724347|ref|ZP_01740190.1| Putative outer membrane lipoprotein carrier protein
           [Rhodobacterales bacterium HTCC2150]
 gi|126705511|gb|EBA04601.1| Putative outer membrane lipoprotein carrier protein
           [Rhodobacterales bacterium HTCC2150]
          Length = 202

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 30/195 (15%), Positives = 71/195 (36%), Gaps = 7/195 (3%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKG 64
            K ++ + ++   +      A   + +   +     +F  ++  Q  F Q +  G +  G
Sbjct: 1   MKHILKMALI--PALTLGLAATSAMAEKIPLSDISAYFNDLKRAQTEFTQINADGTISTG 58

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN-AKLDTWSVYPLRYMAFSVIFSNNQHV 123
             ++ RP +  F+Y+ P    +I+ GS +A+++         +PL+    ++I   N ++
Sbjct: 59  TLYLHRPGRIRFEYNPPEESLVIAGGSQVAIFDAKSNTPPEQFPLKRTPLNIILERNVNL 118

Query: 124 IQESIQRVESNNS---FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
               +     +      +     +      I + F      L  W I D     + + + 
Sbjct: 119 TNSKMVVGHQDGGNSTTVIAQDPEHPDYGSIELVFTADPVELRQWVINDGGGSQTTVILG 178

Query: 181 KYKENTVLDPKVFEI 195
             +    L   +F I
Sbjct: 179 LMERKEKLPASLFSI 193


>gi|86747504|ref|YP_484000.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris HaA2]
 gi|86570532|gb|ABD05089.1| Outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris HaA2]
          Length = 317

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 39/179 (21%), Positives = 77/179 (43%), Gaps = 5/179 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSP 81
                +   +     K   +  S+ T+ G F+Q    G  ++G+F++ +P K  F+Y  P
Sbjct: 130 SIFTTFDAKQKADAAKVSAYLSSLSTLVGNFVQVGPDGSRLQGDFYIMKPGKVRFEYDEP 189

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIF 141
           S VS++SDG ++AV + KL T  VYPL       + S+   +++++     S++      
Sbjct: 190 SPVSMVSDGQSLAVRDRKLATQDVYPLSQTPLRYLLSDRIDLLRDTNVVAISSDELYISI 249

Query: 142 FKDDFM----GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
             ++       + + +       +L  W + D     + + I         DP +F+I 
Sbjct: 250 IIEERNAVIGTSRLMLMLGVKDGQLKQWTVTDPQGYDTTVAIYNLDTTRRPDPSMFKID 308


>gi|114571485|ref|YP_758165.1| outer membrane lipoprotein carrier protein LolA [Maricaulis maris
           MCS10]
 gi|114341947|gb|ABI67227.1| outer membrane lipoprotein carrier protein LolA [Maricaulis maris
           MCS10]
          Length = 221

 Score =  101 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 78/175 (44%), Gaps = 4/175 (2%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVSLI 87
           P+ ++ ++        SI T++  F+Q    G   +G   ++RP +    Y  P+ + +I
Sbjct: 38  PLDRETALAGINAALNSIDTLRSRFIQIAPDGSSAQGNLALSRPGRLRLDYDEPNPLRII 97

Query: 88  SDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES---IQRVESNNSFITIFFKD 144
           +DG+ IAV +  L+T    PLR      +      + +++       E    ++T+    
Sbjct: 98  ADGTTIAVEDRALETVDRIPLRSTPLWWLLKPEIDIAEDAAIVSLEREFGFLYLTLRDPS 157

Query: 145 DFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           D M   I   F +  + L  W + D+    + + ++  + +  L+P++F IP  +
Sbjct: 158 DEMEGEIMFVFSQSDHALREWFVTDALGEITRVSLIDVQSDVTLNPRIFVIPEPE 212


>gi|194097915|ref|YP_002000961.1| LolA [Neisseria gonorrhoeae NCCP11945]
 gi|193933205|gb|ACF29029.1| LolA [Neisseria gonorrhoeae NCCP11945]
 gi|317163676|gb|ADV07217.1| LolA [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 256

 Score =  101 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 30/202 (14%), Positives = 63/202 (31%), Gaps = 9/202 (4%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VM 62
           K ++    LF + A+     A    +  +V    +       + G+F Q           
Sbjct: 48  KIMMKPHNLFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTA 107

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFS 118
            G F + RP  F ++Y+ P   +++ DG  + +Y+  L   +             +++ +
Sbjct: 108 HGTFKILRPGLFKWEYTLPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAILSN 167

Query: 119 NNQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                   +++   S+N                  +        L   ++ DS    + I
Sbjct: 168 KTALESSYTLKEDGSSNGIDYVRATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQTSI 227

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
                  N  L    F+    K
Sbjct: 228 SFGGLNTNPQLSRGAFKFTPPK 249


>gi|49474727|ref|YP_032769.1| Outer membrane lipoprotein carrier protein [Bartonella quintana
           str. Toulouse]
 gi|49240231|emb|CAF26701.1| Outer membrane lipoprotein carrier protein [Bartonella quintana
           str. Toulouse]
          Length = 202

 Score =  101 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 46/200 (23%), Positives = 86/200 (43%), Gaps = 3/200 (1%)

Query: 2   AFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGY 60
           +FL  K +   + +  +  +     +    K    +K   HF +I+TM G F+Q    G 
Sbjct: 4   SFLPRKRIFWFIGIIVFCCLTFPAFSQSSKKVVKAQKIANHFAAIKTMTGDFIQFSPKGK 63

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
           + +G F++ RP K  F Y     + +I+DG  I + N  L+TW+  PL       +  + 
Sbjct: 64  MSQGTFYLERPGKIRFIYKKIP-LQIIADGQFIGINNRALNTWNFSPLFQTPMKFLLDDE 122

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFM-GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
            ++    +     +   +T+  +D       I + FD  +Y L  W I+D     + ++I
Sbjct: 123 INLSSGRLLAFREDPGAVTVILRDKSTGSGQIKMVFDPKTYTLRQWTIIDQQSLETTVQI 182

Query: 180 LKYKENTVLDPKVFEIPYDK 199
           +  +       K+F +P  K
Sbjct: 183 MNVRTGVKFADKMFTLPSKK 202


>gi|91974923|ref|YP_567582.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris BisB5]
 gi|91681379|gb|ABE37681.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris BisB5]
          Length = 315

 Score =  101 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 37/179 (20%), Positives = 75/179 (41%), Gaps = 5/179 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSP 81
                +   +     +   +  S+ T+ G F+Q    G  +KG+F++ +P K  F+Y  P
Sbjct: 128 SIFTTFDAKQKADAARVSAYLSSLSTLVGNFVQVGPDGSKLKGDFYIMKPGKVRFEYDEP 187

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES----IQRVESNNSF 137
           S +S++++G ++ V + KL T  +YPL       + S+   +++++    I   E   S 
Sbjct: 188 SPISMVANGQSLVVRDRKLATQDIYPLSQTPLRYLLSDRIDLLRDTSVVAITSDELYISI 247

Query: 138 ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
           I          + + +       +L  W + D     + + I         DP +F+I 
Sbjct: 248 IIEEKNAVIGTSRLMLMLGVKDGQLKQWTVTDPQGYDTTVAIYNLDTARRPDPAMFKID 306


>gi|91775478|ref|YP_545234.1| outer membrane lipoprotein carrier protein LolA [Methylobacillus
           flagellatus KT]
 gi|122400017|sp|Q1H294|LOLA_METFK RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|91709465|gb|ABE49393.1| outer membrane lipoprotein carrier protein LolA [Methylobacillus
           flagellatus KT]
          Length = 205

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 28/195 (14%), Positives = 60/195 (30%), Gaps = 11/195 (5%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFM 68
               + +          +   V+     F S   M+  F Q            ++G   +
Sbjct: 3   FLAVATMVVALMVPWSVRADGVESLKAFFKSTSAMRAHFRQVVTDAQGNKVQEVEGHMQL 62

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVI 124
            RP KF + Y+ P    ++ DG  + +Y+  L+  +V P+         S++        
Sbjct: 63  QRPGKFRWDYNKPYVQQIVGDGEKVWLYDPDLNQLTVRPMSKAIGSSPASLLAGAQDAER 122

Query: 125 QESIQRVESNNSFITIFF-KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
             ++  V  ++                  V        L   ++ DS    + I+  + +
Sbjct: 123 NFTLTTVIRSDGLAWAQAVPKAEDSGFDKVLLGFKGDELQKMELHDSFGHVTSIQFSQLQ 182

Query: 184 ENTVLDPKVFEIPYD 198
            N  +    F+    
Sbjct: 183 RNPAIANSSFQFVVP 197


>gi|56698238|ref|YP_168611.1| outer membrane lipoprotein carrier protein LolA, putative [Ruegeria
           pomeroyi DSS-3]
 gi|56679975|gb|AAV96641.1| outer membrane lipoprotein carrier protein LolA, putative [Ruegeria
           pomeroyi DSS-3]
          Length = 198

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 28/169 (16%), Positives = 69/169 (40%), Gaps = 5/169 (2%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLIS 88
                 + +   +   ++T+Q TF Q  D G +  G+ ++ RP +  F+Y  P    +++
Sbjct: 19  AADKLPLAEISTYLNGLKTVQTTFTQINDDGSLSTGKLWLHRPGRMRFEYDPPDRSVVLA 78

Query: 89  DGSNIAVYNAK-LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNS---FITIFFKD 144
            G  + +++ K       YPL     S++ +    + + ++    + +     +T    +
Sbjct: 79  KGGTVIIHDPKSNQPPEQYPLNRTPLSIVLARTVDLDRANMVVGHAFDGTATVVTAQDPE 138

Query: 145 DFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
           +     I ++F      L  W I D +   + + + +  +   L+  +F
Sbjct: 139 NPDYGRIELSFTGDPVELRKWVIHDGAGSRTTVILGQLTKGNSLNQNLF 187


>gi|307943516|ref|ZP_07658860.1| outer membrane lipoprotein carrier protein LolA [Roseibium sp.
           TrichSKD4]
 gi|307773146|gb|EFO32363.1| outer membrane lipoprotein carrier protein LolA [Roseibium sp.
           TrichSKD4]
          Length = 214

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 46/185 (24%), Positives = 89/185 (48%), Gaps = 4/185 (2%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFY 75
              A+     A    + +++     +F S++TM G F+Q    G   +G+F++ARP K  
Sbjct: 20  LCLALSAQAFALTDAQKKTLNDVNTYFNSVKTMHGDFVQFGPDGSQSEGKFYLARPGKVR 79

Query: 76  FKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE---SIQRVE 132
           F YS P+ + +I+DG +++V + KL T  ++PL       + + N ++  E       VE
Sbjct: 80  FYYSPPAKLDIIADGKSVSVKDRKLATQDIWPLGQTPLRFLLAENINLQSEATIQNVIVE 139

Query: 133 SNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
           S+   + +  K  F   ++++ F+  +Y L  W + D+    + + +     N   +P +
Sbjct: 140 SDLVTVVLEDKTTFNSGILTLIFEADTYELKQWTVTDAQGFDTSVAVYNVVSNGPTNPDL 199

Query: 193 FEIPY 197
           F I Y
Sbjct: 200 FRIDY 204


>gi|294678843|ref|YP_003579458.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           capsulatus SB 1003]
 gi|294477663|gb|ADE87051.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           capsulatus SB 1003]
          Length = 203

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 32/194 (16%), Positives = 67/194 (34%), Gaps = 4/194 (2%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKG 64
              +    +      +    AA    +   + +   +   + T +  F Q +  G    G
Sbjct: 1   MIQMRFAPVAALLPVLMLALAAPAWAEKIPLAQLSAYLNGLTTAEAAFTQVNADGSKSTG 60

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
           + ++ RP +  F+YS   ++ L S G               YPL+    ++I ++   + 
Sbjct: 61  KLYLKRPGRMRFEYSDDDTLVLASGGQVAIFDPKSNQIAEQYPLKRTPLNLILADRIDLA 120

Query: 125 QESI---QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           Q  +      E  N+ +      +     I + F      L  W I D +   +++ + +
Sbjct: 121 QARMVVGHEAEGANTAVVAQDPQNPDYGTIRLVFSANPVTLRRWVITDDTGAKTVVILDQ 180

Query: 182 YKENTVLDPKVFEI 195
            K      P +F I
Sbjct: 181 LKPGVDPGPLMFSI 194


>gi|268594248|ref|ZP_06128415.1| periplasmic carrier protein [Neisseria gonorrhoeae 35/02]
 gi|268596246|ref|ZP_06130413.1| periplasmic carrier protein [Neisseria gonorrhoeae FA19]
 gi|291044468|ref|ZP_06570177.1| outer-membrane lipoprotein carrier protein [Neisseria gonorrhoeae
           DGI2]
 gi|293397602|ref|ZP_06641808.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           gonorrhoeae F62]
 gi|268547637|gb|EEZ43055.1| periplasmic carrier protein [Neisseria gonorrhoeae 35/02]
 gi|268550034|gb|EEZ45053.1| periplasmic carrier protein [Neisseria gonorrhoeae FA19]
 gi|291011362|gb|EFE03358.1| outer-membrane lipoprotein carrier protein [Neisseria gonorrhoeae
           DGI2]
 gi|291611548|gb|EFF40617.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           gonorrhoeae F62]
          Length = 235

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 30/202 (14%), Positives = 63/202 (31%), Gaps = 9/202 (4%)

Query: 7   KSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VM 62
           K ++    LF + A+     A    +  +V    +       + G+F Q           
Sbjct: 27  KIMMKPHNLFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTA 86

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFS 118
            G F + RP  F ++Y+ P   +++ DG  + +Y+  L   +             +++ +
Sbjct: 87  HGTFKILRPGLFKWEYTLPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAILSN 146

Query: 119 NNQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                   +++   S+N                  +        L   ++ DS    + I
Sbjct: 147 KTALESSYTLKEDGSSNGIDYVRATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQTSI 206

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
                  N  L    F+    K
Sbjct: 207 SFGGLNTNPQLSRGAFKFTPPK 228


>gi|85704070|ref|ZP_01035173.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseovarius sp. 217]
 gi|85671390|gb|EAQ26248.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseovarius sp. 217]
          Length = 201

 Score =  101 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 34/196 (17%), Positives = 74/196 (37%), Gaps = 9/196 (4%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKG 64
            K +  +++   +       A     +  S+ +   +   ++T QG F Q +  G +  G
Sbjct: 1   MKHMRILMVPVLW----AAMALPAAAEKLSLGEISTYLNGLKTAQGAFTQINEDGTISTG 56

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHV 123
              + RP +  F+Y  P    +++DG  + + + + +     YPL      +I + N  +
Sbjct: 57  RILIKRPGRVRFEYDPPEEALVVADGDTVGIIDPRSNDGPQGYPLNRTPLKIILARNVDL 116

Query: 124 IQESIQRVESNNSF---ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
            +E +     ++     +      +     I + F      L  W I D S   + + + 
Sbjct: 117 TRERMVVGYGSDGTSTTVRAQDPANPEYGSIDLVFTGNPVELRQWVIHDGSGSQTTVVLG 176

Query: 181 KYKENTVLDPKVFEIP 196
             + +  L+   F IP
Sbjct: 177 DMQRDVRLNDDSFVIP 192


>gi|92114553|ref|YP_574481.1| outer-membrane lipoprotein carrier protein [Chromohalobacter
           salexigens DSM 3043]
 gi|122990444|sp|Q1QUS6|LOLA_CHRSD RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|91797643|gb|ABE59782.1| outer membrane lipoprotein carrier protein LolA [Chromohalobacter
           salexigens DSM 3043]
          Length = 210

 Score =  101 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 27/203 (13%), Positives = 66/203 (32%), Gaps = 14/203 (6%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YV 61
                 +    +   P  A          ++      S+ +    F Q+           
Sbjct: 2   RAFKWALAIGATLALPLTAQAQTGGA---ERLAALLESVTSYSADFDQQILDGGGQRLQE 58

Query: 62  MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW-----SVYPLRYMAFSVI 116
            +G  +++RP KF+++  +P    ++SDG  + +Y+  L+               A  + 
Sbjct: 59  AEGHMWLSRPGKFHWEVEAPYRQVVVSDGDKVYLYDPDLEQVSVRPLDTRVTHTPALLLS 118

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
            S +      +++  + ++                S+     + RL   ++ DS+ + + 
Sbjct: 119 GSADALTENYAVESRQGDDEETFTLTPKSPDTLFESLQLTFENERLEGLQMEDSTGQRTA 178

Query: 177 IKILKYKENTVLDPKVFEIPYDK 199
           I     + N  +D   F     +
Sbjct: 179 IAFDDIEVNGDIDASRFTFEIPE 201


>gi|332559961|ref|ZP_08414283.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides WS8N]
 gi|332277673|gb|EGJ22988.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides WS8N]
          Length = 197

 Score =  101 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 29/172 (16%), Positives = 61/172 (35%), Gaps = 5/172 (2%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           +   +     +   + T +  F Q +  G V  G  F+ RP +  F+Y+ P    +++ G
Sbjct: 20  EKIPLSALSSYLNGLSTAEADFTQVNADGSVSTGRIFIKRPGRVRFEYAPPEKSLVVAGG 79

Query: 91  SNIAVYN-AKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSF---ITIFFKDDF 146
             +A+++         YPL     S+I + N  + +  +      +     +        
Sbjct: 80  GQVAIFDAKSNQPPEQYPLSRTPLSLILAQNIDLGRAKMVVGHREDKNTTRVVAQDPAHP 139

Query: 147 MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
               I + F      L  W I D +   + + +    +   L   +F I  +
Sbjct: 140 EYGTIEMVFTANPVALRQWVITDDAGNQTTVILGAMAQGRNLPASLFSIQSE 191


>gi|221640987|ref|YP_002527249.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides KD131]
 gi|221161768|gb|ACM02748.1| Outer membrane lipoprotein carrier protein LolA precursor
           [Rhodobacter sphaeroides KD131]
          Length = 200

 Score =  101 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 29/172 (16%), Positives = 61/172 (35%), Gaps = 5/172 (2%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           +   +     +   + T +  F Q +  G V  G  F+ RP +  F+Y+ P    +++ G
Sbjct: 23  EKIPLSALSSYLNGLSTAEADFTQVNADGSVSTGRIFIKRPGRVRFEYAPPEKSLVVAGG 82

Query: 91  SNIAVYN-AKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSF---ITIFFKDDF 146
             +A+++         YPL     S+I + N  + +  +      +     +        
Sbjct: 83  GQVAIFDAKSNQPPEQYPLSRTPLSLILAQNIDLGRAKMVVGHREDKNTTRVVAQDPAHP 142

Query: 147 MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
               I + F      L  W I D +   + + +    +   L   +F I  +
Sbjct: 143 EYGTIEMVFTANPVALRQWVITDDAGNQTTVILGAMAQGRNLPASLFSIQSE 194


>gi|77462034|ref|YP_351538.1| putative outer membrane lipoprotein carrier protein [Rhodobacter
           sphaeroides 2.4.1]
 gi|126460924|ref|YP_001042038.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides ATCC 17029]
 gi|77386452|gb|ABA77637.1| Putative outer membrane lipoprotein carrier protein [Rhodobacter
           sphaeroides 2.4.1]
 gi|126102588|gb|ABN75266.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 212

 Score =  101 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 29/172 (16%), Positives = 61/172 (35%), Gaps = 5/172 (2%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           +   +     +   + T +  F Q +  G V  G  F+ RP +  F+Y+ P    +++ G
Sbjct: 35  EKIPLSALSSYLNGLSTAEADFTQVNADGSVSTGRIFIKRPGRVRFEYAPPEKSLVVAGG 94

Query: 91  SNIAVYN-AKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSF---ITIFFKDDF 146
             +A+++         YPL     S+I + N  + +  +      +     +        
Sbjct: 95  GQVAIFDAKSNQPPEQYPLSRTPLSLILAQNIDLGRAKMVVGHREDKNTTRVVAQDPAHP 154

Query: 147 MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
               I + F      L  W I D +   + + +    +   L   +F I  +
Sbjct: 155 EYGTIEMVFTANPVALRQWVITDDAGNQTTVILGAMAQGRNLPASLFSIQSE 206


>gi|170750146|ref|YP_001756406.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656668|gb|ACB25723.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           radiotolerans JCM 2831]
          Length = 302

 Score =  101 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 38/174 (21%), Positives = 77/174 (44%), Gaps = 5/174 (2%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVSLI 87
                  + +A  +F  I T+ G F+Q    G  + G+  +A+P +  F Y  PS + ++
Sbjct: 112 SADPATLLAQANAYFNGINTLSGNFVQIGADGRRIGGKLTLAKPGRLRFDYDQPSPLEVV 171

Query: 88  SDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFKDDF 146
           +DG+++AV + KL+T  +Y +       +      + ++ ++  V S+   + I  +D  
Sbjct: 172 ADGTSVAVRDRKLNTQDLYFIAQTPLKFLLREKIDLARDLTVTDVASDPGSVRISLEDRA 231

Query: 147 MGN---MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
                  I + FD     L  W+I D     + + +   ++   +D  +F I Y
Sbjct: 232 TLGGTSKIQLFFDAEMKTLSQWRITDPQGYVTTVTLSNLQKGKSVDGSLFFINY 285


>gi|306843438|ref|ZP_07476039.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. BO1]
 gi|306276129|gb|EFM57829.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. BO1]
          Length = 223

 Score =  101 bits (250), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 52/196 (26%), Positives = 91/196 (46%), Gaps = 4/196 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFF 67
           ++G+ +     A  P  A        + ++  +HF S +TM G F+Q    G    G F+
Sbjct: 23  ILGIGVAGAALAPVPVMAQGADGGIATAQQIADHFSSARTMTGEFVQFGPRGEQTGGTFY 82

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           + RP K  F Y++   + +ISDG ++ + N KLDTW +YPL      ++ ++   +    
Sbjct: 83  IERPGKIRFNYNNSP-IRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGR 141

Query: 128 IQRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +Q V+      T+    K  F  + I++ FD  SY L  W I D+ +  + + I   +  
Sbjct: 142 LQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTG 201

Query: 186 TVLDPKVFEIPYDKIH 201
                 +F+I Y +I 
Sbjct: 202 VRFTNDMFKIDYQRIA 217


>gi|309378974|emb|CBX22427.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 206

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/194 (15%), Positives = 63/194 (32%), Gaps = 9/194 (4%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMAR 70
           LF + A+     +    +  +V    +       + G+F Q            G F + R
Sbjct: 6   LFQFLAVCSLTVSVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 65

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+SP   +++ DG  + +Y+  L   +             +++ +        
Sbjct: 66  PGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAILSNKTALESSY 125

Query: 127 SIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +++   S+N     +            +        L   ++ DS    + I       N
Sbjct: 126 TLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQTSISFGGLNTN 185

Query: 186 TVLDPKVFEIPYDK 199
             L   VF+    K
Sbjct: 186 PQLSRGVFKFTPPK 199


>gi|23502851|ref|NP_698978.1| hypothetical protein BR2003 [Brucella suis 1330]
 gi|256370403|ref|YP_003107914.1| outer membrane lipoprotein carrier protein LolA [Brucella microti
           CCM 4915]
 gi|23348877|gb|AAN30893.1| conserved hypothetical protein [Brucella suis 1330]
 gi|256000566|gb|ACU48965.1| outer membrane lipoprotein carrier protein LolA [Brucella microti
           CCM 4915]
          Length = 230

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 4/196 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFF 67
           ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G    G F+
Sbjct: 30  ILGVGVAGAALAPVPVKAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRGEQTGGTFY 89

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           + RP K  F Y++   + +ISDG ++ + N KLDTW +YPL      ++ ++   +    
Sbjct: 90  IERPGKIRFNYNNSP-IRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGR 148

Query: 128 IQRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +Q V+      T+    K  F  + I++ FD  SY L  W I D+ +  + + I   +  
Sbjct: 149 LQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTG 208

Query: 186 TVLDPKVFEIPYDKIH 201
                 +F+I Y +I 
Sbjct: 209 VRFTNDMFKIDYQRIA 224


>gi|319409387|emb|CBI83031.1| lipoprotein carrier protein [Bartonella schoenbuchensis R1]
          Length = 212

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 47/203 (23%), Positives = 85/203 (41%), Gaps = 3/203 (1%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYV 61
           +L  + V  V        +   + A    +    +    HF  I+TM G F+Q    G +
Sbjct: 5   YLSSRRVFIVFGFIICVLLAVPSFAQSSRQVARAQAIANHFSEIKTMTGDFIQFSPKGKM 64

Query: 62  MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQ 121
            +G F++ RP +  F Y     + +I+DG  + V N  L+TW++Y L       +  +  
Sbjct: 65  SEGTFYLERPGRIRFGY-KGVPLQIIADGKMVGVNNRALNTWNLYQLSQTPMKFLLDDKI 123

Query: 122 HVIQESIQRVESNNSFITIFFKDDFM-GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
           ++  +++  +  +   ITI   D  +    I + FD   Y L  W I+D     + ++I+
Sbjct: 124 NISSKNLLALREDPGVITIVLHDKSIGKGQIRMIFDSKDYSLRQWTIVDQQNLETTVQIM 183

Query: 181 KYKENTVLDPKVFEIPYDKIHNI 203
             +        +F IPY  I   
Sbjct: 184 NVRTGIRFVDGMFTIPYKNIAIS 206


>gi|332187682|ref|ZP_08389417.1| outer membrane lipocarrier LolA family protein [Sphingomonas sp.
           S17]
 gi|332012248|gb|EGI54318.1| outer membrane lipocarrier LolA family protein [Sphingomonas sp.
           S17]
          Length = 206

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/200 (14%), Positives = 72/200 (36%), Gaps = 9/200 (4%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQ-SVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEF 66
           ++   +L   +          + +    +        ++ TM   F Q D  G V+ G  
Sbjct: 1   MMASALLAPTAMAMVAAPVPALAQAGGDLAAVQRSLQALTTMTADFTQTDRAGKVLTGTL 60

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE 126
            M +P K  F+Y     + +++DG  +   +  +     +P++     V+   ++ + + 
Sbjct: 61  TMKKPGKIRFQYEKGVPLLIVADGGALTFIDYSVRQVQRWPIKNSPLGVLIDPSRDIGRY 120

Query: 127 SIQRVESNNSFITI--FFKDDFMGNMISVTFDRLS-----YRLLNWKIMDSSRRYSIIKI 179
           +     +++  +++            I++ F R         L  W  +DS    + I++
Sbjct: 121 AKVVPSADSRLLSVEANDPKHPEYGKITLVFARDPAAPGGLMLQGWVALDSQNNRTTIRL 180

Query: 180 LKYKENTVLDPKVFEIPYDK 199
              +    +D K F     +
Sbjct: 181 SNQRYGVAVDDKAFRFNDPR 200


>gi|306842864|ref|ZP_07475502.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. BO2]
 gi|306286986|gb|EFM58501.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. BO2]
          Length = 223

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 4/196 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFF 67
           ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G    G F+
Sbjct: 23  ILGVGVAGAALAPVPVMAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRGEQTGGTFY 82

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           + RP K  F Y++   + +ISDG ++ + N KLDTW +YPL      ++ ++   +    
Sbjct: 83  IERPGKIRFNYNNSP-IRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGR 141

Query: 128 IQRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +Q V+      T+    K  F  + I++ FD  SY L  W I D+ +  + + I   +  
Sbjct: 142 LQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTG 201

Query: 186 TVLDPKVFEIPYDKIH 201
                 +F+I Y +I 
Sbjct: 202 VRFTNDMFKIDYQRIA 217


>gi|15676525|ref|NP_273666.1| outer membrane lipoprotein carrier protein [Neisseria meningitidis
           MC58]
 gi|9977680|sp|P57068|LOLA_NEIMB RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|7225852|gb|AAF41048.1| outer membrane lipoprotein carrier protein [Neisseria meningitidis
           MC58]
 gi|325133862|gb|EGC56518.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis M13399]
 gi|325139826|gb|EGC62358.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis CU385]
 gi|325200691|gb|ADY96146.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis H44/76]
          Length = 207

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 61/194 (31%), Gaps = 9/194 (4%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+ P   +++ DG  + +Y+  L   +             +++ +        
Sbjct: 67  PGLFKWEYTKPYRQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAILSNKTALESSY 126

Query: 127 SIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +++   S+N     +            +        L   ++ DS    + I       N
Sbjct: 127 TLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQTSISFGGLNTN 186

Query: 186 TVLDPKVFEIPYDK 199
             L    F+    K
Sbjct: 187 PQLSRGAFKFTPPK 200


>gi|261217825|ref|ZP_05932106.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M13/05/1]
 gi|261221053|ref|ZP_05935334.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           B1/94]
 gi|261314961|ref|ZP_05954158.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis M163/99/10]
 gi|261316481|ref|ZP_05955678.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis B2/94]
 gi|261321327|ref|ZP_05960524.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M644/93/1]
 gi|261323945|ref|ZP_05963142.1| outer membrane lipoprotein carrier protein LolA [Brucella neotomae
           5K33]
 gi|261751146|ref|ZP_05994855.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           5 str. 513]
 gi|261755708|ref|ZP_05999417.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           3 str. 686]
 gi|265987554|ref|ZP_06100111.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis M292/94/1]
 gi|265992026|ref|ZP_06104583.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265993763|ref|ZP_06106320.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 3 str. Ether]
 gi|265997014|ref|ZP_06109571.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M490/95/1]
 gi|260919637|gb|EEX86290.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           B1/94]
 gi|260922914|gb|EEX89482.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M13/05/1]
 gi|261294017|gb|EEX97513.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M644/93/1]
 gi|261295704|gb|EEX99200.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis B2/94]
 gi|261299925|gb|EEY03422.1| outer membrane lipoprotein carrier protein LolA [Brucella neotomae
           5K33]
 gi|261303987|gb|EEY07484.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis M163/99/10]
 gi|261740899|gb|EEY28825.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           5 str. 513]
 gi|261745461|gb|EEY33387.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           3 str. 686]
 gi|262551482|gb|EEZ07472.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M490/95/1]
 gi|262764744|gb|EEZ10665.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 3 str. Ether]
 gi|263003092|gb|EEZ15385.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|264659751|gb|EEZ30012.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis M292/94/1]
 gi|326410000|gb|ADZ67065.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis M28]
 gi|326539717|gb|ADZ87932.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis M5-90]
          Length = 225

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 4/196 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFF 67
           ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G    G F+
Sbjct: 25  ILGVGVAGAALAPVPVKAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRGEQTGGTFY 84

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           + RP K  F Y++   + +ISDG ++ + N KLDTW +YPL      ++ ++   +    
Sbjct: 85  IERPGKIRFNYNNSP-IRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGR 143

Query: 128 IQRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +Q V+      T+    K  F  + I++ FD  SY L  W I D+ +  + + I   +  
Sbjct: 144 LQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTG 203

Query: 186 TVLDPKVFEIPYDKIH 201
                 +F+I Y +I 
Sbjct: 204 VRFTNDMFKIDYQRIA 219


>gi|84687991|ref|ZP_01015855.1| Putative outer membrane lipoprotein carrier protein [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84664023|gb|EAQ10523.1| Putative outer membrane lipoprotein carrier protein
           [Rhodobacterales bacterium HTCC2654]
          Length = 195

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/169 (16%), Positives = 68/169 (40%), Gaps = 5/169 (2%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           +  S+     +   ++T Q  F Q +  G +  G  ++ RP +  F+Y+ P    +++  
Sbjct: 18  QQLSLGALSTYLNGLKTAQAEFTQINADGTISTGTIYIKRPGRARFEYNPPEQTLVLASA 77

Query: 91  SNIAVYN-AKLDTWSVYPLRYMAFSVIFSNNQHVIQESI---QRVESNNSFITIFFKDDF 146
             +A+++         YPL     ++I + N  + +  +      +   + +T    +  
Sbjct: 78  GQLAIFDAKSNTGPEQYPLARTPLNLILAQNVDLGRNGMVVGHNYDGTATTVTAQDPEHP 137

Query: 147 MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
               I +TF      L  W I D + + + + + + ++   +  + F I
Sbjct: 138 EYGNIQLTFTGNPTELRQWVITDDAGQQTTVVLGELRKGGTISDRNFSI 186


>gi|49476205|ref|YP_034246.1| Outer membrane lipoprotein carrier protein [Bartonella henselae
           str. Houston-1]
 gi|49239013|emb|CAF28313.1| Outer membrane lipoprotein carrier protein [Bartonella henselae
           str. Houston-1]
          Length = 202

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 47/200 (23%), Positives = 86/200 (43%), Gaps = 3/200 (1%)

Query: 2   AFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGY 60
            FLL + +   V +  +S +     +    K    +K   HF +I+TM G F+Q    G 
Sbjct: 4   FFLLRRRIFAFVGILIFSCLTFPAFSQSSNKVARAQKIANHFAAIKTMTGDFIQFSPKGK 63

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
           + +G F++ RP K  F Y     + +I+DG  I + N  L+TW+   L       +  + 
Sbjct: 64  MSQGTFYLERPGKIRFIYKKIP-LQIIADGQFIGINNRALNTWNFSKLFQTPMKFLLDDK 122

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFM-GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
            ++    +     +   +TI  +D  +    I + FD  +Y L  W I+D     + ++I
Sbjct: 123 INISSGRLLAFREDPGAVTIVLRDKSVGAGQIRMVFDSKTYSLRQWTIVDQQNLETTVQI 182

Query: 180 LKYKENTVLDPKVFEIPYDK 199
           +  +        +F +P  K
Sbjct: 183 MNVRTGVRFADGMFTLPSKK 202


>gi|161619920|ref|YP_001593807.1| outer membrane lipoprotein carrier protein LolA [Brucella canis
           ATCC 23365]
 gi|163844024|ref|YP_001628428.1| outer membrane lipoprotein carrier protein LolA [Brucella suis ATCC
           23445]
 gi|225853438|ref|YP_002733671.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis ATCC 23457]
 gi|254700640|ref|ZP_05162468.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           5 str. 513]
 gi|254705009|ref|ZP_05166837.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           3 str. 686]
 gi|254707473|ref|ZP_05169301.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis M163/99/10]
 gi|254708985|ref|ZP_05170796.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis B2/94]
 gi|254713586|ref|ZP_05175397.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M644/93/1]
 gi|254716060|ref|ZP_05177871.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M13/05/1]
 gi|256030512|ref|ZP_05444126.1| outer membrane lipoprotein carrier protein LolA [Brucella
           pinnipedialis M292/94/1]
 gi|256045603|ref|ZP_05448483.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256059973|ref|ZP_05450157.1| outer membrane lipoprotein carrier protein LolA [Brucella neotomae
           5K33]
 gi|256112330|ref|ZP_05453251.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 3 str. Ether]
 gi|256158497|ref|ZP_05456395.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           M490/95/1]
 gi|256253916|ref|ZP_05459452.1| outer membrane lipoprotein carrier protein LolA [Brucella ceti
           B1/94]
 gi|256263082|ref|ZP_05465614.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 2 str. 63/9]
 gi|260562911|ref|ZP_05833397.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 1 str. 16M]
 gi|260567519|ref|ZP_05837989.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           4 str. 40]
 gi|294851236|ref|ZP_06791909.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. NVSL
           07-0026]
 gi|161336731|gb|ABX63036.1| outer membrane lipoprotein carrier protein LolA [Brucella canis
           ATCC 23365]
 gi|163674747|gb|ABY38858.1| outer membrane lipoprotein carrier protein LolA [Brucella suis ATCC
           23445]
 gi|225641803|gb|ACO01717.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis ATCC 23457]
 gi|260152927|gb|EEW88019.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 1 str. 16M]
 gi|260157037|gb|EEW92117.1| outer membrane lipoprotein carrier protein LolA [Brucella suis bv.
           4 str. 40]
 gi|263092974|gb|EEZ17135.1| outer membrane lipoprotein carrier protein LolA [Brucella
           melitensis bv. 2 str. 63/9]
 gi|294819825|gb|EFG36824.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. NVSL
           07-0026]
          Length = 231

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 4/196 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFF 67
           ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G    G F+
Sbjct: 31  ILGVGVAGAALAPVPVKAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRGEQTGGTFY 90

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           + RP K  F Y++   + +ISDG ++ + N KLDTW +YPL      ++ ++   +    
Sbjct: 91  IERPGKIRFNYNNSP-IRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGR 149

Query: 128 IQRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +Q V+      T+    K  F  + I++ FD  SY L  W I D+ +  + + I   +  
Sbjct: 150 LQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTG 209

Query: 186 TVLDPKVFEIPYDKIH 201
                 +F+I Y +I 
Sbjct: 210 VRFTNDMFKIDYQRIA 225


>gi|325127764|gb|EGC50673.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis N1568]
 gi|325137977|gb|EGC60552.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis ES14902]
          Length = 206

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 62/194 (31%), Gaps = 9/194 (4%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMAR 70
           LF + A+     +    +  +V    +       + G+F Q            G F + R
Sbjct: 6   LFQFLAVCSLTVSVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 65

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+SP   +++ DG  + +Y+  L   +             +++ +        
Sbjct: 66  PGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAILSNKTALESSY 125

Query: 127 SIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +++   S+N     +            +        L   ++ DS    + I       N
Sbjct: 126 TLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQTSISFGGLNTN 185

Query: 186 TVLDPKVFEIPYDK 199
             L    F+    K
Sbjct: 186 PQLSRGAFKFTPPK 199


>gi|296314994|ref|ZP_06864935.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           polysaccharea ATCC 43768]
 gi|296838194|gb|EFH22132.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           polysaccharea ATCC 43768]
          Length = 207

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/194 (15%), Positives = 63/194 (32%), Gaps = 9/194 (4%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMAR 70
           LF + A+     +    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCSLTVSVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+SP   +++ DG  + +Y+  L   +             +++ +        
Sbjct: 67  PGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAILSNKTALESSY 126

Query: 127 SIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +++   S+N     +            +        L   ++ DS    + I       N
Sbjct: 127 TLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQTSISFGGLNTN 186

Query: 186 TVLDPKVFEIPYDK 199
             L   VF+    K
Sbjct: 187 PQLSRGVFKFTPPK 200


>gi|296448304|ref|ZP_06890196.1| outer membrane lipoprotein carrier protein LolA [Methylosinus
           trichosporium OB3b]
 gi|296254181|gb|EFH01316.1| outer membrane lipoprotein carrier protein LolA [Methylosinus
           trichosporium OB3b]
          Length = 314

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/177 (18%), Positives = 78/177 (44%), Gaps = 5/177 (2%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVS 85
             P+ + +++K+A     +   M   F+Q    G   +G  F+ +  +  F+Y+ P+++ 
Sbjct: 138 QKPLDRAEAIKRAEASLNASPVMTADFVQIGGDGRRAEGRLFIHKVGRMRFEYAQPATME 197

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNS----FITIF 141
           ++SDG  +AV + KL+T  +Y +       + +    + ++        +      I   
Sbjct: 198 VVSDGVTVAVRDRKLNTQDLYFIAQTPLKFLLNEKIDLEKDVKLLDVVIDDAGAAIIIED 257

Query: 142 FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                  + I + FD  ++ L  W++ D     +++ +     ++  DPK+F++  D
Sbjct: 258 KATLGGTSKIKLLFDAKTFDLKQWQVTDPQGYETLVSLFNIDRDSAPDPKLFKVARD 314


>gi|306837612|ref|ZP_07470483.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. NF
           2653]
 gi|306407319|gb|EFM63527.1| outer membrane lipoprotein carrier protein LolA [Brucella sp. NF
           2653]
          Length = 223

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 4/196 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFF 67
           ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G    G F+
Sbjct: 23  ILGVGVAGAALAPVPVMAQGADGGVAAAQQIADHFSSERTMTGEFVQFGPRGEQTGGTFY 82

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           + RP K  F Y++   + +ISDG ++ + N KLDTW +YPL      ++ ++   +    
Sbjct: 83  IERPGKIRFNYNNSP-IRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGR 141

Query: 128 IQRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +Q V+      T+    K  F  + I++ FD  SY L  W I D+ +  + + I   +  
Sbjct: 142 LQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTG 201

Query: 186 TVLDPKVFEIPYDKIH 201
                 +F+I Y +I 
Sbjct: 202 VRFTNDMFKIDYQRIA 217


>gi|99079902|ref|YP_612056.1| outer membrane lipoprotein carrier protein LolA [Ruegeria sp.
           TM1040]
 gi|99036182|gb|ABF62794.1| outer membrane lipoprotein carrier protein LolA [Ruegeria sp.
           TM1040]
          Length = 198

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/198 (18%), Positives = 67/198 (33%), Gaps = 7/198 (3%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKG 64
            K     V      A    +AA    +  S+ +   +  S  T +  F Q  D G +  G
Sbjct: 1   MKQ---FVFALALGATSLASAAASAAEQLSLNEISAYLNSFATAKADFTQVNDDGSLSTG 57

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
             ++ RP K  F+Y+  + + L   G+   +          YPL     S+I + N ++ 
Sbjct: 58  TLYLRRPGKVRFEYADNAGLVLAEAGTVAIMDPKSNQPPETYPLSRTPLSIILARNVNLA 117

Query: 125 QESIQRVESNNSF---ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           Q ++      +     +            I + F     +L  W I   S   + + + +
Sbjct: 118 QANMVVGHGFDGVSTVVRAQDPKAPEHGSIEMMFTDNPVQLRKWVIHGGSGEETTVILGE 177

Query: 182 YKENTVLDPKVFEIPYDK 199
            +        +F I   K
Sbjct: 178 MQTGLSFPSSLFSISRPK 195


>gi|265982998|ref|ZP_06095733.1| outer membrane lipoprotein carrier protein LolA [Brucella sp.
           83/13]
 gi|264661590|gb|EEZ31851.1| outer membrane lipoprotein carrier protein LolA [Brucella sp.
           83/13]
          Length = 225

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 4/196 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFF 67
           ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G    G F+
Sbjct: 25  ILGVGVAGAALAPVPVMAQGADGGVAAAQQIADHFSSERTMTGEFVQFGPRGEQTGGTFY 84

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           + RP K  F Y++   + +ISDG ++ + N KLDTW +YPL      ++ ++   +    
Sbjct: 85  IERPGKIRFNYNNSP-IRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGR 143

Query: 128 IQRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +Q V+      T+    K  F  + I++ FD  SY L  W I D+ +  + + I   +  
Sbjct: 144 LQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTG 203

Query: 186 TVLDPKVFEIPYDKIH 201
                 +F+I Y +I 
Sbjct: 204 VRFTNDMFKIDYQRIA 219


>gi|325203715|gb|ADY99168.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis M01-240355]
          Length = 207

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/194 (15%), Positives = 62/194 (31%), Gaps = 9/194 (4%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+SP   +++ DG  + +Y+  L   +             +++ +        
Sbjct: 67  PGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAILSNKTALESSY 126

Query: 127 SIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +++   S+N     +            +        L   ++ DS    + I       N
Sbjct: 127 TLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQTSISFGGLNTN 186

Query: 186 TVLDPKVFEIPYDK 199
             L    F+    K
Sbjct: 187 PQLSRGAFKFTPPK 200


>gi|254718051|ref|ZP_05179862.1| outer membrane lipoprotein carrier protein LolA [Brucella sp.
           83/13]
          Length = 231

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 4/196 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFF 67
           ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G    G F+
Sbjct: 31  ILGVGVAGAALAPVPVMAQGADGGVAAAQQIADHFSSERTMTGEFVQFGPRGEQTGGTFY 90

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           + RP K  F Y++   + +ISDG ++ + N KLDTW +YPL      ++ ++   +    
Sbjct: 91  IERPGKIRFNYNNSP-IRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGR 149

Query: 128 IQRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +Q V+      T+    K  F  + I++ FD  SY L  W I D+ +  + + I   +  
Sbjct: 150 LQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTG 209

Query: 186 TVLDPKVFEIPYDKIH 201
                 +F+I Y +I 
Sbjct: 210 VRFTNDMFKIDYQRIA 225


>gi|240127592|ref|ZP_04740253.1| LolA [Neisseria gonorrhoeae SK-93-1035]
          Length = 206

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 60/194 (30%), Gaps = 9/194 (4%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 6   LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 65

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+ P   +++ DG  + +Y+  L   +             +++ +        
Sbjct: 66  PGLFKWEYTLPYRQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAILSNKTALESSY 125

Query: 127 SIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +++   S+N                  +        L   ++ DS    + I       N
Sbjct: 126 TLKEDGSSNGIDYVRATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQTSISFGGLNTN 185

Query: 186 TVLDPKVFEIPYDK 199
             L    F+    K
Sbjct: 186 PQLSRGAFKFTPPK 199


>gi|148559543|ref|YP_001259817.1| hypothetical protein BOV_1926 [Brucella ovis ATCC 25840]
 gi|148370800|gb|ABQ60779.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 258

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 4/196 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFF 67
           ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G    G F+
Sbjct: 58  ILGVGVAGAALAPVPVKAQGADGCIAAAQQIADHFSSARTMTGEFVQFGPRGEQTGGTFY 117

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           + RP K  F Y++   + +ISDG ++ + N KLDTW +YPL      ++ ++   +    
Sbjct: 118 IERPGKIRFNYNNSP-IRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGR 176

Query: 128 IQRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +Q V+      T+    K  F  + I++ FD  SY L  W I D+ +  + + I   +  
Sbjct: 177 LQSVKQEPDMTTLVLGDKSVFGDSKITLMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTG 236

Query: 186 TVLDPKVFEIPYDKIH 201
                 +F+I Y +I 
Sbjct: 237 VRFTNDMFKIDYQRIA 252


>gi|313668892|ref|YP_004049176.1| outer-membrane lipoprotein carrier protein [Neisseria lactamica
           ST-640]
 gi|313006354|emb|CBN87817.1| outer-membrane lipoprotein carrier protein [Neisseria lactamica
           020-06]
          Length = 207

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/194 (15%), Positives = 63/194 (32%), Gaps = 9/194 (4%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMAR 70
           LF + A+     +    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCFLTVSVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+SP   +++ DG  + +Y+  L   +             +++ +        
Sbjct: 67  PGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAILSNKTALESSY 126

Query: 127 SIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +++   S+N     +            +        L   ++ DS    + I       N
Sbjct: 127 TLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQTSISFGGLNTN 186

Query: 186 TVLDPKVFEIPYDK 199
             L   VF+    K
Sbjct: 187 PQLSRGVFKFTPPK 200


>gi|163869208|ref|YP_001610460.1| lipoprotein carrier protein [Bartonella tribocorum CIP 105476]
 gi|161018907|emb|CAK02465.1| lipoprotein carrier protein [Bartonella tribocorum CIP 105476]
          Length = 202

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/200 (22%), Positives = 85/200 (42%), Gaps = 3/200 (1%)

Query: 2   AFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGY 60
           +FL  + V G+V +  +  +     +    K    +    HF +I+TM G F+Q    G 
Sbjct: 4   SFLPQRRVFGLVGILVFCCLTFPAFSQSSNKVAKAQNIANHFAAIKTMTGDFIQFSPKGK 63

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
           + +G F++ RP K  F Y     + +I+DG  + + N  L+TW+   L       +  + 
Sbjct: 64  MSQGTFYLERPGKIRFIYKK-MPLQIIADGQFVGINNRALNTWNFSQLSQTPMKFLLDDK 122

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFM-GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
             +    +     +   +TI  +D  +    I + FD  S+ L  W I+D     + ++I
Sbjct: 123 IDLSSGRLLAFREDPGAVTIVLRDKTIGAGQIRMVFDSKSFALRQWTIVDQQNLETTVQI 182

Query: 180 LKYKENTVLDPKVFEIPYDK 199
           +  +        +F +P  K
Sbjct: 183 MNVRTGVRFVQGMFTLPSKK 202


>gi|144897973|emb|CAM74837.1| Outer-membrane lipoprotein carrier protein [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 215

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 72/174 (41%), Gaps = 5/174 (2%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
               V +A  +   I T++  F Q    G V +G  +  RP +   +Y  PS + +++DG
Sbjct: 34  DKADVVRAEAYMNGITTLKARFQQFAPNGNVSEGTAYFWRPGRMRLQYDPPSPILVVADG 93

Query: 91  SNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVES----NNSFITIFFKDDF 146
             + V++ +L   S  PL      V+   N  +  + +             I++   DD 
Sbjct: 94  DFLIVHDQELGEPSYIPLGSTPAGVLVRENVQLNGKDLAVSRVTRAPGVLNISVVESDDP 153

Query: 147 MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKI 200
               I++ F    + L  W+++D+    + + + + +    LD K+F+    K 
Sbjct: 154 AQGEITLVFTEQPFALRQWRVLDAQGSITTVSLYETQSGMTLDRKLFQFSDPKF 207


>gi|121634415|ref|YP_974660.1| putative periplasmic carrier protein [Neisseria meningitidis FAM18]
 gi|218767756|ref|YP_002342268.1| putative periplasmic carrier protein [Neisseria meningitidis Z2491]
 gi|254804505|ref|YP_003082726.1| outer membrane lipoprotein carrier protein [Neisseria meningitidis
           alpha14]
 gi|9977677|sp|P57067|LOLA_NEIMA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|166230493|sp|A1KSN0|LOLA_NEIMF RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|120866121|emb|CAM09860.1| putative periplasmic carrier protein [Neisseria meningitidis FAM18]
 gi|121051764|emb|CAM08070.1| putative periplasmic carrier protein [Neisseria meningitidis Z2491]
 gi|254668047|emb|CBA04479.1| outer membrane lipoprotein carrier protein [Neisseria meningitidis
           alpha14]
 gi|254670792|emb|CBA07125.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis alpha153]
 gi|261393009|emb|CAX50598.1| outer-membrane lipoprotein carrier protein [Neisseria meningitidis
           8013]
 gi|308388808|gb|ADO31128.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis alpha710]
 gi|319410009|emb|CBY90340.1| outer-membrane lipoprotein carrier protein [Neisseria meningitidis
           WUE 2594]
 gi|325129744|gb|EGC52553.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis OX99.30304]
 gi|325131926|gb|EGC54626.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis M6190]
 gi|325135783|gb|EGC58395.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis M0579]
 gi|325141870|gb|EGC64314.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis 961-5945]
 gi|325143992|gb|EGC66302.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis M01-240013]
 gi|325197836|gb|ADY93292.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis G2136]
 gi|325207666|gb|ADZ03118.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis NZ-05/33]
          Length = 207

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 62/194 (31%), Gaps = 9/194 (4%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMAR 70
           LF + A+     +    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCSLTVSVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+SP   +++ DG  + +Y+  L   +             +++ +        
Sbjct: 67  PGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAILSNKTALESSY 126

Query: 127 SIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +++   S+N     +            +        L   ++ DS    + I       N
Sbjct: 127 TLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQTSISFGGLNTN 186

Query: 186 TVLDPKVFEIPYDK 199
             L    F+    K
Sbjct: 187 PQLSRGAFKFTPPK 200


>gi|58040407|ref|YP_192371.1| Outer-membrane lipoprotein carrier protein [Gluconobacter oxydans
           621H]
 gi|58002821|gb|AAW61715.1| Outer-membrane lipoprotein carrier protein [Gluconobacter oxydans
           621H]
          Length = 208

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/206 (13%), Positives = 67/206 (32%), Gaps = 12/206 (5%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYP--------ITKDQSVKKAIEHFLSIQTMQGTFLQ 55
           ++ +S      L     +   + A+               + +  +    + T+Q  F Q
Sbjct: 1   MMNRSFFRAAALVALLPVALPSMAFAQATPAQLRPADQGWISRIEDTLGQVTTLQARFRQ 60

Query: 56  ED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS 114
               G    G   + RP +  F Y  PS + L+++   +   +  +D  +  PL      
Sbjct: 61  TAADGSTTVGTATLDRPGRMRFDYDKPSPLLLVANDGRVVFQDRSVDQVTTIPLDRTPLG 120

Query: 115 VIFSNNQHVIQESIQRV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS 171
           ++      +  +         +    + +          +++        LL W ++D+ 
Sbjct: 121 LLLRPELKLSGDVTVTGFEHSNGQIRVQVVRTQSAGEGTLTLVLSDAPLGLLGWTVVDAQ 180

Query: 172 RRYSIIKILKYKENTVLDPKVFEIPY 197
            R + I +   +    +   +F +P 
Sbjct: 181 GRTTTIALSDVRLGGTVPQSLFVLPK 206


>gi|190893819|ref|YP_001980361.1| outer membrane lipoproteins carrier protein [Rhizobium etli CIAT
           652]
 gi|190699098|gb|ACE93183.1| putative outer membrane lipoproteins carrier protein [Rhizobium
           etli CIAT 652]
          Length = 222

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 51/166 (30%), Positives = 84/166 (50%), Gaps = 3/166 (1%)

Query: 39  AIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
             +HF  + TMQG F+Q    G    G+FF+ RP K  F Y  PS + +I+DG N+A+ N
Sbjct: 50  IADHFSGVTTMQGEFVQFGPRGEQTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNVAIGN 109

Query: 98  AKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISV--TF 155
            KL TW +YPL     S++ + +  +    ++ V+  +   TI   ++ +    ++   F
Sbjct: 110 TKLKTWDLYPLSKTPLSLLLAQHIDLSAGMVKGVKEESDLTTIALGNNTVFGNSTITMMF 169

Query: 156 DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIH 201
           D  +Y L  W I D+  + + + I   K     D +VF +PY+ I 
Sbjct: 170 DPKTYDLRQWTITDNQGKDTSVMIFNVKTGMQFDDRVFRVPYESIP 215


>gi|329114602|ref|ZP_08243361.1| Outer Membrane Lipoprotein Carrier Protein LolA [Acetobacter
           pomorum DM001]
 gi|326696082|gb|EGE47764.1| Outer Membrane Lipoprotein Carrier Protein LolA [Acetobacter
           pomorum DM001]
          Length = 231

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/175 (15%), Positives = 66/175 (37%), Gaps = 4/175 (2%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLI 87
             +    +K+  +     +T Q    Q D  G    G  +M RP +    Y  PS + L+
Sbjct: 56  SASDKAWLKRIEQALNQSKTFQARIQQLDAEGKRTTGTVWMKRPGQMRLAYDPPSPLLLV 115

Query: 88  SDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNS---FITIFFKD 144
           ++G  +   + +LD  +V P+      ++   +  +  +       +++    +T+    
Sbjct: 116 ANGGKVVFRDNQLDQTTVIPIERTPLGLLLRPHVSLTDDVTVTGFQHDNGLVQVTLVRTS 175

Query: 145 DFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                 +++ F      L +W ++D+  R + + +        +    F +P + 
Sbjct: 176 SPGDGSLTLVFYETPVALRSWSVLDAQGRETRVTLFDVHAGADIPASTFVLPAEN 230


>gi|59800658|ref|YP_207370.1| LolA [Neisseria gonorrhoeae FA 1090]
 gi|268685973|ref|ZP_06152835.1| outer-membrane lipoprotein carrier protein [Neisseria gonorrhoeae
           SK-93-1035]
 gi|75432580|sp|Q5FA29|LOLA_NEIG1 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|59717553|gb|AAW88958.1| putative lipoprotein carrier precursor, periplasmic binding
           [Neisseria gonorrhoeae FA 1090]
 gi|268626257|gb|EEZ58657.1| outer-membrane lipoprotein carrier protein [Neisseria gonorrhoeae
           SK-93-1035]
          Length = 207

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 60/194 (30%), Gaps = 9/194 (4%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+ P   +++ DG  + +Y+  L   +             +++ +        
Sbjct: 67  PGLFKWEYTLPYRQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAILSNKTALESSY 126

Query: 127 SIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +++   S+N                  +        L   ++ DS    + I       N
Sbjct: 127 TLKEDGSSNGIDYVRATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQTSISFGGLNTN 186

Query: 186 TVLDPKVFEIPYDK 199
             L    F+    K
Sbjct: 187 PQLSRGAFKFTPPK 200


>gi|222150121|ref|YP_002551078.1| possible lolA type protein [Agrobacterium vitis S4]
 gi|221737103|gb|ACM38066.1| possible lolA type protein [Agrobacterium vitis S4]
          Length = 220

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 86/165 (52%), Gaps = 3/165 (1%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF S++TM G F+Q    G    G+F++ RP K  F Y  PS + +ISDG N+A+ N K
Sbjct: 54  DHFASVKTMMGEFVQFGPRGEQTAGKFYIERPGKLRFNYEQPSPMRVISDGRNVAIGNLK 113

Query: 100 LDTWSVYPLRYMAFSVIFSNNQH--VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDR 157
           + TW VYPL     S++ S+            + E + + I +  K  F    I++ FD 
Sbjct: 114 MKTWDVYPLSKTPLSLLLSDRIDLGHQMVRQVKEEQDLTTIVLGDKSIFGDQTITLMFDP 173

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
            ++ L  W + D+  + + + I   ++    D KVFE+PYD I N
Sbjct: 174 KTFELRQWTVTDAQGKDTSVMIFNVQQGVNFDEKVFEVPYDDIRN 218


>gi|319782044|ref|YP_004141520.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317167932|gb|ADV11470.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 211

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/173 (26%), Positives = 72/173 (41%), Gaps = 3/173 (1%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
             K   +H  S+++M G F+Q        +G FF+ RP K  F Y+  S +S+I+DG ++
Sbjct: 35  DAKTIADHLSSVKSMSGDFVQSGPNAERTRGRFFLQRPGKIRFNYAGQSGISVIADGKSL 94

Query: 94  AVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISV 153
            VYN KL T  +Y L      ++  N        ++ V  + + +T+   D       S+
Sbjct: 95  VVYNRKLKTSRLYALSKTPLKLLLDNKVDFSGNRVKSVRDDGAQVTVKLSDRSTFGNSSI 154

Query: 154 --TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
              FD  S  L  W + D     + + I   K+        F I Y      N
Sbjct: 155 SMVFDSKSLDLRRWSLTDEKGLTTTVNISNVKQGVRAPEGTFVIDYTANREFN 207


>gi|239998388|ref|ZP_04718312.1| LolA [Neisseria gonorrhoeae 35/02]
 gi|240013514|ref|ZP_04720427.1| LolA [Neisseria gonorrhoeae DGI18]
 gi|240015952|ref|ZP_04722492.1| LolA [Neisseria gonorrhoeae FA6140]
 gi|240080093|ref|ZP_04724636.1| LolA [Neisseria gonorrhoeae FA19]
 gi|240112303|ref|ZP_04726793.1| LolA [Neisseria gonorrhoeae MS11]
 gi|240115046|ref|ZP_04729108.1| LolA [Neisseria gonorrhoeae PID18]
 gi|240117331|ref|ZP_04731393.1| LolA [Neisseria gonorrhoeae PID1]
 gi|240120586|ref|ZP_04733548.1| LolA [Neisseria gonorrhoeae PID24-1]
 gi|240122882|ref|ZP_04735838.1| LolA [Neisseria gonorrhoeae PID332]
 gi|240125138|ref|ZP_04738024.1| LolA [Neisseria gonorrhoeae SK-92-679]
          Length = 206

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 60/194 (30%), Gaps = 9/194 (4%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 6   LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 65

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+ P   +++ DG  + +Y+  L   +             +++ +        
Sbjct: 66  PGLFKWEYTLPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAILSNKTALESSY 125

Query: 127 SIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +++   S+N                  +        L   ++ DS    + I       N
Sbjct: 126 TLKEDGSSNGIDYVRATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQTSISFGGLNTN 185

Query: 186 TVLDPKVFEIPYDK 199
             L    F+    K
Sbjct: 186 PQLSRGAFKFTPPK 199


>gi|62290850|ref|YP_222643.1| hypothetical protein BruAb1_1978 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700762|ref|YP_415336.1| hypothetical protein BAB1_2003 [Brucella melitensis biovar Abortus
           2308]
 gi|260546114|ref|ZP_05821854.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           NCTC 8038]
 gi|62196982|gb|AAX75282.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616863|emb|CAJ11959.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
           2308]
 gi|260096221|gb|EEW80097.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           NCTC 8038]
          Length = 230

 Score = 99.6 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 4/196 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFF 67
           ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G    G F+
Sbjct: 30  ILGVGVAGAALAPVPVKAQGEDGGIAAAQQIADHFSSARTMTGEFVQFGPRGEQTGGTFY 89

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           + RP K  F Y++   + +ISDG ++ + N KLDTW +YPL      ++ ++   +    
Sbjct: 90  IERPGKIRFNYNNSP-IRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGR 148

Query: 128 IQRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +Q V+      T+    K  F  + I++ FD  SY L  W I D+ +  + + I   +  
Sbjct: 149 LQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTG 208

Query: 186 TVLDPKVFEIPYDKIH 201
                 +F+I Y +I 
Sbjct: 209 VRFTNDMFKIDYQRIA 224


>gi|149204851|ref|ZP_01881813.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseovarius sp. TM1035]
 gi|149141721|gb|EDM29776.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseovarius sp. TM1035]
          Length = 201

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/170 (18%), Positives = 69/170 (40%), Gaps = 5/170 (2%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           +  S+ +   +   ++T QG F Q +  G +  G   + RP +  F+Y  P    +++DG
Sbjct: 23  EKLSLPEISNYLNGLRTAQGAFTQINEDGTISTGRILIKRPGRVRFEYDPPEQALVVADG 82

Query: 91  SNIAVYNAKLDT-WSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSF---ITIFFKDDF 146
             + + + + +     YPL      +I + N  + +E +    +++     +      + 
Sbjct: 83  DTVGIIDPRSNDGPVGYPLHRTPLKIILARNVDLTRERMVVGHASDGTSTTVRAQDPANP 142

Query: 147 MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
               I + F      L  W I D S   + + +   + +  L+ + F IP
Sbjct: 143 EYGSIDLVFTGSPVELRQWVIHDGSGSQTTVVLGDMQRDVRLNDESFVIP 192


>gi|261214951|ref|ZP_05929232.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 3 str. Tulya]
 gi|260916558|gb|EEX83419.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 3 str. Tulya]
          Length = 223

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 52/196 (26%), Positives = 90/196 (45%), Gaps = 4/196 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFF 67
           ++GV +     A  P           + ++  +HF S +TM G F+Q    G    G F+
Sbjct: 23  ILGVGVAGAALAPVPVKVQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRGEQTGGTFY 82

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           + RP K  F Y++   + +ISDG ++ + N KLDTW +YPL      ++ ++   +    
Sbjct: 83  IERPGKIRFNYNNSP-IRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGR 141

Query: 128 IQRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +Q V+      T+    K  F  + I++ FD  SY L  W I D+ +  + + I   +  
Sbjct: 142 LQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTG 201

Query: 186 TVLDPKVFEIPYDKIH 201
                 +F+I Y +I 
Sbjct: 202 VRFTNDMFKIDYQRIA 217


>gi|260169417|ref|ZP_05756228.1| outer membrane lipoprotein carrier protein LolA [Brucella sp.
           F5/99]
 gi|261758939|ref|ZP_06002648.1| outer membrane lipoprotein carrier protein LolA [Brucella sp.
           F5/99]
 gi|261738923|gb|EEY26919.1| outer membrane lipoprotein carrier protein LolA [Brucella sp.
           F5/99]
          Length = 231

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 4/196 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFF 67
           ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G    G F+
Sbjct: 31  ILGVGVAGAALAPVPVKAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRGEQTGGTFY 90

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           + RP K  F Y++   + +ISDG ++ + N KLDTW +YPL      ++ ++   +    
Sbjct: 91  IERPGKIRFNYNNSP-IRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGR 149

Query: 128 IQRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +Q V+      T+    K  F  + I++ FD  SY L  W I D+ +  + + I   +  
Sbjct: 150 LQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDARKLDTTVMIFNVRTG 209

Query: 186 TVLDPKVFEIPYDKIH 201
                 +F+I Y +I 
Sbjct: 210 VRFTNDMFKIDYQRIA 225


>gi|258542799|ref|YP_003188232.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256633877|dbj|BAH99852.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256636936|dbj|BAI02905.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256639989|dbj|BAI05951.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256643045|dbj|BAI09000.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256646100|dbj|BAI12048.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256649153|dbj|BAI15094.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256652140|dbj|BAI18074.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256655197|dbj|BAI21124.1| outer-membrane lipoprotein carrier protein [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 231

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 29/180 (16%), Positives = 68/180 (37%), Gaps = 4/180 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSP 81
           P   A   +    +K+  +     +T Q    Q D  G    G  +M RP +    Y  P
Sbjct: 50  PVPVALSASDKAWLKRIEQALNQSKTFQARIQQLDAEGKRTTGTVWMKRPGQMRLAYDPP 109

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNS---FI 138
           S + L+++G  +   + +LD  +V P+      ++   +  +  +       +++    +
Sbjct: 110 SPLLLVANGGKVVFRDNQLDQTTVIPIERTPLGLLLRPHVSLTDDVTVTGFQHDNGLVQV 169

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           T+          +++ F      L +W ++D+  R + + +        +    F +P +
Sbjct: 170 TLVRTSSPGDGSLTLVFYETPVALRSWSVLDAQGRETRVTLFDVHAGADIPASTFVLPAE 229


>gi|254465563|ref|ZP_05078974.1| outer membrane lipoprotein carrier protein LolA [Rhodobacterales
           bacterium Y4I]
 gi|206686471|gb|EDZ46953.1| outer membrane lipoprotein carrier protein LolA [Rhodobacterales
           bacterium Y4I]
          Length = 194

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/172 (17%), Positives = 64/172 (37%), Gaps = 5/172 (2%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSL 86
               +  S+ +   +   I T    F Q  D G +  G+ +M RP +  F+Y      ++
Sbjct: 17  SWAAEKLSLNEISRYLNGISTASSPFTQINDDGSLSTGKLYMHRPGRMRFEYDGKGGGTV 76

Query: 87  ISDGSNIAVYNAK-LDTWSVYPLRYMAFSVIFSNNQHVIQESIQ---RVESNNSFITIFF 142
           ++ G  + +++ K       YPL+    S+I      + + ++      +  ++ +    
Sbjct: 77  VAGGGAVVIHDPKSNQPPETYPLKRTPLSIILDRRVDLGRANMVVGYSFDGTSTIVRAQD 136

Query: 143 KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
            +      I + F      L  W I DS+   + + +   K    L   +F 
Sbjct: 137 PEHPDYGSIEMMFTGDPVELRKWVIHDSAGGKTTVILGAMKTGQKLSSSLFT 188


>gi|198282687|ref|YP_002219008.1| outer membrane lipoprotein carrier protein LolA [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218668025|ref|YP_002424879.1| outer membrane lipoprotein carrier protein LolA, putative
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198247208|gb|ACH82801.1| outer membrane lipoprotein carrier protein LolA [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218520238|gb|ACK80824.1| outer membrane lipoprotein carrier protein LolA, putative
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 230

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/195 (14%), Positives = 70/195 (35%), Gaps = 13/195 (6%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMAR 70
           F   +              +    + F    T+   F QE A           G+ +++R
Sbjct: 28  FLVPLLILGGIQLAAAATGLAMLQDFFQKTHTITAQFRQEVANHDGRIVKRTSGKLWISR 87

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P KF + Y   +  +++S+G  + +Y   L+  +V PL         ++I  N+    + 
Sbjct: 88  PGKFRWDYDGRNGQTIVSNGEKVWLYEPALEQATVQPLGKAIGSTPAALIAGNDDLGRRF 147

Query: 127 SIQRVESNNS--FITIFFKDDFMGNMISVTFDRL-SYRLLNWKIMDSSRRYSIIKILKYK 183
            I  +   +   ++ +  K        ++         L   ++ D+ ++ ++++    +
Sbjct: 148 RITDLGEKDGLRWLLLHPKTGQDQGFTALRLGFDAQGALREMRMEDAFQQQTVLRFEHIR 207

Query: 184 ENTVLDPKVFEIPYD 198
            N  +  + F+    
Sbjct: 208 INHPISAQEFQFTPP 222


>gi|260755676|ref|ZP_05868024.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 6 str. 870]
 gi|260758901|ref|ZP_05871249.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 4 str. 292]
 gi|260760625|ref|ZP_05872968.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260884703|ref|ZP_05896317.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 9 str. C68]
 gi|260669219|gb|EEX56159.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 4 str. 292]
 gi|260671057|gb|EEX57878.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260675784|gb|EEX62605.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 6 str. 870]
 gi|260874231|gb|EEX81300.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 9 str. C68]
          Length = 225

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 4/196 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFF 67
           ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G    G F+
Sbjct: 25  ILGVGVAGAALAPVPVKAQGEDGGIAAAQQIADHFSSARTMTGEFVQFGPRGEQTGGTFY 84

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           + RP K  F Y++   + +ISDG ++ + N KLDTW +YPL      ++ ++   +    
Sbjct: 85  IERPGKIRFNYNNSP-IRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGR 143

Query: 128 IQRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +Q V+      T+    K  F  + I++ FD  SY L  W I D+ +  + + I   +  
Sbjct: 144 LQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTG 203

Query: 186 TVLDPKVFEIPYDKIH 201
                 +F+I Y +I 
Sbjct: 204 VRFTNDMFKIDYQRIA 219


>gi|224826931|ref|ZP_03700030.1| outer membrane lipoprotein carrier protein LolA [Lutiella
           nitroferrum 2002]
 gi|224600918|gb|EEG07102.1| outer membrane lipoprotein carrier protein LolA [Lutiella
           nitroferrum 2002]
          Length = 201

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/203 (14%), Positives = 73/203 (35%), Gaps = 18/203 (8%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----V 61
            K ++ +++           A        ++ +        +T+  +F Q  +       
Sbjct: 1   MKKLLPIIL---------AAAFALPAHAAAIAQLKAFVAGSKTLSASFSQVVSAKGKREE 51

Query: 62  MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIF 117
             G+  ++RP KF ++Y+ P    ++ D   + +Y+ +L   +   L         +++ 
Sbjct: 52  ASGQLEISRPGKFRWEYAKPYEQLIVGDSKRLWIYDKELAQVTSKSLDAALGSSPAALLA 111

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGN-MISVTFDRLSYRLLNWKIMDSSRRYSI 176
            +N       ++   + +    +        N   S+     +  L+  ++ DS    ++
Sbjct: 112 GSNAIERDYHLKEAGAQDGIEWLSAAPKKSENTFQSIRMGFRANTLVTMELHDSFGNTTL 171

Query: 177 IKILKYKENTVLDPKVFEIPYDK 199
           I+    K+N VL P  F     K
Sbjct: 172 IRFADMKKNPVLAPSRFTFTPPK 194


>gi|254694630|ref|ZP_05156458.1| outer membrane lipoprotein carrier protein LolA [Brucella abortus
           bv. 3 str. Tulya]
          Length = 231

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 52/196 (26%), Positives = 90/196 (45%), Gaps = 4/196 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFF 67
           ++GV +     A  P           + ++  +HF S +TM G F+Q    G    G F+
Sbjct: 31  ILGVGVAGAALAPVPVKVQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRGEQTGGTFY 90

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           + RP K  F Y++   + +ISDG ++ + N KLDTW +YPL      ++ ++   +    
Sbjct: 91  IERPGKIRFNYNNSP-IRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGR 149

Query: 128 IQRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +Q V+      T+    K  F  + I++ FD  SY L  W I D+ +  + + I   +  
Sbjct: 150 LQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTG 209

Query: 186 TVLDPKVFEIPYDKIH 201
                 +F+I Y +I 
Sbjct: 210 VRFTNDMFKIDYQRIA 225


>gi|325202584|gb|ADY98038.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis M01-240149]
          Length = 207

 Score = 98.8 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/194 (15%), Positives = 63/194 (32%), Gaps = 9/194 (4%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+SP   +++ DG  + +Y+  L   +             +++ +        
Sbjct: 67  PDLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAILSNKTALESSY 126

Query: 127 SIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +++   S+N     +            +        L   ++ DS    + I       N
Sbjct: 127 TLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQTSISFGGLNTN 186

Query: 186 TVLDPKVFEIPYDK 199
             L   VF+    K
Sbjct: 187 PQLSRGVFKFTPPK 200


>gi|254493108|ref|ZP_05106279.1| periplasmic carrier protein [Neisseria gonorrhoeae 1291]
 gi|260441138|ref|ZP_05794954.1| LolA [Neisseria gonorrhoeae DGI2]
 gi|268598366|ref|ZP_06132533.1| periplasmic carrier protein [Neisseria gonorrhoeae MS11]
 gi|268600722|ref|ZP_06134889.1| periplasmic carrier protein [Neisseria gonorrhoeae PID18]
 gi|268603028|ref|ZP_06137195.1| periplasmic carrier protein [Neisseria gonorrhoeae PID1]
 gi|268681503|ref|ZP_06148365.1| periplasmic carrier protein [Neisseria gonorrhoeae PID332]
 gi|268683733|ref|ZP_06150595.1| periplasmic carrier protein [Neisseria gonorrhoeae SK-92-679]
 gi|226512148|gb|EEH61493.1| periplasmic carrier protein [Neisseria gonorrhoeae 1291]
 gi|268582497|gb|EEZ47173.1| periplasmic carrier protein [Neisseria gonorrhoeae MS11]
 gi|268584853|gb|EEZ49529.1| periplasmic carrier protein [Neisseria gonorrhoeae PID18]
 gi|268587159|gb|EEZ51835.1| periplasmic carrier protein [Neisseria gonorrhoeae PID1]
 gi|268621787|gb|EEZ54187.1| periplasmic carrier protein [Neisseria gonorrhoeae PID332]
 gi|268624017|gb|EEZ56417.1| periplasmic carrier protein [Neisseria gonorrhoeae SK-92-679]
          Length = 207

 Score = 98.8 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 60/194 (30%), Gaps = 9/194 (4%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+ P   +++ DG  + +Y+  L   +             +++ +        
Sbjct: 67  PGLFKWEYTLPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAILSNKTALESSY 126

Query: 127 SIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +++   S+N                  +        L   ++ DS    + I       N
Sbjct: 127 TLKEDGSSNGIDYVRATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQTSISFGGLNTN 186

Query: 186 TVLDPKVFEIPYDK 199
             L    F+    K
Sbjct: 187 PQLSRGAFKFTPPK 200


>gi|121602483|ref|YP_988432.1| LolA family protein [Bartonella bacilliformis KC583]
 gi|120614660|gb|ABM45261.1| LolA family protein [Bartonella bacilliformis KC583]
          Length = 210

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 43/200 (21%), Positives = 78/200 (39%), Gaps = 3/200 (1%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVM 62
           L    ++ V  + ++  +     +    +    +    HF +I+TM G F+Q    G   
Sbjct: 6   LSLNRILVVSGILYFVLLLFPAFSQSAHQVARAQVIANHFAAIKTMTGDFVQFSPKGKKT 65

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQH 122
           KG F++ RP K  F Y       +    S     N  L+TW +Y L      ++  +   
Sbjct: 66  KGTFYLERPGKVRFTYQGVPLQIMADGQSVGIQ-NRALNTWDLYQLSQTPMKLLLGDTID 124

Query: 123 VIQESIQRVESNNSFI-TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           +  E++     ++  I  I          I + FD  +Y LL W I+D     + ++++ 
Sbjct: 125 ISSENLLAFRQDSRAIEIILRDKSLGKGQIKMIFDANTYALLQWTIVDQQNLETTVQVMN 184

Query: 182 YKENTVLDPKVFEIPYDKIH 201
            +        +F IPY  I 
Sbjct: 185 VRTGVRFAEDMFTIPYQNIA 204


>gi|189025066|ref|YP_001935834.1| hypothetical protein BAbS19_I18780 [Brucella abortus S19]
 gi|254690140|ref|ZP_05153394.1| hypothetical protein Babob68_08221 [Brucella abortus bv. 6 str.
           870]
 gi|254696255|ref|ZP_05158083.1| hypothetical protein Babob28_00711 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731173|ref|ZP_05189751.1| hypothetical protein Babob42_08251 [Brucella abortus bv. 4 str.
           292]
 gi|256258394|ref|ZP_05463930.1| hypothetical protein Babob9C_13833 [Brucella abortus bv. 9 str.
           C68]
 gi|297247234|ref|ZP_06930952.1| hypothetical protein BAYG_00131 [Brucella abortus bv. 5 str. B3196]
 gi|189020638|gb|ACD73360.1| hypothetical protein BAbS19_I18780 [Brucella abortus S19]
 gi|297174403|gb|EFH33750.1| hypothetical protein BAYG_00131 [Brucella abortus bv. 5 str. B3196]
          Length = 231

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 4/196 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFF 67
           ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G    G F+
Sbjct: 31  ILGVGVAGAALAPVPVKAQGEDGGIAAAQQIADHFSSARTMTGEFVQFGPRGEQTGGTFY 90

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           + RP K  F Y++   + +ISDG ++ + N KLDTW +YPL      ++ ++   +    
Sbjct: 91  IERPGKIRFNYNNSP-IRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGR 149

Query: 128 IQRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +Q V+      T+    K  F  + I++ FD  SY L  W I D+ +  + + I   +  
Sbjct: 150 LQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTG 209

Query: 186 TVLDPKVFEIPYDKIH 201
                 +F+I Y +I 
Sbjct: 210 VRFTNDMFKIDYQRIA 225


>gi|34497069|ref|NP_901284.1| outer membrane lipoproteins carrier protein [Chromobacterium
           violaceum ATCC 12472]
 gi|47117164|sp|Q7NXL2|LOLA_CHRVO RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|34102926|gb|AAQ59290.1| outer membrane lipoproteins carrier protein [Chromobacterium
           violaceum ATCC 12472]
          Length = 206

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/171 (15%), Positives = 56/171 (32%), Gaps = 9/171 (5%)

Query: 38  KAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           +        +T+   F Q            G   +ARP KF ++Y+ P +  ++ DG  +
Sbjct: 28  QLKAFVSGSKTLSADFNQTVTNKGKREEASGRLEIARPGKFRWEYTKPYAQLIVGDGKTL 87

Query: 94  AVYNAKLDTWSVYPL-----RYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG 148
            +Y+  L   +            A  +  +N      +  +  +  +             
Sbjct: 88  WIYDQDLAQVTRKAQGAALGSSPAALLAGNNEIERSYKLNEAGKQGDLEWLAASPKKQDN 147

Query: 149 NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
              ++     +  L+  ++ DS    + I   + ++N  L P  F     K
Sbjct: 148 TFSAIRMGFKNNVLVEMQLTDSFGNDTRIVFSQQRQNAALPPARFAFAPPK 198


>gi|225628197|ref|ZP_03786232.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225617022|gb|EEH14069.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
          Length = 258

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 4/196 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFF 67
           ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G    G F+
Sbjct: 58  ILGVGVAGAALAPVPVKAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRGEQTGGTFY 117

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           + RP K  F Y++   + +ISDG ++ + N KLDTW +YPL      ++ ++   +    
Sbjct: 118 IERPGKIRFNYNNSP-IRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGR 176

Query: 128 IQRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +Q V+      T+    K  F  + I++ FD  SY L  W I D+ +  + + I   +  
Sbjct: 177 LQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDARKLDTTVMIFNVRTG 236

Query: 186 TVLDPKVFEIPYDKIH 201
                 +F+I Y +I 
Sbjct: 237 VRFTNDMFKIDYQRIA 252


>gi|254500974|ref|ZP_05113125.1| Outer membrane lipoprotein carrier protein LolA [Labrenzia
           alexandrii DFL-11]
 gi|222437045|gb|EEE43724.1| Outer membrane lipoprotein carrier protein LolA [Labrenzia
           alexandrii DFL-11]
          Length = 212

 Score = 98.4 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 48/177 (27%), Positives = 89/177 (50%), Gaps = 4/177 (2%)

Query: 25  NAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSS 83
             A    + Q+++    +F S++TM G F+Q    G    G+F+MARP K  F Y+ PS 
Sbjct: 30  ALALSDQEQQTLQDLNTYFNSVKTMHGDFIQFGPDGSQSDGKFYMARPGKVRFYYNKPSV 89

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQR---VESNNSFITI 140
           + +++DG +++V + KL+T  ++PL       + S++  + Q++      VE +   +TI
Sbjct: 90  LDIVADGKSVSVRDRKLNTQDIWPLGQTPLRFLLSDSIDLQQDTNVTNVLVEEDLVTVTI 149

Query: 141 FFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
           F +  F    +++ FD   Y L  W + D     + + +     N   +P +F+I Y
Sbjct: 150 FDQTKFNSGTLTLIFDAKDYALKQWTVTDQQGYDTSVAVYNVVSNGPSNPDLFKIDY 206


>gi|237816359|ref|ZP_04595352.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|237788426|gb|EEP62641.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
          Length = 258

 Score = 98.4 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 4/196 (2%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFF 67
           ++GV +     A  P  A        + ++  +HF S +TM G F+Q    G    G F+
Sbjct: 58  ILGVGVAGAALAPVPVKAQGEDGGIAAAQQIADHFSSARTMTGEFVQFGPRGEQTGGTFY 117

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           + RP K  F Y++   + +ISDG ++ + N KLDTW +YPL      ++ ++   +    
Sbjct: 118 IERPGKIRFNYNNSP-IRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGR 176

Query: 128 IQRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +Q V+      T+    K  F  + I++ FD  SY L  W I D+ +  + + I   +  
Sbjct: 177 LQSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTG 236

Query: 186 TVLDPKVFEIPYDKIH 201
                 +F+I Y +I 
Sbjct: 237 VRFTNDMFKIDYQRIA 252


>gi|304388134|ref|ZP_07370260.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis ATCC 13091]
 gi|304337904|gb|EFM04047.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis ATCC 13091]
          Length = 207

 Score = 98.4 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/204 (14%), Positives = 64/204 (31%), Gaps = 13/204 (6%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY---- 60
           + K       LF + A+     +    +  +V    +       + G+F Q         
Sbjct: 1   MMKQHN----LFKFLAVCSLTVSVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQ 56

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVI 116
              G F + RP  F ++Y+SP   +++ DG  + +Y+  L   +             +++
Sbjct: 57  TAHGTFKILRPDLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAIL 116

Query: 117 FSNNQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
            +        +++   S+N     +            +        L   ++ DS    +
Sbjct: 117 SNKTALESSYTLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQT 176

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
            I       N  L    F+    K
Sbjct: 177 SISFGGLNTNPQLSRGAFKFTPPK 200


>gi|192288714|ref|YP_001989319.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris TIE-1]
 gi|192282463|gb|ACE98843.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris TIE-1]
          Length = 313

 Score = 98.4 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 36/165 (21%), Positives = 76/165 (46%), Gaps = 5/165 (3%)

Query: 40  IEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNA 98
             +  S+QT+ G F+Q    G  + G+F++ +P +  F+Y  PS +S+I+DG ++ V + 
Sbjct: 143 STYLSSLQTLVGQFVQVGPDGSKLTGDFYIMKPGRVRFEYDDPSPISMIADGQSVVVRDR 202

Query: 99  KLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFM----GNMISVT 154
           KL T  VYPL       + S+   +++++     +++   +    ++       + + + 
Sbjct: 203 KLATQDVYPLSQTPLRYLLSDRLDLLRDTNVVSITSDDLYSNIIIEEKNAVIGTSRLLLM 262

Query: 155 FDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           F     +L  W + D     + + +         DP +F+I Y  
Sbjct: 263 FGTKDGQLKQWTVTDPQGYDTTVAVYNLDTTRRPDPSMFKIDYTN 307


>gi|39933357|ref|NP_945633.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris CGA009]
 gi|39652982|emb|CAE25724.1| unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 313

 Score = 98.4 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 36/165 (21%), Positives = 76/165 (46%), Gaps = 5/165 (3%)

Query: 40  IEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNA 98
             +  S+QT+ G F+Q    G  + G+F++ +P +  F+Y  PS +S+I+DG ++ V + 
Sbjct: 143 STYLSSLQTLVGQFVQVGPDGSKLTGDFYIMKPGRVRFEYDDPSPISMIADGQSVVVRDR 202

Query: 99  KLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFM----GNMISVT 154
           KL T  VYPL       + S+   +++++     +++   +    ++       + + + 
Sbjct: 203 KLATQDVYPLSQTPLRYLLSDRLDLLRDTNVVSITSDDLYSNIIIEEKNAVIGTSRLLLM 262

Query: 155 FDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           F     +L  W + D     + + +         DP +F+I Y  
Sbjct: 263 FGTKDGQLKQWTVTDPQGYDTTVAVYNLDTTRRPDPSMFKIDYTN 307


>gi|327480898|gb|AEA84208.1| outer-membrane lipoprotein carrier protein [Pseudomonas stutzeri
           DSM 4166]
          Length = 215

 Score = 98.4 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/201 (14%), Positives = 65/201 (32%), Gaps = 11/201 (5%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVM 62
            + ++ L   S +    A     +  S K+        +T+ G F Q             
Sbjct: 7   YMQLIRLLCASVLMVALAPAHADQAASTKRLTGLLNQAETLTGRFSQLSLDGSGTQLQET 66

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVIF 117
            GE  + RP +F +   +P    L+S+G  + +Y+  L+  ++           A  +  
Sbjct: 67  SGELALKRPGQFRWHTDAPMEQLLVSNGKKVWLYDPDLEQVTIQELDQRLTHTPALLLSG 126

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             +       +   E+ +                ++        + + +++DS  + + I
Sbjct: 127 DVSTISENFEVSHKEAGDVVDFTLKPKAKDTLFDNLRLSFRGGVINDMQLIDSVGQRTNI 186

Query: 178 KILKYKENTVLDPKVFEIPYD 198
             +  K N  L   +F     
Sbjct: 187 LFMGVKMNQPLKADLFTFEIP 207


>gi|170743017|ref|YP_001771672.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           sp. 4-46]
 gi|168197291|gb|ACA19238.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           sp. 4-46]
          Length = 313

 Score = 98.0 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 72/173 (41%), Gaps = 5/173 (2%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLIS 88
                 V++A  +F S+ T+ G F+Q    G  + G+ ++A+P +  F Y  PS + +++
Sbjct: 123 SNPAAVVERANGYFNSVSTLTGNFVQIAADGRKIGGKLYLAKPGRLRFDYDQPSPLEVVA 182

Query: 89  DGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNN----SFITIFFKD 144
           DG+++AV + KL T  +Y +       +  +   + ++      S               
Sbjct: 183 DGTSVAVRDRKLATQDLYFISQTPLKFLLRDRIDLARDLSVTDVSTEPGGVRISLEDRST 242

Query: 145 DFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
               + I + FD     L  W+I D     + + +   +    +D  +F I Y
Sbjct: 243 LGGTSRIVLVFDEAMKSLSQWRITDPQGYQTTVLLSNLQRGRPIDGMMFVINY 295


>gi|209966057|ref|YP_002298972.1| outer membrane lipoprotein carrier protein LolA,putative
           [Rhodospirillum centenum SW]
 gi|209959523|gb|ACJ00160.1| outer membrane lipoprotein carrier protein LolA,putative
           [Rhodospirillum centenum SW]
          Length = 240

 Score = 98.0 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 31/170 (18%), Positives = 68/170 (40%), Gaps = 4/170 (2%)

Query: 33  DQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGS 91
              + +   +   I T++  FLQ  D G  +KG F +ARP +    Y  P    +++DG 
Sbjct: 64  AADLARVEAYLNGIGTLRSRFLQVADDGSSVKGTFALARPGRMRIDYDPPVGNFIVADGR 123

Query: 92  NIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNS---FITIFFKDDFMG 148
            +  ++A+L   S  P+       +      +  +      +++     +T+    D   
Sbjct: 124 FVYFWDAELKQQSNAPIGSTLADFLLRPQISLSGDVTVTEVAHDGGVLEVTLAQTKDPAL 183

Query: 149 NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
             +++ F+   + L  W+++D+    + I +L  +    L  + F     
Sbjct: 184 GRLTLVFEERPFALRKWRVLDAQGLTTEISLLSPETGVELKDEQFFFRDP 233


>gi|146282640|ref|YP_001172793.1| outer-membrane lipoprotein carrier protein [Pseudomonas stutzeri
           A1501]
 gi|145570845|gb|ABP79951.1| periplasmic chaperone LolA [Pseudomonas stutzeri A1501]
          Length = 215

 Score = 98.0 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 29/202 (14%), Positives = 66/202 (32%), Gaps = 11/202 (5%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVM 62
            + ++ L   S +    A     +  S K+        +T+ G F Q             
Sbjct: 7   YMQLIRLLCASVLMVALAPVHADQAASTKRLTGLLNQAETLTGRFSQLSLDGSGTQLQET 66

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVIF 117
            GE  + RP +F +   +P    L+S+G  + +Y+  L+  ++           A  +  
Sbjct: 67  SGELALKRPGQFRWHTDAPMEQLLVSNGKKVWLYDPDLEQVTIQELDQRLTHTPALLLSG 126

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             +       +   E+ +                ++        + + +++DS  + + I
Sbjct: 127 DVSTISENFEVSHKEAGDVVDFTLKPKAKDTLFDNLRLSFRGGVINDMQLIDSVGQRTNI 186

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
             +  K N  L   +F     +
Sbjct: 187 LFMGVKMNQPLKADLFTFEIPE 208


>gi|254472223|ref|ZP_05085623.1| outer membrane lipoprotein carrier protein LolA [Pseudovibrio sp.
           JE062]
 gi|211958506|gb|EEA93706.1| outer membrane lipoprotein carrier protein LolA [Pseudovibrio sp.
           JE062]
          Length = 229

 Score = 98.0 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 49/173 (28%), Positives = 90/173 (52%), Gaps = 4/173 (2%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLI 87
            +T  Q++    ++F S++ M G F+Q    G  ++G+FF++RP K  F Y+ PS++ +I
Sbjct: 46  ALTNVQAIDAVSKYFNSVRNMHGKFVQFGPTGGRVEGQFFISRPGKVRFYYNKPSTLDII 105

Query: 88  SDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQR---VESNNSFITIFFKD 144
           +DGS ++V + KL T  ++PL       + ++   +  ++      VE +   ITI  K 
Sbjct: 106 ADGSMVSVKDRKLQTQDIWPLSQTPLRFLLADKIDLKTDANVTNVVVEPDLITITIDDKT 165

Query: 145 DFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
            F    +++ FD   Y+L  W + D+    + + I    EN   +P +F+I Y
Sbjct: 166 RFTSGRLTLIFDARDYKLKQWTVRDAQGYDTSVAIYDVVENGATNPDLFKIDY 218


>gi|299066063|emb|CBJ37244.1| Outer-membrane lipoprotein carrier protein precursor [Ralstonia
           solanacearum CMR15]
          Length = 206

 Score = 98.0 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/195 (14%), Positives = 65/195 (33%), Gaps = 16/195 (8%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-----DAGY------VMKGEFFMA 69
           +    A     +  ++++      ++ T +G F+Q        G          G+F  +
Sbjct: 5   LVSLAAWSAGAQAGAIEQLNAFVNNVTTARGEFVQRQVKGGANGSPLRVAGTSSGDFAFS 64

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQ 125
           RP +F ++Y  P    L +DG  + +Y+  L   +   L         +++F +N     
Sbjct: 65  RPGRFIWRYVKPYEQQLSADGQMLYIYDKDLSQVTERKLDASLGSSPAAILFGSNDLAKN 124

Query: 126 ESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
             ++   + +                  V     +  L   ++ D+    +++     ++
Sbjct: 125 FVLKEGGTKDGIDWVELTPKAKDTQFERVAIGFRAGELEGMELRDAFGSTTLLTFSHIQK 184

Query: 185 NTVLDPKVFEIPYDK 199
           N  L    F     K
Sbjct: 185 NPQLPASAFRFVPPK 199


>gi|85710027|ref|ZP_01041092.1| outer membrane lipoprotein-sorting protein [Erythrobacter sp. NAP1]
 gi|85688737|gb|EAQ28741.1| outer membrane lipoprotein-sorting protein [Erythrobacter sp. NAP1]
          Length = 221

 Score = 98.0 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 30/181 (16%), Positives = 70/181 (38%), Gaps = 9/181 (4%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSP 81
           P   A   +    + +A+    SI TM+  F Q D  G   +G   +  P K  F Y   
Sbjct: 31  PAPHALAQSSAD-LDRAVSALRSISTMKADFSQTDRQGRTARGTMTLKSPGKIRFDYGRD 89

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES--IQRVESNNSFIT 139
           S + ++S+G ++ + + +++    +P+R      +    + +      I     +   I 
Sbjct: 90  SDLLIVSNGRSLYMVDYEVNQVERWPIRNSPLGALLDPERDMKDYGTLIPTGNPDVLSID 149

Query: 140 IFFKDDFMGNMISVTFDRLS-----YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
           +   +      +++ F R S      +L +W  +D+    + +++  ++    +    F 
Sbjct: 150 VRDPNKPELGRMNLIFVRNSSAPGGLQLTHWVALDAQNHRTTVRLTNHRYGVSVPDSTFN 209

Query: 195 I 195
            
Sbjct: 210 F 210


>gi|148652700|ref|YP_001279793.1| outer membrane lipoprotein carrier protein LolA [Psychrobacter sp.
           PRwf-1]
 gi|148571784|gb|ABQ93843.1| outer membrane lipoprotein carrier protein LolA [Psychrobacter sp.
           PRwf-1]
          Length = 238

 Score = 97.6 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 34/224 (15%), Positives = 71/224 (31%), Gaps = 24/224 (10%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKD-------QSVKKAIEHFLSIQTMQGTFLQED 57
           + K+++G  +        P  A     +         + K+      + ++M   F Q  
Sbjct: 14  MMKNIMGTALSGALIFGMPMMAVSQAAQAATAADNLTAAKRLNALLANTKSMTANFTQTT 73

Query: 58  AG------------YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV 105
            G                G   + RP+KF +  +SP    +++DGS + VY+  L   + 
Sbjct: 74  KGANGGKSGLSAKNGTFSGNMSLQRPNKFRWNITSPFEQQIVTDGSAMWVYDKDLQQATR 133

Query: 106 YPLRYM----AFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYR 161
                        ++  +   +                + +      N  S+       +
Sbjct: 134 QNADQQLGNTPALLLSGDPSKIASNFKITQPDAKKNYYVLYPKASGSNFNSLAVSFNGGK 193

Query: 162 LLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK-IHNIN 204
            +   + DS  + + IK    K N  ++   F+    K +  IN
Sbjct: 194 PIMMVLNDSLGQVTSIKFSNVKVNPSINSSQFKFTPPKGVDIIN 237


>gi|17986353|ref|NP_538987.1| outer membrane lipoproteins carrier protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|17981941|gb|AAL51251.1| outer membrane lipoproteins carrier protein precursor [Brucella
           melitensis bv. 1 str. 16M]
          Length = 200

 Score = 97.6 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 53/195 (27%), Positives = 90/195 (46%), Gaps = 4/195 (2%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFM 68
           +GV +     A  P  A        + ++  +HF S +TM G F+Q    G    G F++
Sbjct: 1   MGVGVAGAALAPVPVKAQGADGGIAAAQQIADHFSSARTMTGEFVQFGPRGEQTGGTFYI 60

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI 128
            RP K  F Y++   + +ISDG ++ + N KLDTW +YPL      ++ ++   +    +
Sbjct: 61  ERPGKIRFNYNNSP-IRVISDGDSVVINNRKLDTWDLYPLSKTPLKLLLADRIDLGGGRL 119

Query: 129 QRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
           Q V+      T+    K  F  + I++ FD  SY L  W I D+ +  + + I   +   
Sbjct: 120 QSVKQEPDMTTLVLGDKSVFGDSKITMMFDPKSYDLKQWTITDAQKLDTTVMIFNVRTGV 179

Query: 187 VLDPKVFEIPYDKIH 201
                +F+I Y +I 
Sbjct: 180 RFTNDMFKIDYQRIA 194


>gi|261401110|ref|ZP_05987235.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           lactamica ATCC 23970]
 gi|269209011|gb|EEZ75466.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           lactamica ATCC 23970]
          Length = 207

 Score = 97.6 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 62/194 (31%), Gaps = 9/194 (4%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMAR 70
           LF + A+     A    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P  F ++Y+SP   +++ DG  + +Y+  L   +             +++ +        
Sbjct: 67  PGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAILSNKTALESSY 126

Query: 127 SIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +++   S+N     +            +        L   ++ DS    + I       +
Sbjct: 127 TLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQTSISFGGLNTD 186

Query: 186 TVLDPKVFEIPYDK 199
             L    F+    K
Sbjct: 187 PQLSRGAFKFTPPK 200


>gi|325206530|gb|ADZ01983.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           meningitidis M04-240196]
          Length = 207

 Score = 97.6 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 63/194 (32%), Gaps = 9/194 (4%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMAR 70
           LF + A+     +    +  +V    +       + G+F Q            G F + R
Sbjct: 7   LFQFLAVCSLTVSVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKTQTAHGTFKILR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P+ F ++Y+SP   +++ DG  + +Y+  L   +             +++ +        
Sbjct: 67  PALFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAAILSNKTALESSY 126

Query: 127 SIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +++   S+N     +            +        L   ++ DS    + I       N
Sbjct: 127 TLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFGNQTSISFGGLNTN 186

Query: 186 TVLDPKVFEIPYDK 199
             L    F+    K
Sbjct: 187 PQLSRGAFKFTPPK 200


>gi|294013495|ref|YP_003546955.1| outer membrane lipoprotein carrier protein LolA [Sphingobium
           japonicum UT26S]
 gi|292676825|dbj|BAI98343.1| outer membrane lipoprotein carrier protein LolA [Sphingobium
           japonicum UT26S]
          Length = 217

 Score = 97.6 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/211 (12%), Positives = 68/211 (32%), Gaps = 15/211 (7%)

Query: 6   YKSVIG-------VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED- 57
            K +          + L       P   A        + +   +  ++ TM   F Q D 
Sbjct: 1   MKRMFAPHGLTLAALTLAVAPFAAPMMPAAAQAGQSDLSRVNAYIRAVTTMTADFAQTDR 60

Query: 58  AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIF 117
            G  + G   + +P K  F+Y     + ++ DG  + + + ++     +P+       + 
Sbjct: 61  NGQTLTGRLTIKQPGKIRFQYQKGVPLLIVGDGKALTMIDYEVRQVQRWPIGNSPLGALI 120

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRL-------SYRLLNWKIMDS 170
             N+ + +        + + +++  +D       ++T             +L  W  +DS
Sbjct: 121 DPNKDLSKFGKVIQTGDPTVLSVQARDPRRPEYGTITMIFKRDAGSPAGLQLYGWVALDS 180

Query: 171 SRRYSIIKILKYKENTVLDPKVFEIPYDKIH 201
               + +K+   +    +    F     +  
Sbjct: 181 QNNRTAVKLSNQRYGVPVADSAFRWTDPRPK 211


>gi|94496588|ref|ZP_01303164.1| outer membrane lipoprotein carrier protein LolA [Sphingomonas sp.
           SKA58]
 gi|94423948|gb|EAT08973.1| outer membrane lipoprotein carrier protein LolA [Sphingomonas sp.
           SKA58]
          Length = 212

 Score = 97.3 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/183 (13%), Positives = 66/183 (36%), Gaps = 8/183 (4%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVS 85
           A     D  + +   +  ++ TM   F Q D  G  + G+  + +P K  F+Y     + 
Sbjct: 24  AAAQQGDADLSRVNAYIRAVTTMTADFSQTDRNGQTLTGKLTLKQPGKIRFQYQKGVPLL 83

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD 145
           ++ DG  + V + ++     +P+       +   ++ + +        + S +++  +D 
Sbjct: 84  IVGDGKALTVIDYEVRQVQRWPIGNSPLGALIDPSKDLSKFGKVIPTDDPSILSVQARDP 143

Query: 146 FMGNMISVTFDRL-------SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                 ++T             +L  W  +DS    + +++   +    ++   F     
Sbjct: 144 KRPEFGTITMIFKRDAASPAGLQLYGWVALDSQNNRTAVRLTNQRYGAPVEDSAFRWTDP 203

Query: 199 KIH 201
           +  
Sbjct: 204 RPR 206


>gi|260432333|ref|ZP_05786304.1| outer membrane lipoprotein carrier protein LolA [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260416161|gb|EEX09420.1| outer membrane lipoprotein carrier protein LolA [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 198

 Score = 97.3 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/168 (19%), Positives = 72/168 (42%), Gaps = 5/168 (2%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           +   + +   +   ++T+Q TF Q  D G +  G+ ++ RP K  F+Y  P+S  ++++ 
Sbjct: 21  EKLPLSQISNYLNGLKTVQTTFTQINDDGSLSTGKLWLQRPGKMRFEYDPPNSAVVLANA 80

Query: 91  SNIAVYNAK-LDTWSVYPLRYMAFSVIFSNNQHVIQESI---QRVESNNSFITIFFKDDF 146
             + V++ K       YPL+    S++ + N ++ Q  +      +   + +T     + 
Sbjct: 81  GTVMVFDPKSNQPPEQYPLKRTPLSLVLARNVNLSQADMVVGHTFDGTATVVTAQDPKNP 140

Query: 147 MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
               I + F      L  W I D++   + + +     N  +D  +F 
Sbjct: 141 DSGRIELMFTSDPIELRKWVIYDNTGGQTTVLLGSLDGNVRVDSDLFT 188


>gi|241762157|ref|ZP_04760240.1| outer membrane lipoprotein carrier protein LolA [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241373407|gb|EER63007.1| outer membrane lipoprotein carrier protein LolA [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 222

 Score = 97.3 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/194 (17%), Positives = 71/194 (36%), Gaps = 7/194 (3%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKF 74
              SA     A           +  +H   + TM   F+Q D  G  + G   + +P   
Sbjct: 26  LCLSAFPAIAAPASDASSTVFPQIQKHLREVSTMTAHFVQVDRNGQALDGSLTLKKPGLI 85

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVES 133
            F+Y     + ++ DG  + + +  +   S +P+     S++   ++ +    ++   + 
Sbjct: 86  RFQYQKDVPLLVVGDGKALVMIDYSVRQVSRWPIGDSPLSILIDPSKDIASYATLTSDDG 145

Query: 134 NNSFITIFFKDDFMGNMISVTFDRLS-----YRLLNWKIMDSSRRYSIIKILKYKENTVL 188
            N  IT           I++ F R         L+ W ++D+    S I + + K N  +
Sbjct: 146 KNIVITGHDPKHPDFGTIAINFQRDKSAPAQLMLMGWTVIDAQNNRSQIILSEQKFNQPV 205

Query: 189 DPKVFEIPYDKIHN 202
              +F     + +N
Sbjct: 206 SNNMFRWNDPRGNN 219


>gi|17547059|ref|NP_520461.1| outer-membrane lipoprotein carrier protein [Ralstonia solanacearum
           GMI1000]
 gi|21759258|sp|Q8XWY0|LOLA_RALSO RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|17429360|emb|CAD16047.1| probable outer-membrane lipoprotein carrier precursor. signal
           peptide [Ralstonia solanacearum GMI1000]
          Length = 215

 Score = 97.3 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/195 (14%), Positives = 65/195 (33%), Gaps = 16/195 (8%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-----DAGY------VMKGEFFMA 69
           +    A     +  ++++      ++ T +G F+Q        G          G+F  +
Sbjct: 14  LVSLAAWSAGAQAGAIEQLNAFVSNVTTARGEFVQRQVKGGANGSPLRVAGTSSGDFTFS 73

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQ 125
           RP +F ++Y  P    L +DG  + +Y+  L   +   L         +++F +N     
Sbjct: 74  RPGRFVWRYLKPYEQQLSADGQMLYIYDKDLSQVTERKLDASLGSSPAAILFGSNDLAKN 133

Query: 126 ESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
             ++   + +                  V     +  L   ++ D+    +++     ++
Sbjct: 134 FVLKEGGTKDGIDWVELTPKAKDTQFERVAIGFRAGELEGMELRDAFGNTTLLTFSHIQK 193

Query: 185 NTVLDPKVFEIPYDK 199
           N  L    F     K
Sbjct: 194 NPQLPASAFRFVPPK 208


>gi|288962145|ref|YP_003452440.1| hypothetical protein AZL_d00700 [Azospirillum sp. B510]
 gi|288914411|dbj|BAI75896.1| hypothetical protein AZL_d00700 [Azospirillum sp. B510]
          Length = 222

 Score = 96.9 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/176 (16%), Positives = 67/176 (38%), Gaps = 4/176 (2%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVS 85
           +        V K   +   I T+Q  FLQ    G    G F + RP +   +Y  P    
Sbjct: 37  SLSAQDQAVVAKVEAYLNGITTLQSKFLQVAPNGRQATGTFSLWRPGRMRLEYDRPLKDF 96

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRV---ESNNSFITIFF 142
           +++DGS +  ++ ++   S  P+       I  ++  +  +              +++  
Sbjct: 97  IVADGSFVFYWDGEMRQQSSAPIGSTLADFILRSDIRLSGDVTVTEVFQSPGVIEVSLLE 156

Query: 143 KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
             D     +++ F+   ++L  W+++D+    + + +L  + +   D  +F     
Sbjct: 157 TKDPGKGTLTLVFEDRPFQLRKWRVLDAQGLTTEVALLNPRTDVTFDRDMFYFKEP 212


>gi|162149018|ref|YP_001603479.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209545232|ref|YP_002277461.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787595|emb|CAP57191.1| putative outer membrane lipoprotein carrier protein LolA
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532909|gb|ACI52846.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 223

 Score = 96.9 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/177 (13%), Positives = 69/177 (38%), Gaps = 5/177 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSP 81
               A        V++  ++   + T++  F Q    G    G  +++RP +  F+Y  P
Sbjct: 41  AMTLALAPADRAWVQRVQDYLNGVTTLEAQFQQLAPDGKRTTGTAWLSRPGRMRFEYDKP 100

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNS---FI 138
           S + L+++   +   +++L   +  PL      ++      +  +      ++++    +
Sbjct: 101 SPLLLVANHGQVVFNDSQLGQTTTLPLDKTPLGLLLRPGLQLSGDVTVTGFTHSNGLVQV 160

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE-NTVLDPKVFE 194
           T+          +++ F      L +W ++D+  + + + +   +     L   +F+
Sbjct: 161 TLVRTASPADGSLTLVFHDSPMSLRSWSVVDAQGQETRVDLYNIRLGGGPLPDGLFD 217


>gi|226944895|ref|YP_002799968.1| outer-membrane lipoprotein carrier protein [Azotobacter vinelandii
           DJ]
 gi|259491785|sp|C1DKZ1|LOLA_AZOVD RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|226719822|gb|ACO78993.1| outer membrane lipoprotein carrier protein, LolA [Azotobacter
           vinelandii DJ]
          Length = 207

 Score = 96.9 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/198 (14%), Positives = 63/198 (31%), Gaps = 11/198 (5%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEF 66
           +      +   F  +     ++S+++  +     QT+   F Q              GE 
Sbjct: 3   LFRVLLLSAVAFALSPAQADERSIQRLTQLLDRAQTLTARFSQLSLDGSGTQLQETSGEM 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS-----VYPLRYMAFSVIFSNNQ 121
            + RP  F +   +P    L+S+G  + +Y+  L+  +            A  +    ++
Sbjct: 63  ALKRPGLFRWHTDAPQEQLLVSNGKTVWLYDPDLEQVTVRSLDQRLTHTPALLLSGDLSK 122

Query: 122 HVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
                 I   E+      I           ++        + + +++D   + + I    
Sbjct: 123 IGENFEITHKEAGGVVDFILKPKSKDTLFDNLRLSFRDGVVNDMQLIDGVGQRTNILFFG 182

Query: 182 YKENTVLDPKVFEIPYDK 199
            K N  LD   F+    +
Sbjct: 183 VKMNQSLDAAQFDFKVPE 200


>gi|254786026|ref|YP_003073455.1| outer membrane lipoprotein carrier protein LolA [Teredinibacter
           turnerae T7901]
 gi|237684194|gb|ACR11458.1| outer membrane lipoprotein carrier protein LolA [Teredinibacter
           turnerae T7901]
          Length = 211

 Score = 96.9 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/201 (14%), Positives = 72/201 (35%), Gaps = 12/201 (5%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMK 63
           + +   FF +A+        ++    V        ++ T    F Q             +
Sbjct: 1   MALKNTFFTAAVLLSGLFCSVSWADDVDDLSAKLRALNTFSAHFEQRLLDDSGAELQKTE 60

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY---MAFSVIFSNN 120
           G+  ++ P +F+++   P   ++++DG  + VY+  ++  +VY  +        ++  + 
Sbjct: 61  GQVKVSNPGRFFWQVEPPFEQTVVTDGEQLWVYDPDMEQVTVYSKQQLASTPAQLLSGDF 120

Query: 121 QHVIQESIQRVESNNSFITIFF--KDDFMGNMISVTFDR-LSYRLLNWKIMDSSRRYSII 177
             + +        N   +T     KD+   N   + F      RL    + D   + +++
Sbjct: 121 AELAKTYAITASMNKGALTYRMAPKDEQTSNFAGLEFIFDKKDRLEGMILEDKLGQRTVV 180

Query: 178 KILKYKENTVLDPKVFEIPYD 198
              K + N  +D  +F     
Sbjct: 181 TFSKRQLNKPIDASIFSFKPP 201


>gi|300690795|ref|YP_003751790.1| outer-membrane lipoprotein carrier protein precursor [Ralstonia
           solanacearum PSI07]
 gi|299077855|emb|CBJ50493.1| Outer-membrane lipoprotein carrier protein precursor [Ralstonia
           solanacearum PSI07]
          Length = 215

 Score = 96.9 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/195 (14%), Positives = 65/195 (33%), Gaps = 16/195 (8%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-----DAGY------VMKGEFFMA 69
           +    A     +  ++++      ++ T +G F+Q        G          G+F  +
Sbjct: 14  LVSLAAWSAGAQAGAIEQLNAFVSNVSTARGEFVQRQVKGGANGSPLRVAGTSSGDFVFS 73

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQ 125
           RP +F ++Y  P    L +DG  + +Y+  L   +   L         +++F +N     
Sbjct: 74  RPGRFVWRYMKPYEQQLSADGQVLYIYDKDLSQVTERKLDASLGSSPAAILFGSNDLAKN 133

Query: 126 ESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
             ++   + +                  V     +  L   ++ D+    +++     ++
Sbjct: 134 FVLKEGGTKDGIDWVELTPKAKDTQFERVAIGFRAGELEGMELRDAFGNTTLLTFSHIQK 193

Query: 185 NTVLDPKVFEIPYDK 199
           N  L    F     K
Sbjct: 194 NPQLPANAFRFVPPK 208


>gi|283856532|ref|YP_163436.2| outer membrane lipoprotein carrier protein LolA [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|283775537|gb|AAV90325.2| outer membrane lipoprotein carrier protein LolA [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 222

 Score = 96.9 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/194 (17%), Positives = 71/194 (36%), Gaps = 7/194 (3%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKF 74
              SA     A           +  +H   + TM   F+Q D  G  + G   + +P   
Sbjct: 26  LCLSAFPAIAAPASDASSTVFPQIQKHLREVATMTAHFVQVDRNGQALDGSLTLKKPGLI 85

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES-IQRVES 133
            F+Y     + ++ DG  + + +  +   S +P+     S++   ++ +   + +   + 
Sbjct: 86  RFQYQKDVPLLVVGDGKALVMIDYSVRQVSRWPIGDSPLSILIDPSKDIASYAALTSDDG 145

Query: 134 NNSFITIFFKDDFMGNMISVTFDRLS-----YRLLNWKIMDSSRRYSIIKILKYKENTVL 188
            N  IT           I++ F R         L+ W ++D+    S I + + K N  +
Sbjct: 146 KNIVITGHDPKHPDFGTIAINFQRDKSAPAQLMLMGWTVIDAQNNRSQIILSEQKFNQPV 205

Query: 189 DPKVFEIPYDKIHN 202
              +F     + +N
Sbjct: 206 SNNMFRWNDPRGNN 219


>gi|292493396|ref|YP_003528835.1| outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           halophilus Nc4]
 gi|291581991|gb|ADE16448.1| outer membrane lipoprotein carrier protein LolA [Nitrosococcus
           halophilus Nc4]
          Length = 195

 Score = 96.5 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/184 (15%), Positives = 65/184 (35%), Gaps = 11/184 (5%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------VMKGEFFMARPSKFYFKYSS 80
           A+ +  ++   +       + +++  F Q             +G FF+ RP KF + Y  
Sbjct: 2   AFALKAEEPGARLETFLERVHSLRAEFHQILLDEYNEPLEESRGIFFLQRPGKFRWDYHE 61

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQESIQRVESNNS 136
           P + ++++DG  I  Y+  L+  +V   +         ++           I  + S+N 
Sbjct: 62  PFTQAIVADGERIWFYDPDLEQVTVKNQKLALGDTPALLLSGERLPEETFQINNLASHNH 121

Query: 137 F-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
                    +       +     +  L   ++ DS  + + +   + + N  LD  +F  
Sbjct: 122 LAWVELLPRNKEAAFERLLLGFDNNTLRQMELHDSFGQITRLSFSEVEVNLSLDSSLFVF 181

Query: 196 PYDK 199
              +
Sbjct: 182 TPPE 185


>gi|240851284|ref|YP_002972687.1| outer membrane lipoprotein carrier protein, LolA family [Bartonella
           grahamii as4aup]
 gi|240268407|gb|ACS51995.1| outer membrane lipoprotein carrier protein, LolA family [Bartonella
           grahamii as4aup]
          Length = 202

 Score = 96.5 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 45/200 (22%), Positives = 85/200 (42%), Gaps = 3/200 (1%)

Query: 2   AFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGY 60
           +FL  + V G+V +  +  +     +    K    +  + HF +I+TM G F+Q    G 
Sbjct: 4   SFLPQRRVFGLVGIIIFWCLTFPVFSQASNKVIKAQNVVNHFAAIKTMTGDFIQFSPKGK 63

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120
           + +G F++ RP K  F Y     + +I+DG  + + N  L+TW+   L       +  + 
Sbjct: 64  MSQGTFYLERPGKIRFIYKK-MPLQIIADGQFVGINNRALNTWNFSQLSQTPMKFLLGDK 122

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFM-GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
             V    +     +   +TI  +D  +    I + FD     L  W I+D     + ++I
Sbjct: 123 IDVSSGRLLAFREDPGAVTIVLRDKTIGAGQIRMVFDSKGSALRQWTIVDQQNLETTVQI 182

Query: 180 LKYKENTVLDPKVFEIPYDK 199
           +  + +      +F +P  K
Sbjct: 183 MNVRTDVRFANGMFALPSKK 202


>gi|319899429|ref|YP_004159526.1| lipoprotein carrier protein [Bartonella clarridgeiae 73]
 gi|319403397|emb|CBI76965.1| lipoprotein carrier protein [Bartonella clarridgeiae 73]
          Length = 210

 Score = 96.5 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 45/199 (22%), Positives = 84/199 (42%), Gaps = 5/199 (2%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYV 61
           FL  +    V+  F +  +     +    +    +    HF +I+TM G F+Q    G +
Sbjct: 5   FLSLRRAFNVI--FLFLLLIGSAFSQSAKQLVRAQNIANHFAAIKTMTGDFIQFSPKGKI 62

Query: 62  MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQ 121
            KG F++ RP K  F Y     + +++DG ++ V N  L+TWS Y L      ++  +  
Sbjct: 63  TKGTFYLERPGKIRFSY-KGVPLQIVADGKSVGVNNRALNTWSFYQLSQTPMKLLLGDTI 121

Query: 122 HVIQESIQRVESNNSFI-TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
            +   ++     +   +  +          I + FD  SY L  W I+D     + ++++
Sbjct: 122 SLSSANLLAFREDPGAVMIVLRDKTIGKGQIKMIFDSQSYALRQWTILDQQNLETTVQVM 181

Query: 181 KYKENTVLDPKVFEIPYDK 199
             + N      +F+IPY  
Sbjct: 182 NVRTNVRFADGMFKIPYKN 200


>gi|319406309|emb|CBI79946.1| LolA family protein [Bartonella sp. AR 15-3]
          Length = 206

 Score = 96.5 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 52/199 (26%), Positives = 89/199 (44%), Gaps = 5/199 (2%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYV 61
           F   + ++ V++LFF  +   F  +    +    +  I  F +I+TM G F+Q    G +
Sbjct: 5   FFSLRRIVSVILLFFLLSSPAF--SQSAKQLARAQNIINRFAAIKTMTGDFIQFSPKGKI 62

Query: 62  MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQ 121
            KG F++ RP K  F Y     + +I+DG ++ + N  L+TWS Y L       +  N  
Sbjct: 63  TKGTFYLERPGKIRFSY-KGVPLQIIADGKSVGINNRALNTWSFYRLSQTPMKFLLGNTI 121

Query: 122 HVIQESIQRVESNNS-FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
           ++  E++     +    + I          I + FD  SY L  W I+D     + I+I+
Sbjct: 122 NLSSENLLAFREDPKTVVIILRDKTIGKGQIKIIFDSQSYALRQWAILDQQNLETTIQIM 181

Query: 181 KYKENTVLDPKVFEIPYDK 199
             + N     ++F IPY  
Sbjct: 182 NVRTNVRFSNEMFVIPYKN 200


>gi|260753747|ref|YP_003226640.1| outer membrane lipoprotein carrier protein LolA [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|258553110|gb|ACV76056.1| outer membrane lipoprotein carrier protein LolA [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 222

 Score = 96.5 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/194 (17%), Positives = 71/194 (36%), Gaps = 7/194 (3%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKF 74
              SA     A           +  +H   + TM   F+Q D  G  + G   + +P   
Sbjct: 26  LCLSAFPAIAAPASDASSTVFPQIQKHLREVATMTAHFVQVDRNGQALDGSLTLKKPGLI 85

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVES 133
            F+Y     + ++ DG  + + +  +   S +P+     S++   ++ +    ++   + 
Sbjct: 86  RFQYQKDVPLLVVGDGKALVMIDYSVRQVSRWPIGDSPLSILIDPSKDIASYATLTSDDG 145

Query: 134 NNSFITIFFKDDFMGNMISVTFDRLS-----YRLLNWKIMDSSRRYSIIKILKYKENTVL 188
            N  IT           I++ F R         L+ W ++D+    S I + + K N  +
Sbjct: 146 KNIVITGHDPKHPDFGTIAINFQRDKSAPAQLMLMGWTVIDAQNNRSQIILSEQKFNQPV 205

Query: 189 DPKVFEIPYDKIHN 202
              +F     + +N
Sbjct: 206 SNNMFRWNDPRGNN 219


>gi|163796427|ref|ZP_02190387.1| Outer membrane lipoprotein-sorting protein [alpha proteobacterium
           BAL199]
 gi|159178277|gb|EDP62821.1| Outer membrane lipoprotein-sorting protein [alpha proteobacterium
           BAL199]
          Length = 211

 Score = 96.5 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/198 (18%), Positives = 75/198 (37%), Gaps = 9/198 (4%)

Query: 6   YKSVIGVVILFFYSAI-----FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG 59
            +  +   ++               A+        + +   +F  I +M+  FLQ    G
Sbjct: 1   MRRTLTSALMGVLVVAGLWTGSATAASLSAEDKADLARVEAYFNGITSMRSNFLQASSTG 60

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
            V KG  ++ RP +  F+Y  PS + + SDG  +   + +L   +  PL     SV+   
Sbjct: 61  LVAKGRVWLRRPGRMRFEYDPPSPILITSDGILVTYQDLELKQTNQIPLFTSPLSVLVEE 120

Query: 120 NQ---HVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
           N      +     + ESN   + I  + +     +++ F      L  W I+D+ +    
Sbjct: 121 NVTFGEELIVDEVKRESNVLRVRIRLRKEPDQGYVTLVFQDRPMSLKQWTIVDAQQVSVK 180

Query: 177 IKILKYKENTVLDPKVFE 194
           + +L  +    +  ++F 
Sbjct: 181 VALLDPEFGVTIPNELFR 198


>gi|296136851|ref|YP_003644093.1| outer membrane lipoprotein carrier protein LolA [Thiomonas
           intermedia K12]
 gi|295796973|gb|ADG31763.1| outer membrane lipoprotein carrier protein LolA [Thiomonas
           intermedia K12]
          Length = 220

 Score = 96.5 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/212 (13%), Positives = 64/212 (30%), Gaps = 15/212 (7%)

Query: 3   FLLYKSVIGV-VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV 61
            +   +     ++ FF +      +        SV+   +     +     F Q  +   
Sbjct: 1   MMSMNTRWRTSLVRFFLAGGLLVTSLPAAFAANSVQLLEQWLQQTRGGSAQFTQTVSNPK 60

Query: 62  ------MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----M 111
                   G+F   RP +F + Y+ P    ++SDG  +  Y+  LD  ++ P+       
Sbjct: 61  GPAQAPATGQFAFERPDRFRWDYTKPYGQVIVSDGKQLWTYDHDLDQVTITPVTQAFKGT 120

Query: 112 AFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTF----DRLSYRLLNWKI 167
             ++    +   +     + ++               N   +            +   ++
Sbjct: 121 PAAIFAGTDLTRLFTLQAQADAGGLQWVQATPKAKDSNFDWIRIGLRSTAQGPEVAELQL 180

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            D+  + S ++    K N    P  F     K
Sbjct: 181 RDAFGQISTMRFTAIKHNPTFGPDSFRFTPPK 212


>gi|207723625|ref|YP_002254023.1| outer-membrane lipoprotein carrier protein precursor [Ralstonia
           solanacearum MolK2]
 gi|206588828|emb|CAQ35790.1| outer-membrane lipoprotein carrier protein precursor [Ralstonia
           solanacearum MolK2]
          Length = 215

 Score = 96.5 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/195 (14%), Positives = 66/195 (33%), Gaps = 16/195 (8%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-----DAGY------VMKGEFFMA 69
           +    A     +  ++++      ++ T +G F+Q        G          G+F  +
Sbjct: 14  LVSLAAWSAGAQAGAIEQLNAFVNNVTTARGEFVQRQVKGGANGSPLRVAGASSGDFIFS 73

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQ 125
           RP +F ++Y  P    L +DG  + +Y+  L   +   L         +++F +N     
Sbjct: 74  RPGRFVWRYLKPYEQQLSADGRMLYIYDKDLSQVTERKLDASLGSSPAAILFGSNDLAKN 133

Query: 126 ESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
            S++   + +                  V     +  L   ++ D+    +++     ++
Sbjct: 134 FSLKEGGTKDGIDWVELTPKAKDTQFERVAIGFRAGELEGMELRDAFGNTTLLTFSHLQK 193

Query: 185 NTVLDPKVFEIPYDK 199
           N  L    F     K
Sbjct: 194 NPQLPASAFRFVPPK 208


>gi|146278933|ref|YP_001169092.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145557174|gb|ABP71787.1| outer membrane lipoprotein carrier protein LolA [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 212

 Score = 96.5 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 62/172 (36%), Gaps = 5/172 (2%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           +   +     +   + T +  F Q +  G +  G  F+ RP +  F+Y+ P    +++ G
Sbjct: 35  EKIPLSTISAYLNRLSTAEADFTQVNADGSMSTGRLFIKRPGRVRFEYAPPERSLVMAGG 94

Query: 91  SNIAVYN-AKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNN---SFITIFFKDDF 146
             +A+++         YPL     S+I + N  + +         +   + +        
Sbjct: 95  GQVAIFDAKSNQPPEQYPLSRTPLSLILAQNIDLGRARTVVGHREDRNTTRVVAQDPAHP 154

Query: 147 MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
               I + F      L  W I D +   + + + +  +   L   +F I  +
Sbjct: 155 EYGTIEMVFTANPVALRQWVITDDAGSQTTVILGEMSQGGNLPASLFSIQSE 206


>gi|300703419|ref|YP_003745021.1| outer-membrane lipoprotein carrier protein [Ralstonia solanacearum
           CFBP2957]
 gi|299071082|emb|CBJ42391.1| Outer-membrane lipoprotein carrier protein precursor [Ralstonia
           solanacearum CFBP2957]
          Length = 215

 Score = 96.1 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/195 (14%), Positives = 66/195 (33%), Gaps = 16/195 (8%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-----DAGY------VMKGEFFMA 69
           +    A     +  ++++      ++ T +G F+Q        G          G+F  +
Sbjct: 14  LVSLAAWSAGAQAGAIEQLNAFVNNVTTARGEFVQRQVKGGANGSPLRVAGASSGDFIFS 73

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQ 125
           RP +F ++Y  P    L +DG  + +Y+  L   +   L         +++F +N     
Sbjct: 74  RPGRFVWRYLKPYEQQLSADGQMLYIYDKDLSQVTERKLDASLGSSPAAILFGSNDLAKN 133

Query: 126 ESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
            S++   + +                  V     +  L   ++ D+    +++     ++
Sbjct: 134 FSLKEGGTKDGIDWVELTPKAKDTQFERVAIGFRAGELEGMELRDAFGNTTLLTFSHLQK 193

Query: 185 NTVLDPKVFEIPYDK 199
           N  L    F     K
Sbjct: 194 NPQLPASAFRFVPPK 208


>gi|220922844|ref|YP_002498146.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           nodulans ORS 2060]
 gi|219947451|gb|ACL57843.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           nodulans ORS 2060]
          Length = 332

 Score = 96.1 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/177 (19%), Positives = 73/177 (41%), Gaps = 5/177 (2%)

Query: 26  AAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSV 84
           A         +++A  +F  + T+ G F+Q    G  + G+ ++A+P +  F Y  PS +
Sbjct: 138 AVDAGNPTAVIERANAYFNGVSTLTGNFVQIGADGRKIGGKLYLAKPGRLRFDYDQPSPL 197

Query: 85  SLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNN----SFITI 140
            +++DG+++AV + KL T  +Y +       +  +   + ++      S +         
Sbjct: 198 EVVADGTSVAVRDRKLATQDLYFISQTPLKFLLRDRIDLARDLTVTDVSADPGGVRISLE 257

Query: 141 FFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
                   + I + FD     L  W+I D     + + +   +    +D  +F I Y
Sbjct: 258 DRSTLGGTSRIVLLFDEAMKSLSQWRITDPQGYQTTVLLSNLQRGRPIDGMMFVINY 314


>gi|332978340|gb|EGK15065.1| outer-membrane lipoprotein carrier protein [Psychrobacter sp.
           1501(2011)]
          Length = 237

 Score = 96.1 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/218 (15%), Positives = 71/218 (32%), Gaps = 23/218 (10%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKD-------QSVKKAIEHFLSIQTMQGTFLQED 57
           + K V+G  +        P  A     +         + K+      + ++M   F Q  
Sbjct: 13  MMKKVMGTALSGALIFGMPVMAVSQAAQAATAADNLTAAKRLNTLLSNTKSMTANFTQTT 72

Query: 58  AG------------YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV 105
            G                G   + RP+ F +  +SPS   +++DGS + VY+  L+  + 
Sbjct: 73  KGANGGKSGLSAKNGTFSGNVSLQRPNNFRWNITSPSEQLIVTDGSALWVYDKDLEQVTR 132

Query: 106 YPLRYM----AFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYR 161
                        ++  +   + +       +      + +  +   N  S+       +
Sbjct: 133 QSTDQQVGNTPALLLSGDPSKIAKNFKITQPNATKNYYVLYPKNSGSNFNSLAVSFNGGK 192

Query: 162 LLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            +   + DS  + + IK    K NT +    F+    K
Sbjct: 193 PVMMVLNDSLGQVTSIKFSNVKTNTSIPSSQFKFTPPK 230


>gi|88798709|ref|ZP_01114292.1| outer-membrane lipoprotein carrier protein precursor [Reinekea sp.
           MED297]
 gi|88778472|gb|EAR09664.1| outer-membrane lipoprotein carrier protein precursor [Reinekea sp.
           MED297]
          Length = 209

 Score = 96.1 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/202 (15%), Positives = 67/202 (33%), Gaps = 14/202 (6%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------EDAGYVM 62
           +IG  I  F  +     A+Y   + ++    IE   +++T+   F Q           V 
Sbjct: 1   MIGKKISVFAISFMVMAASYADDQARAA--LIEQLEALETLSADFEQRTYQETSPRADVS 58

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIF 117
            G F +++P++F++    P    +I+DG  + VY+  L+  +   L           +  
Sbjct: 59  SGTFQLSKPNRFHWHVQEPFEQRVIADGELLWVYDPDLEQATYQSLNQNLSQSPAMILTQ 118

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLS-YRLLNWKIMDSSRRYSI 176
                     + +V   +                 +         +   +I+DS  + + 
Sbjct: 119 PRQTLTDDYGVIKVALEDGVAYRLTPSSDDAIFDELLMRFDPAGHINQLRILDSLGQETQ 178

Query: 177 IKILKYKENTVLDPKVFEIPYD 198
           +       N+ L   +F     
Sbjct: 179 VTFSNVDVNSPLADDLFVFTPP 200


>gi|85375219|ref|YP_459281.1| outer membrane lipoprotein-sorting protein [Erythrobacter litoralis
           HTCC2594]
 gi|84788302|gb|ABC64484.1| outer membrane lipoprotein-sorting protein [Erythrobacter litoralis
           HTCC2594]
          Length = 221

 Score = 96.1 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/187 (15%), Positives = 72/187 (38%), Gaps = 8/187 (4%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYS 79
           I             S+  A+     I TM+ +F Q D  G  + G   + RP +  F+Y 
Sbjct: 28  IIATPVPVAAQSAGSLDDAVAALRGISTMRASFTQTDRKGQTVGGTMTLKRPGRIRFEYE 87

Query: 80  SPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES--IQRVESNNSF 137
               + ++S+GS++ + + +++    +P++      +   ++ V +    I     +   
Sbjct: 88  KGVPLLIVSNGSSMTLVDYEVNQVQRWPIKNSPLGALLDPSRDVKRYGKLISTGNRDVLS 147

Query: 138 ITIFFKDDFMGNMISVTFDRL-----SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
           + +         +I++ F R       ++L NW  +D+    + +++   +    +    
Sbjct: 148 VEVRDPKKPEFGVITLIFLRNASAPGGWQLTNWVALDAQNNRTTVRLSNQRYGMSVSDAT 207

Query: 193 FEIPYDK 199
           F     +
Sbjct: 208 FRYKDPR 214


>gi|222087553|ref|YP_002546090.1| outer membrane lipoproteins carrier protein [Agrobacterium
           radiobacter K84]
 gi|221725001|gb|ACM28157.1| outer membrane lipoproteins carrier protein [Agrobacterium
           radiobacter K84]
          Length = 216

 Score = 96.1 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 51/171 (29%), Positives = 86/171 (50%), Gaps = 3/171 (1%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
                ++  +HF SI+TM+G FLQ    G  + G FF+ RP K  F Y  PS + +I DG
Sbjct: 46  NPSVAQQIADHFSSIKTMKGGFLQIGPRGDQVSGSFFIQRPGKMRFNYDPPSRMRVICDG 105

Query: 91  SNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSF--ITIFFKDDFMG 148
           +N+ V N +  T ++Y L     S++ +N   +  + ++ V++      IT+  +  F  
Sbjct: 106 NNVQVINDQTRTKNMYQLSKTPLSLLLANKIDLSADMVRGVDAQPDLTKITLGNRTVFGD 165

Query: 149 NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           + I++ FD  +Y L  W ++D   + + + I   K N   D  VF I Y +
Sbjct: 166 STIAMIFDSKTYDLRQWTVIDPQGKTTDVIINNVKTNVSFDDSVFRIDYTR 216


>gi|83749191|ref|ZP_00946193.1| Outer-membrane lipoproteins carrier protein [Ralstonia solanacearum
           UW551]
 gi|207742681|ref|YP_002259073.1| outer-membrane lipoprotein carrier protein precursor [Ralstonia
           solanacearum IPO1609]
 gi|83724132|gb|EAP71308.1| Outer-membrane lipoproteins carrier protein [Ralstonia solanacearum
           UW551]
 gi|206594075|emb|CAQ61002.1| outer-membrane lipoprotein carrier protein precursor [Ralstonia
           solanacearum IPO1609]
          Length = 215

 Score = 96.1 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/195 (14%), Positives = 66/195 (33%), Gaps = 16/195 (8%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-----DAGY------VMKGEFFMA 69
           +    A     +  ++++      ++ T +G F+Q        G          G+F  +
Sbjct: 14  LVSLAAWSAGAQAGAIEQLNAFVNNVTTARGEFVQRQVKGGANGSPLRVAGASSGDFIFS 73

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQ 125
           RP +F ++Y  P    L +DG  + +Y+  L   +   L         +++F +N     
Sbjct: 74  RPGRFVWRYLKPYEQQLSADGQMLYIYDKDLSQVTERKLDASLGSSPAAILFGSNDLAKN 133

Query: 126 ESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
            S++   + +                  V     +  L   ++ D+    +++     ++
Sbjct: 134 FSLKEGGTKDGIDWVELTPKAKDTQFERVAIGFRAGELEGMELRDAFGNTTLLTFSHLQK 193

Query: 185 NTVLDPKVFEIPYDK 199
           N  L    F     K
Sbjct: 194 NPQLPASAFRFVPPK 208


>gi|119897657|ref|YP_932870.1| putative outer membrane lipoprotein carrier protein [Azoarcus sp.
           BH72]
 gi|119670070|emb|CAL93983.1| putative outer membrane lipoprotein carrier protein [Azoarcus sp.
           BH72]
          Length = 225

 Score = 96.1 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 33/207 (15%), Positives = 71/207 (34%), Gaps = 20/207 (9%)

Query: 6   YKSVIGV------VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG 59
            K V+G+       ++   + +F             V +  +   + ++ +G+F Q    
Sbjct: 1   MKRVLGMNAGHWGALVVCAALVF---GTRCAVAADGVDQLRQFVTATRSAEGSFEQVVTA 57

Query: 60  Y------VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY--- 110
                    +G F  +RP KF ++Y  P    L+ DG  +  ++  L+  +V  L     
Sbjct: 58  KSGRKPQQSEGSFAFSRPGKFRWQYELPYQQLLVGDGEKLWSWDKDLNQVAVKRLGDALG 117

Query: 111 -MAFSVIFSNNQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIM 168
               +++F  +       +    S                   ++     + +L   ++ 
Sbjct: 118 ATPAAILFGGSDLEQNFELSDGGSAEGLAWVEARPRKPESGFENLRLGLYAGQLRRMEMR 177

Query: 169 DSSRRYSIIKILKYKENTVLDPKVFEI 195
           DS  + ++I   +   N  LDP  F  
Sbjct: 178 DSFGQATVIVFTRLVANPALDPARFRF 204


>gi|319780772|ref|YP_004140248.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317166660|gb|ADV10198.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 227

 Score = 96.1 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 51/186 (27%), Positives = 87/186 (46%), Gaps = 3/186 (1%)

Query: 22  FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSS 80
           F   A+       + +K  +HF S+++M G F+Q    G    G+FF+ RP K  F Y  
Sbjct: 37  FQLLASAQAAVPAAAQKIADHFSSVKSMSGEFVQFGPKGEQTGGKFFLERPGKIRFNYDG 96

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITI 140
            S+  +ISDG ++ + N +L+T  +YPL      ++  N   +  + ++ V+  +   TI
Sbjct: 97  SSNFRVISDGQSVVILNKRLNTSDLYPLSKTPLKLLLDNRIDLSGDRVKSVKQEDDLTTI 156

Query: 141 F--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
               K  F  + I++ FD  ++ L  W I D+  + + + I   KE     P  F I Y 
Sbjct: 157 QLADKSVFGNSKITMMFDPKTFDLRQWTITDAQGKDTTVMIFNTKEGVSFAPDTFAIDYT 216

Query: 199 KIHNIN 204
               +N
Sbjct: 217 ANRELN 222


>gi|93006577|ref|YP_581014.1| outer membrane lipoprotein carrier protein LolA [Psychrobacter
           cryohalolentis K5]
 gi|92394255|gb|ABE75530.1| outer membrane lipoprotein carrier protein LolA [Psychrobacter
           cryohalolentis K5]
          Length = 233

 Score = 96.1 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 33/193 (17%), Positives = 71/193 (36%), Gaps = 8/193 (4%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM---KGEFFMARPSKFYF 76
           AI     A P     + K+  +   + ++M   F Q   G       G   + RP+ F +
Sbjct: 40  AITQSAMAAPADNITAAKRLNKLLTNTKSMTANFSQTTKGANSGTFSGTMSVQRPNNFRW 99

Query: 77  KYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQESIQRVE 132
           +  SPS   ++++GS++ VY+  L+  +   +          ++  +   + +       
Sbjct: 100 ETKSPSEQLIVANGSSMWVYDKDLEQATKQNVDSQVGNTPALLLSGDPSKIDKNFKITQP 159

Query: 133 SNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
             N    + +      +  S++      + +   + DS  + + IK    K N  +    
Sbjct: 160 YANKNYYVLYPKSDSASFKSLSMSFSGGKPVMMVLNDSLGQTTSIKFSGIKMNPSISSNQ 219

Query: 193 FEIPYDK-IHNIN 204
           F+    K +  IN
Sbjct: 220 FKFTPPKGVDIIN 232


>gi|149184982|ref|ZP_01863299.1| outer membrane lipoprotein-sorting protein [Erythrobacter sp.
           SD-21]
 gi|148831093|gb|EDL49527.1| outer membrane lipoprotein-sorting protein [Erythrobacter sp.
           SD-21]
          Length = 220

 Score = 95.7 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 73/184 (39%), Gaps = 8/184 (4%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKY 78
           A F    A        + +A+E    I TM+  F+Q D  G  + G   + RP K  F+Y
Sbjct: 26  ASFYAAPAPVEAATGDLDQAVEALRGISTMRANFVQTDRNGQAVSGVMTLKRPGKIRFEY 85

Query: 79  SSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES--IQRVESNNS 136
                + ++S+G ++ + + +++    +P++      +   ++ V +    +    S+  
Sbjct: 86  EKGVPLLVVSNGKSMYMIDYEVNQVQRWPIKNSPLGALVDPSRDVKKYGRLVPTSHSDVV 145

Query: 137 FITIFFKDDFMGNMISVTFDRL-----SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPK 191
            I +         +I++ F R        RL +W  +DS    + +++   +    +   
Sbjct: 146 SIEVRDPKRPEFGVITLIFARDASAPGGLRLTHWVALDSQNHRTTVRLSNNRYGVSVADS 205

Query: 192 VFEI 195
            F  
Sbjct: 206 AFTF 209


>gi|241663737|ref|YP_002982097.1| outer-membrane lipoprotein carrier protein [Ralstonia pickettii
           12D]
 gi|240865764|gb|ACS63425.1| outer membrane lipoprotein carrier protein LolA [Ralstonia
           pickettii 12D]
          Length = 215

 Score = 95.7 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/195 (14%), Positives = 67/195 (34%), Gaps = 16/195 (8%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-----DAGY------VMKGEFFMA 69
           +    A        +V++      ++ T +G F+Q        G          G+F  +
Sbjct: 14  LVSLAAWSAGAYAGAVEQLNAFVSNVSTARGEFVQRQVKGGTNGSPLRVAGTSNGDFVFS 73

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQ 125
           RP +F ++Y  P    L +DG  + +++  L+  +   L         +++F +N     
Sbjct: 74  RPGRFVWRYVKPYEQQLSADGQTLYIFDKDLNQITERKLDASLGSSPAAILFGSNDLAKN 133

Query: 126 ESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
            +++   + +                  +     S  L   ++ D+    +++     ++
Sbjct: 134 FTLKEGGTKDGIDWAELTPKAKDTQFERIAIGFRSGELQGMELRDAFGNTTLLTFSNIQK 193

Query: 185 NTVLDPKVFEIPYDK 199
           N  L   VF     K
Sbjct: 194 NPQLPANVFRFTPPK 208


>gi|326388589|ref|ZP_08210182.1| outer membrane lipoprotein carrier protein LolA [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326206840|gb|EGD57664.1| outer membrane lipoprotein carrier protein LolA [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 231

 Score = 95.7 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 34/201 (16%), Positives = 72/201 (35%), Gaps = 8/201 (3%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFM 68
              ++L   S     +A        +V +AI    +I TM+  F+Q D  G  + G   M
Sbjct: 27  FSSILLSAVSFPSVAHADPAGAHPAAVDEAIAALRAITTMRADFVQTDANGGRLNGTLTM 86

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQH--VIQE 126
            RP K  F+Y     + ++SDG+ + + + ++     +P+R      +   N+       
Sbjct: 87  KRPGKIRFQYQPGVPLLIVSDGAALTMIDYEVRQVQRWPIRNSPLGALLDPNKDVARFAR 146

Query: 127 SIQRVESNNSFITIFFKDDFMGNMISVTFDRL-----SYRLLNWKIMDSSRRYSIIKILK 181
            I     +   + +          +++   R         L +W   D+  R + + ++ 
Sbjct: 147 LIPTGRPDQVSVAVRDPSHPEYGTLTLQMVRKASAPGGLELDSWITTDAQARRTTVHLMN 206

Query: 182 YKENTVLDPKVFEIPYDKIHN 202
            +    ++   F        N
Sbjct: 207 PQYGIPVNEITFRYRDPNPQN 227


>gi|187929628|ref|YP_001900115.1| outer-membrane lipoprotein carrier protein [Ralstonia pickettii
           12J]
 gi|309781606|ref|ZP_07676340.1| outer membrane lipoprotein carrier protein LolA [Ralstonia sp.
           5_7_47FAA]
 gi|229485836|sp|B2U9Y9|LOLA_RALPJ RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|187726518|gb|ACD27683.1| outer membrane lipoprotein carrier protein LolA [Ralstonia
           pickettii 12J]
 gi|308919581|gb|EFP65244.1| outer membrane lipoprotein carrier protein LolA [Ralstonia sp.
           5_7_47FAA]
          Length = 215

 Score = 95.7 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 31/215 (14%), Positives = 72/215 (33%), Gaps = 23/215 (10%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---- 56
           M  L  + ++          +    A        +V++      ++ T +G F+Q     
Sbjct: 1   MFVLNARHLMAA-------GLVSLAAWSAGAYAGAVEQLNAFVSNVSTARGEFVQRQVKG 53

Query: 57  -DAGY------VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR 109
              G          G+F  +RP +F ++Y  P    L +DG  + +++  L+  +   L 
Sbjct: 54  GTNGSPLRVAGTSNGDFVFSRPGRFVWRYVKPYEQQLSADGQMLYIFDKDLNQITERKLD 113

Query: 110 ----YMAFSVIFSNNQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLN 164
                   +++F +N      +++   + +                  +     S  L  
Sbjct: 114 ASLGSSPAAILFGSNDLAKNFTLKEGGTKDGIDWVELTPKAKDTQFQRIAIGFRSGELQG 173

Query: 165 WKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            ++ D+    +++     ++N  L   VF     K
Sbjct: 174 MELRDAFGNTTLLTFSNIQKNPQLPANVFRFTPPK 208


>gi|188583703|ref|YP_001927148.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           populi BJ001]
 gi|179347201|gb|ACB82613.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           populi BJ001]
          Length = 314

 Score = 95.3 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 36/178 (20%), Positives = 74/178 (41%), Gaps = 5/178 (2%)

Query: 25  NAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSS 83
            +         V  A  +F   QT+ G F+Q    G  + G+  +A+P +  F+Y  PS 
Sbjct: 120 ASLQDADPATVVAAANAYFNGFQTLTGGFIQIGADGRRIGGKLTLAKPGRLRFEYDQPSP 179

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNN----SFIT 139
           + +++DG+++AV + KL T  +Y +       +  +   + ++      +N+        
Sbjct: 180 LEVVADGTSVAVRDRKLGTQDLYFISQTPLKFLLRDKIDLARDLTVTEVTNDPGGVRIAL 239

Query: 140 IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
                    + I + FD     L  W+I D     + +++   ++   +D  +F I Y
Sbjct: 240 EDRSTLGGTSKIQLFFDGELKTLSQWRITDPQGYLTTVQLSNLQKGKAVDGSLFFINY 297


>gi|307825886|ref|ZP_07656101.1| outer membrane lipoprotein carrier protein LolA [Methylobacter
           tundripaludum SV96]
 gi|307733005|gb|EFO03867.1| outer membrane lipoprotein carrier protein LolA [Methylobacter
           tundripaludum SV96]
          Length = 196

 Score = 95.3 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/189 (15%), Positives = 58/189 (30%), Gaps = 11/189 (5%)

Query: 22  FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------VMKGEFFMARPSKFY 75
                     +D+ VK+      + +++   F Q              G F++ RP KF 
Sbjct: 1   MLLFNISGYAEDKPVKQLRAFLKNTKSLTADFKQVLINEAGNPTQTSYGIFYLQRPGKFR 60

Query: 76  FKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAFSVIFSNNQHVIQESIQR 130
           + Y  P    ++S    +  Y+  L+  +V  L        A  +    +        Q+
Sbjct: 61  WDYLKPFQQQIVSTSGKVWFYDTDLEQVTVKKLDESVGSTPALLLSGEISLDENFTMEQQ 120

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
               N         +   +   V     +  L   ++ D+  + + I       N  L  
Sbjct: 121 GVDGNLMWIKLLPKNQESSFKYVLIGLNNDSLGGMELSDNFGQLTRIYFSNVILNPPLKQ 180

Query: 191 KVFEIPYDK 199
            +FE    K
Sbjct: 181 TLFEFKAPK 189


>gi|304394438|ref|ZP_07376361.1| outer membrane lipoprotein carrier protein LolA [Ahrensia sp.
           R2A130]
 gi|303293878|gb|EFL88255.1| outer membrane lipoprotein carrier protein LolA [Ahrensia sp.
           R2A130]
          Length = 220

 Score = 95.3 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 50/195 (25%), Positives = 94/195 (48%), Gaps = 3/195 (1%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFF 67
           ++ ++         P +A       ++V +  +HF S+ +M G F+Q    G    G+F+
Sbjct: 16  LVVMIAGIASLMANPASAKVTNADKKAVAQISQHFSSVPSMAGEFIQFGPNGEQTGGKFY 75

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           + RP K  F Y++PS +++ +DG  + + N KL TW  +PLR     ++ S+   V  +S
Sbjct: 76  LQRPGKIRFDYANPSPITVKADGKTVGINNKKLKTWDFFPLRKTPLRLLLSDKIDVNDKS 135

Query: 128 IQRVESNNSFITIF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           I+ V+      T+    K  F  + I++ FD  +  L  W I D   + + + I   ++N
Sbjct: 136 IKSVKREKDLTTVMLANKSVFGNSKITMMFDPETSDLRQWTITDDQGKDTSVMIFNVQKN 195

Query: 186 TVLDPKVFEIPYDKI 200
             L  ++F +   +I
Sbjct: 196 VKLSKRLFYMNQREI 210


>gi|13473591|ref|NP_105159.1| hypothetical protein mll4242 [Mesorhizobium loti MAFF303099]
 gi|14024341|dbj|BAB50945.1| mll4242 [Mesorhizobium loti MAFF303099]
          Length = 229

 Score = 95.3 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 50/186 (26%), Positives = 86/186 (46%), Gaps = 3/186 (1%)

Query: 22  FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSS 80
           F   A+       + +K  +HF S+++M G F+Q    G    G+FF+ RP K  F Y  
Sbjct: 40  FELLASAQAAVPAAAQKIADHFSSVKSMSGEFVQFGPKGEQTGGKFFLERPGKIRFNYDG 99

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITI 140
            S+  +ISDG ++ + N K++T  +YPL      ++  +   +  + ++ V+  +   TI
Sbjct: 100 ASNFKVISDGKSVVILNKKMNTSDLYPLSKTPLKLLLDDRIDLSGDRVKSVKEEDDLTTI 159

Query: 141 FFKDDFMGN--MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
              D  +     I++ FD  +Y L  W I D+  + + + I   KE     P  F I Y 
Sbjct: 160 QLSDKAVFGNARITMMFDPKTYDLRQWTITDAQGKDTTVMIFNTKEGVSFAPDTFAIDYT 219

Query: 199 KIHNIN 204
               +N
Sbjct: 220 ANRELN 225


>gi|260464218|ref|ZP_05812411.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium
           opportunistum WSM2075]
 gi|259030021|gb|EEW31304.1| outer membrane lipoprotein carrier protein LolA [Mesorhizobium
           opportunistum WSM2075]
          Length = 226

 Score = 95.0 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 49/186 (26%), Positives = 86/186 (46%), Gaps = 3/186 (1%)

Query: 22  FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSS 80
           F   A+       + +K  +HF ++++M G F+Q    G    G+FF+ RP K  F Y  
Sbjct: 37  FQLLASAQAAVPAAAQKIADHFSAVKSMSGEFVQFGPKGEQTGGKFFLERPGKIRFNYDG 96

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITI 140
            S+  +ISDG ++ + N K++T  +YPL      ++  +   +  + ++ V+  +   TI
Sbjct: 97  SSNFKVISDGKSVVILNKKMNTSDLYPLSKTPLKLLLDDRIDLSGDRVKSVKQEDDLTTI 156

Query: 141 FFKDDFMGN--MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
              D  +     I++ FD  +Y L  W I D+  + + + I   KE     P  F I Y 
Sbjct: 157 QLSDKSVFGNARITMMFDPKTYDLRQWTITDAQGKDTTVMIFNTKEGVSFAPDTFAIDYT 216

Query: 199 KIHNIN 204
               +N
Sbjct: 217 ANRELN 222


>gi|83595027|ref|YP_428779.1| outer membrane lipoprotein carrier protein LolA [Rhodospirillum
           rubrum ATCC 11170]
 gi|83577941|gb|ABC24492.1| Outer membrane lipoprotein carrier protein LolA [Rhodospirillum
           rubrum ATCC 11170]
          Length = 221

 Score = 95.0 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 32/170 (18%), Positives = 70/170 (41%), Gaps = 5/170 (2%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISD 89
            +   V +   +   ++ +Q  FLQ    G   +G   ++RP++   +Y  P+ + ++++
Sbjct: 40  DQRAFVARVEGYLNGVRRVQARFLQVSSTGNYAEGTVSISRPNRMRLQYDPPADLLMVAN 99

Query: 90  GSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI----QRVESNNSFITIFFKDD 145
           GS +  Y+ +LD  S   L      V+  +   +   +I     R       I +   +D
Sbjct: 100 GSQLVYYDRELDQVSYIGLDSTPLGVLLRDKIELSDPNITVTAYREAKGVVEIALVQTND 159

Query: 146 FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
                +++ F      L  W+++D+      + +   +    LDPK+F  
Sbjct: 160 PGQGTLTLVFTTDPLELRQWRVLDAQNVEVSVSLFNPQVGLALDPKLFVF 209


>gi|218532291|ref|YP_002423107.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           chloromethanicum CM4]
 gi|254563360|ref|YP_003070455.1| hypothetical protein METDI5027 [Methylobacterium extorquens DM4]
 gi|218524594|gb|ACK85179.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           chloromethanicum CM4]
 gi|254270638|emb|CAX26642.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens DM4]
          Length = 315

 Score = 95.0 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 38/178 (21%), Positives = 78/178 (43%), Gaps = 5/178 (2%)

Query: 25  NAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSS 83
            +         V  A  +F   QT+ G F+Q    G  + G+  +A+P +  F+Y  PS 
Sbjct: 121 ASLQDADPATVVAAANSYFNGFQTLTGGFIQIGADGRRIGGKLTLAKPGRLRFEYDQPSP 180

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFF 142
           + +++DG+++AV + KL T  +Y +       +      + ++ ++  V ++   + I  
Sbjct: 181 LEVVADGTSVAVRDRKLGTQDLYFISQTPLKFLLREKIDLARDLTVSEVTNDPGGVRIGL 240

Query: 143 KDDFMGN---MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
           +D         I + FD     L  W+I D     + +++   ++   +D  +F I Y
Sbjct: 241 EDRSTLGGTSKIQLFFDAEMKTLSQWRITDPQGYLTTVQLSNLQKGKAVDGSLFFINY 298


>gi|163853431|ref|YP_001641474.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           extorquens PA1]
 gi|163665036|gb|ABY32403.1| outer membrane lipoprotein carrier protein LolA [Methylobacterium
           extorquens PA1]
          Length = 315

 Score = 95.0 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 38/178 (21%), Positives = 78/178 (43%), Gaps = 5/178 (2%)

Query: 25  NAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSS 83
            +         V  A  +F   QT+ G F+Q    G  + G+  +A+P +  F+Y  PS 
Sbjct: 121 ASLQDADPATVVAAANSYFNGFQTLTGGFIQIGADGRRIGGKLTLAKPGRLRFEYDQPSP 180

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFF 142
           + +++DG+++AV + KL T  +Y +       +      + ++ ++  V ++   + I  
Sbjct: 181 LEVVADGTSVAVRDRKLGTQDLYFISQTPLKFLLREKIDLARDLTVSEVTNDPGGVRIGL 240

Query: 143 KDDFMGN---MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
           +D         I + FD     L  W+I D     + +++   ++   +D  +F I Y
Sbjct: 241 EDRSTLGGTSKIQLFFDAEMKTLSQWRITDPQGYLTTVQLSNLQKGKAVDGSLFFINY 298


>gi|118591354|ref|ZP_01548752.1| hypothetical protein SIAM614_26943 [Stappia aggregata IAM 12614]
 gi|118436026|gb|EAV42669.1| hypothetical protein SIAM614_26943 [Stappia aggregata IAM 12614]
          Length = 215

 Score = 95.0 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 46/170 (27%), Positives = 87/170 (51%), Gaps = 4/170 (2%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           + +++     +F S++TM G F+Q    G    G+F+MARP K  F Y+ PS + +++DG
Sbjct: 37  EQKTLTDLNSYFNSVKTMHGDFIQFGPDGNQSDGKFYMARPGKVRFYYNKPSVLDIVADG 96

Query: 91  SNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQR---VESNNSFITIFFKDDFM 147
            +++V + KL+T  ++PL       + S++  + +++      VE +   +TIF K  F 
Sbjct: 97  KSVSVRDRKLNTQDIWPLGQTPLRFLLSDDIDLQKDTNVTNVLVEEDLITVTIFDKTKFN 156

Query: 148 GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
              +++ FD   Y L  W + D     + + +     N   +P +F+I Y
Sbjct: 157 SGTLTLIFDAKDYALKQWTVTDQQGYDTSVAVYNVVSNGPTNPDLFKIDY 206


>gi|240140851|ref|YP_002965331.1| hypothetical protein MexAM1_META1p4423 [Methylobacterium extorquens
           AM1]
 gi|240010828|gb|ACS42054.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens AM1]
          Length = 315

 Score = 95.0 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 38/177 (21%), Positives = 78/177 (44%), Gaps = 5/177 (2%)

Query: 26  AAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSV 84
           +         V  A  +F   QT+ G F+Q    G  + G+  +A+P +  F+Y  PS +
Sbjct: 122 SLQDADPATVVAAANSYFNGFQTLTGGFIQIGADGRRIGGKLTLAKPGRLRFEYDQPSPL 181

Query: 85  SLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE-SIQRVESNNSFITIFFK 143
            +++DG+++AV + KL T  +Y +       +      + ++ ++  V ++   + I  +
Sbjct: 182 EVVADGTSVAVRDRKLGTQDLYFISQTPLKFLLREKIDLARDLTVSEVTNDPGGVRIGLE 241

Query: 144 DDFMGN---MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
           D         I + FD     L  W+I D     + +++   ++   +D  +F I Y
Sbjct: 242 DRSTLGGTSKIQLFFDAEMKTLSQWRITDPQGYLTTVQLSNLQKGKAVDGSLFFINY 298


>gi|170722572|ref|YP_001750260.1| outer-membrane lipoprotein carrier protein [Pseudomonas putida
           W619]
 gi|229485835|sp|B1JBE3|LOLA_PSEPW RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|169760575|gb|ACA73891.1| outer membrane lipoprotein carrier protein LolA [Pseudomonas putida
           W619]
          Length = 211

 Score = 95.0 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 29/203 (14%), Positives = 67/203 (33%), Gaps = 11/203 (5%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YV 61
             I ++++   +             +Q V++  +     QT++  F Q            
Sbjct: 2   RAIRMLLVSALTLGSLSATLSAHAGEQDVQRLTQLLEKSQTIEANFSQLTLDAGGTSLQE 61

Query: 62  MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVI 116
             G+  + RP  FY+   +P    ++SDG N+ +++  L+  ++        +  A  + 
Sbjct: 62  TTGKMTVKRPGLFYWHTDAPQEQVVVSDGKNVTLWDPDLEQATIKKLDVRLNQTPALLLS 121

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
              ++      I   E                   S+        + + +++DS  + + 
Sbjct: 122 GDVSKISQSFDITSKEQGEVMDFTLKPTTKDTLFDSLRVSFRRGLINDMQLIDSVGQRTN 181

Query: 177 IKILKYKENTVLDPKVFEIPYDK 199
           I     K N  +    F+    K
Sbjct: 182 ILFNGVKANQAVPDSTFKFDIPK 204


>gi|146307410|ref|YP_001187875.1| outer-membrane lipoprotein carrier protein [Pseudomonas mendocina
           ymp]
 gi|166230495|sp|A4XUX7|LOLA_PSEMY RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|145575611|gb|ABP85143.1| outer membrane lipoprotein carrier protein LolA [Pseudomonas
           mendocina ymp]
          Length = 208

 Score = 94.6 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 68/201 (33%), Gaps = 11/201 (5%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMK 63
           + V+ L   +A+          ++ + K+  E     QT+   F Q              
Sbjct: 1   MRVIRLLMLAALSFTLLTAQADEEAATKRLTELLSQAQTISARFSQLTLDASGTQLQETA 60

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVIFS 118
           G+  + RP  F +    P    L+S+G  + +Y+  L+  ++           A  +   
Sbjct: 61  GQLVLKRPGLFRWHTDEPMEQLLVSNGQKVWLYDPDLEQVTIQSLDQRLTHTPALLLSGD 120

Query: 119 NNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
            +Q      I   E  +    I           S+     +  L + +++DS  + + I 
Sbjct: 121 VSQIRENFEIDYKEGGSVVDFILKPKAKDSLFDSLRLSFRNRMLNDMQLIDSIGQRTNIL 180

Query: 179 ILKYKENTVLDPKVFEIPYDK 199
            L  K N  ++  +F     +
Sbjct: 181 FLNVKMNEPVEDHLFTFDIPE 201


>gi|254489676|ref|ZP_05102872.1| outer membrane lipoprotein carrier protein LolA [Methylophaga
           thiooxidans DMS010]
 gi|224465085|gb|EEF81338.1| outer membrane lipoprotein carrier protein LolA [Methylophaga
           thiooxydans DMS010]
          Length = 212

 Score = 94.6 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 34/206 (16%), Positives = 71/206 (34%), Gaps = 16/206 (7%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG---- 59
           +  K ++  + L          A           K  +    ++T Q  F Q        
Sbjct: 1   MTMKQIMAGLFLSLLLVTGLSQAQTTGE-----DKLNQFVQHVETFQAAFEQTVIDPEGQ 55

Query: 60  --YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAF 113
                +G F ++RP KF + Y +P    +++DG NI  Y+  L+  +V   +        
Sbjct: 56  VMEQAQGLFVLSRPGKFRWDYETPYPQKIVADGKNIWFYDVDLEQVTVKSQQEALAETPA 115

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDRLSYRLLNWKIMDSSR 172
           +++        + +I  + S++  + +         N  +VT       L    + DS  
Sbjct: 116 TLLSGELVPEDKYNINNLPSDDGLLWVELTPKQTESNFQAVTLAFDGDVLQQMIMRDSFD 175

Query: 173 RYSIIKILKYKENTVLDPKVFEIPYD 198
           + + +   +  EN      +F+    
Sbjct: 176 QRTRLTFTQVIENPKFKQDMFKFTPP 201


>gi|71066126|ref|YP_264853.1| outer membrane lipoprotein carrier [Psychrobacter arcticus 273-4]
 gi|71039111|gb|AAZ19419.1| probable outer membrane lipoprotein carrier [Psychrobacter arcticus
           273-4]
          Length = 233

 Score = 94.6 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 32/193 (16%), Positives = 74/193 (38%), Gaps = 8/193 (4%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM---KGEFFMARPSKFYF 76
           A+     A P  K  + K+  +   + ++M   F Q   G       G   + RP+ F +
Sbjct: 40  ALTQSATAAPADKLTASKRLNKLLTNTKSMTANFSQTTKGANSGTFSGAMSVQRPNNFRW 99

Query: 77  KYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQESIQRVE 132
           +  SPS   ++++GS++ VY+  L+  +   +          ++  +   + +       
Sbjct: 100 ETKSPSEQLIVANGSSMWVYDKDLEQATKQKVDSQVGNTPALLLSGDPSKIDKNFKITQP 159

Query: 133 SNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
             N    + +      +  S++      + +   + DS  + + I+  + K N+ +    
Sbjct: 160 YANKNYYVLYPKSDSASFKSLSMSFSGGKPVMMVLNDSLGQTTSIRFSRIKMNSSISSSQ 219

Query: 193 FEIPYDK-IHNIN 204
           F+    K +  IN
Sbjct: 220 FKFTPPKGVDIIN 232


>gi|90421062|ref|ZP_01228965.1| outer membrane lipoprotein carrier protein [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90334697|gb|EAS48474.1| outer membrane lipoprotein carrier protein [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 214

 Score = 94.6 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 51/164 (31%), Positives = 79/164 (48%), Gaps = 4/164 (2%)

Query: 41  EHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF  I +M G F+Q D  G   +G+F++ +P K  F Y+    + +I+DGS +A+ N K
Sbjct: 46  DHFAGIPSMHGDFVQFDPNGRQTEGKFYIEKPGKVRFDYTQQP-LRVIADGSTVAINNKK 104

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGN--MISVTFDR 157
           L+TW  YPL      ++      + Q +IQ V+      TI   D  +     I++ FD 
Sbjct: 105 LNTWDTYPLSKTPLKLLLDRRIDLSQANIQSVKEEPDLTTIVMGDSSIFGNSRITLMFDP 164

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIH 201
            SY L  W I D   + + + I   K    +    F+IPY  I 
Sbjct: 165 KSYELKQWTIRDQQGKDTTVMIYNVKHGGDIAESTFKIPYTAIA 208


>gi|331004979|ref|ZP_08328389.1| Outer membrane lipoprotein carrier protein LolA [gamma
           proteobacterium IMCC1989]
 gi|330421221|gb|EGG95477.1| Outer membrane lipoprotein carrier protein LolA [gamma
           proteobacterium IMCC1989]
          Length = 206

 Score = 94.6 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 63/194 (32%), Gaps = 12/194 (6%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMA 69
                 F  +    +     V    E  + + T  G F Q              G FF+ 
Sbjct: 7   VVCGFCFCLSVFTTMANAADVDVLAEKLVQLSTFSGDFRQTLIDDQGEVLQESTGVFFLE 66

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT----WSVYPLRYMAFSVIFSNNQHVIQ 125
           RP  F+++  +P    L+SD ++I +Y+  L+          +      ++  +   +  
Sbjct: 67  RPGYFHWETIAPFPQLLVSDLASIWLYDPDLEQVTVRPYDESVSQTPALLLSGDVSKMSA 126

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
                  ++N F               +  +    +L++  + DS  + +    L    N
Sbjct: 127 SYEVVQTTDNQF--SLTPKSQQELFTQLMVEFAEGQLVSMSLQDSLGQTTTFTFLNGIYN 184

Query: 186 TVLDPKVFEIPYDK 199
             +  ++F+    +
Sbjct: 185 QPIPSELFQFIPPE 198


>gi|253996803|ref|YP_003048867.1| outer membrane lipoprotein carrier protein LolA [Methylotenera
           mobilis JLW8]
 gi|253983482|gb|ACT48340.1| outer membrane lipoprotein carrier protein LolA [Methylotenera
           mobilis JLW8]
          Length = 216

 Score = 94.6 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 30/196 (15%), Positives = 56/196 (28%), Gaps = 11/196 (5%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM------KGEFFM 68
                 + P     P      +      +   Q ++ +F Q             +G   +
Sbjct: 14  FINSLLVLPALFLMPAAHADGMDSVKAFYEKTQAVRASFHQVVTDKQGRKVQEVQGTMQL 73

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFSNNQHV 123
            RP+KF + Y  P    +ISDG  + +Y+ +L   +V  +           +        
Sbjct: 74  KRPNKFRWDYHKPYEQQIISDGKQVWLYDTELAQVTVRDIGKALGSSPAALLAGGKAIEE 133

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
                     +          D       +       ++    ++DS    + I   K +
Sbjct: 134 TFTLANASNRDGLNWVSAQPKDKESGFEKILLGFKDNQIQEMALLDSFGHNTKIVFSKVE 193

Query: 184 ENTVLDPKVFEIPYDK 199
            N  LD K F     K
Sbjct: 194 VNPALDEKSFLFKPPK 209


>gi|323138222|ref|ZP_08073294.1| outer membrane lipoprotein carrier protein LolA [Methylocystis sp.
           ATCC 49242]
 gi|322396474|gb|EFX99003.1| outer membrane lipoprotein carrier protein LolA [Methylocystis sp.
           ATCC 49242]
          Length = 257

 Score = 94.6 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 78/171 (45%), Gaps = 5/171 (2%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVSLIS 88
           + +++++K+A   F +   M   F+Q    G   +G+  + R  +  F+Y+ P+++ +++
Sbjct: 85  LNREEAIKRANAFFNTSPVMTADFVQIGADGKRSEGKLHVQRAGRVRFEYAQPATMEVVA 144

Query: 89  DGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNS----FITIFFKD 144
           DG+ +AV + KL T  +Y +       +  +   + ++   +  + +             
Sbjct: 145 DGAQVAVRDRKLGTQDLYFITQTPLKFLMKDKIDLEKDVTVQDVTFDDSGVTIFIEDKAT 204

Query: 145 DFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
               + + + FD  +++L  W++ D     ++I +    +    DP +F+I
Sbjct: 205 FGGTSHLRLIFDPKTFKLKQWQVKDPQGYETLISLFNIDQTKTPDPGLFKI 255


>gi|315497244|ref|YP_004086048.1| outer membrane lipoprotein carrier protein lola [Asticcacaulis
           excentricus CB 48]
 gi|315415256|gb|ADU11897.1| outer membrane lipoprotein carrier protein LolA [Asticcacaulis
           excentricus CB 48]
          Length = 221

 Score = 94.2 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/221 (19%), Positives = 90/221 (40%), Gaps = 19/221 (8%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAA-------------YPITKDQSVKKAIEHFLSIQ 47
           M  L  ++++  +         P  A              +       + +A+ +  S+ 
Sbjct: 1   MTELTKRALLTGLTAASLLTTAPAWAQGRNTIQQFVTPPKFSAQDQGRIDRAVAYLQSLG 60

Query: 48  TMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY 106
           T  G F Q D  G    G++++ RP K  F+Y +P S+ ++SDG  +  ++ +L  ++ Y
Sbjct: 61  TGGGRFEQTDYKGRTTAGKWWLQRPGKIRFEYDAPYSLLVVSDGKTVNTWDPRLKAFNQY 120

Query: 107 PLRYMAFSVIFSNNQHVIQESIQRV---ESNNSFITIFFKDDFMGNMISVTFDR--LSYR 161
           PL     S+  S    + Q  I       ++   +    +   +   I +TF     + +
Sbjct: 121 PLNATPLSLFLSKQIRLDQGVIVTEVTPTTDGFRLKARDRRRDVEGSILMTFIERGNALQ 180

Query: 162 LLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
           L  W + D   + + ++++ +  NT + P +F +   K  N
Sbjct: 181 LGEWTVTDQQGKGTRVRLVTFDRNTAVRPDLFVLKKPKGAN 221


>gi|312114954|ref|YP_004012550.1| outer membrane lipoprotein carrier protein LolA [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311220083|gb|ADP71451.1| outer membrane lipoprotein carrier protein LolA [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 292

 Score = 94.2 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 47/177 (26%), Positives = 81/177 (45%), Gaps = 4/177 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK-GEFFMARPSKFYFKYSSP 81
           P  A    +  + V K  ++F  +  +QG F+Q D     K G+F++AR  K  F Y +P
Sbjct: 106 PAAAPIQESDLEVVAKINDYFNKMTFLQGVFVQSDPDTKQKRGKFYLARGGKVRFDYGAP 165

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNS---FI 138
           S + +I+DG  +A+ +  L+T   YPL    F ++ S +  +I ++        +    +
Sbjct: 166 SRLKIIADGKYLAIEDHDLNTSDRYPLEVTPFRLLLSEHVDLINDANILGVEQWTDVVVL 225

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
           T+  K       I + F +    L  W I D+    + I++   +EN    P VFE 
Sbjct: 226 TVEDKKGDGSGRIRLMFSKPDMVLKEWIITDAQGLSTKIEVANLEENKAPAPDVFEF 282


>gi|85712405|ref|ZP_01043455.1| Outer membrane lipoprotein-sorting protein [Idiomarina baltica
           OS145]
 gi|85693848|gb|EAQ31796.1| Outer membrane lipoprotein-sorting protein [Idiomarina baltica
           OS145]
          Length = 204

 Score = 94.2 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/200 (15%), Positives = 68/200 (34%), Gaps = 10/200 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK-- 63
            K     + L     + P + A     +Q+ ++  +    ++++Q +F Q   G   +  
Sbjct: 1   MKQYGIALALIASVVMSPLSWAT----EQAKQQLQDKMQQLESVQASFEQTVTGSSGEVL 56

Query: 64  ----GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               GE  + RP+   ++ + P    LI+DG ++  YN  ++  +VY       +     
Sbjct: 57  QSLTGELALQRPAMLRWRSNPPDDTLLIADGESVWYYNPFVEQVTVYAQSNAVENSPLLL 116

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
                +E  Q+ +         F+         +       +L    +       + I +
Sbjct: 117 LMEGSKERWQQFDVTYDSAEGAFEVVNENTGSELNLSFTGDKLARIVLKQKQGDTTTIAL 176

Query: 180 LKYKENTVLDPKVFEIPYDK 199
                N  L   +F+    +
Sbjct: 177 TDVVMNERLPTDLFQFAIPE 196


>gi|49079610|gb|AAT49911.1| PA2614 [synthetic construct]
          Length = 209

 Score = 93.8 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/200 (15%), Positives = 68/200 (34%), Gaps = 11/200 (5%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMK 63
           + ++   F +A+    +        +V++        QT+   F Q              
Sbjct: 1   MRLIRTLFVAALAMGASLAHADDSAAVQRLTGLLNKAQTLTARFSQLTLDGSGTRLQETA 60

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFS 118
           G+  + RP  F +   +P+   LIS+G  + +Y+  L+  ++  L           +   
Sbjct: 61  GQLSLKRPGLFRWHTDAPNEQLLISNGEKVWLYDPDLEQVTIQKLDQRLTQTPALLLSGD 120

Query: 119 NNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
            ++     +I   E  N    +           ++     S ++ + +++D   + + I 
Sbjct: 121 ISKISESFAITYKEGGNVVDFVLKPKTKDTLFDTLRLSFRSGKVNDMQMIDGVGQRTNIL 180

Query: 179 ILKYKENTVLDPKVFEIPYD 198
               K N  LD K F     
Sbjct: 181 FFDVKMNEALDAKQFTFDVP 200


>gi|296282149|ref|ZP_06860147.1| outer membrane lipoprotein-sorting protein [Citromicrobium
           bathyomarinum JL354]
          Length = 222

 Score = 93.8 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 75/190 (39%), Gaps = 8/190 (4%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYF 76
            +A     A        S+  A+     I TM+ +F Q D +G  ++G   + RP K  F
Sbjct: 26  IAATVALPAPALAQAGGSLDDAVAALRGISTMRASFTQTDRSGQTVRGTMTLKRPGKIRF 85

Query: 77  KYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNS 136
           +YS    + ++S+G ++ + + +++    +P+       +   N+ V +    R   N +
Sbjct: 86  EYSKDVPLLIVSNGKSLTMVDYEVNQVQRWPISNSPLGALLDPNRDVKKYGKLRNTGNPN 145

Query: 137 F--ITIFFKDDFMGNMISVTFDRL-----SYRLLNWKIMDSSRRYSIIKILKYKENTVLD 189
              + +         +I++ F R       + L NW  +D+    + +++   +    + 
Sbjct: 146 VLSVEVRDPKKPEYGVITLIFVRKAGAPGGWELTNWVSLDAQNNRTTVRLANQRYGVSVS 205

Query: 190 PKVFEIPYDK 199
              F     +
Sbjct: 206 DSTFTYKDPR 215


>gi|330503297|ref|YP_004380166.1| outer-membrane lipoprotein carrier protein [Pseudomonas mendocina
           NK-01]
 gi|328917583|gb|AEB58414.1| outer-membrane lipoprotein carrier protein [Pseudomonas mendocina
           NK-01]
          Length = 208

 Score = 93.8 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 35/200 (17%), Positives = 66/200 (33%), Gaps = 11/200 (5%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMK 63
           + V+ L   +A+          ++ + K+  E     QT+   F Q              
Sbjct: 1   MRVIRLLMLAALSFTLLTAQADEEAATKRLTELLNQAQTINARFSQLTLDASGTQLQETA 60

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVIFS 118
           GE  + RP  F +    P    L+S+G  + +Y+  L+  ++           A  +   
Sbjct: 61  GELVLKRPGLFRWHTDQPMEQLLVSNGEKVWLYDPDLEQVTIQTLDQRLTHTPALLLSGD 120

Query: 119 NNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
            +Q      I   E  +    I           S+     +  L + +++DS  + + I 
Sbjct: 121 VSQIRENFEIDYKEGGSVVDFILKPKAKDSLFDSLRLSFRNRMLNDMQLIDSIGQRTNIL 180

Query: 179 ILKYKENTVLDPKVFEIPYD 198
            L  K N  +D   F     
Sbjct: 181 FLNVKMNEPVDDGQFTFDIP 200


>gi|26990708|ref|NP_746133.1| outer-membrane lipoprotein carrier protein [Pseudomonas putida
           KT2440]
 gi|24985701|gb|AAN69597.1|AE016593_5 outer membrane lipoprotein carrier protein [Pseudomonas putida
           KT2440]
          Length = 228

 Score = 93.8 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/197 (15%), Positives = 65/197 (32%), Gaps = 11/197 (5%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFF 67
           I     +     +      +Q V++  +     QT++  F Q   G          G+  
Sbjct: 25  IRMLLVSALTLGSVTAYAGEQDVQRLTQLLEKSQTIEANFSQLTLGADGTSLQETSGKMT 84

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVIFSNNQH 122
           + RP  FY+   +P    ++SDG N+ +++  L+  ++        +  A  +    ++ 
Sbjct: 85  VKRPGLFYWHTDAPQEQVVVSDGKNVTLWDPDLEQATIKKLDVRLNQTPALLLSGDVSKI 144

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
                I   E                   S+        + + +++DS  + + I     
Sbjct: 145 SQSFDIASKEQGEVMDFTLKPKTKDTLFDSLRVSFRKGLINDMQLIDSVGQRTNILFNGV 204

Query: 183 KENTVLDPKVFEIPYDK 199
           K N  +    F+    K
Sbjct: 205 KANQAVPDSKFKFDIPK 221


>gi|16127935|ref|NP_422499.1| hypothetical protein CC_3705 [Caulobacter crescentus CB15]
 gi|221236756|ref|YP_002519193.1| outer-membrane lipoproteins carrier protein [Caulobacter crescentus
           NA1000]
 gi|13425471|gb|AAK25667.1| hypothetical protein CC_3705 [Caulobacter crescentus CB15]
 gi|220965929|gb|ACL97285.1| outer-membrane lipoproteins carrier protein [Caulobacter crescentus
           NA1000]
          Length = 219

 Score = 93.8 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/181 (20%), Positives = 79/181 (43%), Gaps = 4/181 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSP 81
           P  A     +   + KA  +   + + +G F+Q D  G   +G F++ RP K  F Y  P
Sbjct: 33  PVPAQLSAEQKALLDKATAYIQGLSSAKGRFVQTDQRGTQTQGTFYLQRPGKARFAYDPP 92

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVES---NNSFI 138
           + + ++S+G+N+ +++++L T+  YPL     +++ +    + +  +        +   I
Sbjct: 93  AGLLVVSNGNNVNIFDSRLKTYESYPLSKTPLNLLLAREVRLDRGVVITDVRPLADGFTI 152

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                       IS+ F      L+ W + D       +++  + E   LDPK+F +   
Sbjct: 153 VAQDAKRQALGRISIDFSNGLVGLMGWTVTDIKGGQIRVRLSDFAETADLDPKLFVLTDP 212

Query: 199 K 199
           +
Sbjct: 213 R 213


>gi|126738704|ref|ZP_01754409.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseobacter sp. SK209-2-6]
 gi|126720503|gb|EBA17209.1| outer membrane lipoprotein carrier protein LolA, putative
           [Roseobacter sp. SK209-2-6]
          Length = 197

 Score = 93.8 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/165 (16%), Positives = 66/165 (40%), Gaps = 5/165 (3%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
           S+ +   +   ++T   +F Q  D G +  G+ ++ RP +  F+Y      ++++    +
Sbjct: 24  SLNEISGYLNGLKTATASFSQISDDGSLTTGKLYLHRPGRMRFEYDGDGGGTVVAGAGAV 83

Query: 94  AVYNAK-LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITI---FFKDDFMGN 149
            V++ K       +PLR    S+I +    + + ++      +   TI      ++    
Sbjct: 84  VVHDPKSNQPPETFPLRRTPLSIILAKKVDLGRANMVVGHGFDGTTTIVRAQDPENPDYG 143

Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
            + + F      L  W + DS+   + + +   +    L  ++F 
Sbjct: 144 SLELMFTGDPVELRKWVVHDSAGGQTTVILGALERGMSLSNRLFS 188


>gi|261380991|ref|ZP_05985564.1| outer membrane lipoprotein carrier protein LolA [Neisseria subflava
           NJ9703]
 gi|284796021|gb|EFC51368.1| outer membrane lipoprotein carrier protein LolA [Neisseria subflava
           NJ9703]
          Length = 206

 Score = 93.4 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/199 (14%), Positives = 61/199 (30%), Gaps = 9/199 (4%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGE 65
           +    LF  +A    ++A    +  +V    +       + G F Q            G 
Sbjct: 1   MKTTRLFTLTAAALLSSAIGFAQADAVDALKKFNNDADGISGNFSQTVHSKKKTQTTHGT 60

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSVIFSNNQ 121
           F + RP  F ++Y+ P   +++ DG  I +Y+  L   +             +++ +   
Sbjct: 61  FKILRPGLFKWEYTKPYKQTIVGDGKTIWLYDVDLAQVTKSSQDQTIGDSPAAILSNKTA 120

Query: 122 HVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
                +++   S N     +            +        L   ++ DS    + I   
Sbjct: 121 LDSSYTLKEDGSANGIDYVLATPKKNNAGYQYIRIGFKGDNLAAMQLKDSFGNQTSISFS 180

Query: 181 KYKENTVLDPKVFEIPYDK 199
                  L   +F+    K
Sbjct: 181 GLNTKPNLSSGMFKFTPPK 199


>gi|58220685|gb|AAW67950.1| putative outer membrane lipoprotein carrier protein [Desulfovibrio
           gigas]
          Length = 224

 Score = 93.4 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/211 (11%), Positives = 57/211 (27%), Gaps = 18/211 (8%)

Query: 6   YKSVIGVVILFFYSA----IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV 61
            + ++   +L    A        +AA     +  +    + + S+QT +  F Q      
Sbjct: 1   MQKLLIACVLVAGIALTMGFSMQSAASSPETNALLDAIQKQYESMQTFRAHFSQVLINSA 60

Query: 62  M------KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----Y 110
                   G   M +P    ++   P    L++    +  Y     T   Y         
Sbjct: 61  SREAERRTGRVSMKKPGLIRWETLEPEKELLVAAKDVVWDYFEAEKTAYKYKASEILDSK 120

Query: 111 MAFSVIFSNNQHVIQESIQRVESNNSFI---TIFFKDDFMGNMISVTFDRLSYRLLNWKI 167
                +    +      +      +S         + +      S+  D  +  +    +
Sbjct: 121 TMLHFLAGTTRLDKDFEVVNAGREDSLTRLDLTPREPEPGLVQASIWADPATGLIQRISM 180

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           +D     +++       N  LD  +F     
Sbjct: 181 IDFYGNENVVAFTDMSLNPPLDEGLFTFTPP 211


>gi|56479431|ref|YP_161020.1| outer membrane lipoprotein carrier protein LolA [Aromatoleum
           aromaticum EbN1]
 gi|56315474|emb|CAI10119.1| Outer membrane lipoprotein carrier protein LolA [Aromatoleum
           aromaticum EbN1]
          Length = 216

 Score = 93.4 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 60/171 (35%), Gaps = 11/171 (6%)

Query: 36  VKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSPSSVSLISD 89
           V++  E   + ++ QG F Q  +           G F   RP KF + Y  P    L+SD
Sbjct: 35  VEQLREFVDTARSAQGEFEQTVSSASGRRAQQASGSFVFLRPGKFRWSYDKPYPQLLVSD 94

Query: 90  GSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQESIQRVESNNSF-ITIFFKD 144
           G  +  ++  L+  +V  L         +++  +        +    S +     +    
Sbjct: 95  GEKLWSWDRDLNQVTVKRLGDALGSTPAAILAGSGTLDRDFDLAEAGSGDGLDWVLATPK 154

Query: 145 DFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
               +  S+        L   ++ D+  + ++I     + N   DP +F  
Sbjct: 155 HAESSFQSIRLGLAGELLKRMELQDNFGQTTMIVFTSLEPNARPDPSLFRF 205


>gi|15597810|ref|NP_251304.1| outer-membrane lipoprotein carrier protein [Pseudomonas aeruginosa
           PAO1]
 gi|107102136|ref|ZP_01366054.1| hypothetical protein PaerPA_01003186 [Pseudomonas aeruginosa PACS2]
 gi|116050601|ref|YP_790580.1| outer-membrane lipoprotein carrier protein [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218891225|ref|YP_002440091.1| outer-membrane lipoprotein carrier protein [Pseudomonas aeruginosa
           LESB58]
 gi|254235600|ref|ZP_04928923.1| periplasmic chaperone LolA [Pseudomonas aeruginosa C3719]
 gi|254241047|ref|ZP_04934369.1| periplasmic chaperone LolA [Pseudomonas aeruginosa 2192]
 gi|296388927|ref|ZP_06878402.1| outer-membrane lipoprotein carrier protein [Pseudomonas aeruginosa
           PAb1]
 gi|313107650|ref|ZP_07793833.1| periplasmic chaperone LolA [Pseudomonas aeruginosa 39016]
 gi|21759265|sp|Q9I0M4|LOLA_PSEAE RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|122259724|sp|Q02NA6|LOLA_PSEAB RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|226737655|sp|B7UW08|LOLA_PSEA8 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|9948680|gb|AAG06002.1|AE004690_2 periplasmic chaperone LolA [Pseudomonas aeruginosa PAO1]
 gi|115585822|gb|ABJ11837.1| periplasmic chaperone protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126167531|gb|EAZ53042.1| periplasmic chaperone LolA [Pseudomonas aeruginosa C3719]
 gi|126194425|gb|EAZ58488.1| periplasmic chaperone LolA [Pseudomonas aeruginosa 2192]
 gi|218771450|emb|CAW27217.1| periplasmic chaperone LolA [Pseudomonas aeruginosa LESB58]
 gi|310880335|gb|EFQ38929.1| periplasmic chaperone LolA [Pseudomonas aeruginosa 39016]
          Length = 208

 Score = 93.4 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/200 (15%), Positives = 68/200 (34%), Gaps = 11/200 (5%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMK 63
           + ++   F +A+    +        +V++        QT+   F Q              
Sbjct: 1   MRLIRTLFVAALAMGASLAHADDSAAVQRLTGLLNKAQTLTARFSQLTLDGSGTRLQETA 60

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFS 118
           G+  + RP  F +   +P+   LIS+G  + +Y+  L+  ++  L           +   
Sbjct: 61  GQLSLKRPGLFRWHTDAPNEQLLISNGEKVWLYDPDLEQVTIQKLDQRLTQTPALLLSGD 120

Query: 119 NNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
            ++     +I   E  N    +           ++     S ++ + +++D   + + I 
Sbjct: 121 ISKISESFAITYKEGGNVVDFVLKPKTKDTLFDTLRLSFRSGKVNDMQMIDGVGQRTNIL 180

Query: 179 ILKYKENTVLDPKVFEIPYD 198
               K N  LD K F     
Sbjct: 181 FFDVKMNEALDAKQFTFDVP 200


>gi|295691546|ref|YP_003595239.1| outer membrane lipoprotein carrier protein LolA [Caulobacter segnis
           ATCC 21756]
 gi|295433449|gb|ADG12621.1| outer membrane lipoprotein carrier protein LolA [Caulobacter segnis
           ATCC 21756]
          Length = 218

 Score = 93.4 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/183 (21%), Positives = 82/183 (44%), Gaps = 4/183 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSP 81
           P  AA    +   V KA  +  S+ + +G F+Q D  G   +G F++ RP K  F Y +P
Sbjct: 32  PVPAALTAEQKALVNKATAYVQSLGSAKGRFVQTDARGTRTQGTFYLQRPGKARFAYDAP 91

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVES---NNSFI 138
           + + ++S+G+N+ +++++L T+  YPL     +++ +    + +  +        +   I
Sbjct: 92  AGLLVVSNGNNVNIWDSRLKTYESYPLSKTPLNLLLAREVRLDRGVVITDVRRLADGFSI 151

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                       I++ F      L+ W + D       +++  +   + LDPK+F +   
Sbjct: 152 VAQDAKRQALGKIALDFSDGPVALMGWTVTDIKGGQIRVRLTDFGPASGLDPKLFVLTDP 211

Query: 199 KIH 201
           +  
Sbjct: 212 RPK 214


>gi|197106968|ref|YP_002132345.1| outer membrane lipoprotein carrier protein LolA [Phenylobacterium
           zucineum HLK1]
 gi|196480388|gb|ACG79916.1| outer membrane lipoprotein carrier protein LolA [Phenylobacterium
           zucineum HLK1]
          Length = 215

 Score = 93.4 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 43/185 (23%), Positives = 79/185 (42%), Gaps = 4/185 (2%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSP 81
              A         V++A  +  S++  +  F+Q D+ G  + G+ F+ RP K  F Y  P
Sbjct: 26  FAQAGLSAQDRALVERAAAYLESLKEAKARFVQTDSRGRSIGGDVFLKRPGKARFDYDPP 85

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVES---NNSFI 138
           S + ++SDG  ++V + +L T+  YPL     SV  + N  + +       S   +   I
Sbjct: 86  SGLLVVSDGGVVSVQDTRLKTFDRYPLSATPLSVFLAKNIRLDKGVTVTRVSRMADGFSI 145

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           T    +      I +TF      L  W I D+  R + +++   +  + L   +F +   
Sbjct: 146 TARDGNKRTAGQIMLTFRDEPMTLTGWTITDAQGRQTRVQLQGLQRASGLAGSLFVLKDP 205

Query: 199 KIHNI 203
           +  N+
Sbjct: 206 RPKNV 210


>gi|120554469|ref|YP_958820.1| outer-membrane lipoprotein carrier protein [Marinobacter aquaeolei
           VT8]
 gi|120324318|gb|ABM18633.1| outer membrane lipoprotein carrier protein LolA [Marinobacter
           aquaeolei VT8]
          Length = 216

 Score = 93.0 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 33/207 (15%), Positives = 73/207 (35%), Gaps = 12/207 (5%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK- 63
           + +   G++++   +      A        + ++        +T Q  F+Q         
Sbjct: 1   MIRMFSGILLMLAATWSGLSQAESVQASRGAAEQLTSILKGYETYQADFIQIVVNENGSQ 60

Query: 64  -----GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFS 114
                G     RP  FY++  +P S  ++SDG  + VY+  L+  +V+     ++     
Sbjct: 61  VQETRGSLKAKRPGLFYWETGAPLSQFIVSDGDKVEVYDPDLEQVTVHSLDERVQTTPAL 120

Query: 115 VIFSNNQHVIQESIQRVES--NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSR 172
           ++    +++ +     V     ++               S+        L   ++ DS  
Sbjct: 121 LLSGEVENLDESYEVSVRDLGESTREFTLVPRSQDSLFTSLRLSFYDGELQEMRMRDSLS 180

Query: 173 RYSIIKILKYKENTVLDPKVFEIPYDK 199
           + SI+     + N  LD  VF + Y +
Sbjct: 181 QMSILSFDHIELNQALDSSVFRLDYPE 207


>gi|220935171|ref|YP_002514070.1| outer membrane lipoprotein carrier protein LolA [Thioalkalivibrio
           sp. HL-EbGR7]
 gi|219996481|gb|ACL73083.1| outer membrane lipoprotein carrier protein LolA [Thioalkalivibrio
           sp. HL-EbGR7]
          Length = 205

 Score = 93.0 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/181 (13%), Positives = 49/181 (27%), Gaps = 11/181 (6%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV------MKGEFFMARPSKFYFKYSSPS 82
           P     + +     F  +      F Q             +G   + RP +F + Y  P 
Sbjct: 17  PAFAADARQSLERFFSEVSRFDARFEQLVINEQDEVLQASEGRVQLQRPGRFRWDYEQPF 76

Query: 83  SVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS-----VIFSNNQHVIQESIQRVESNNSF 137
              +I+DG  +  Y+ +L   +  P+  +        +          E     E     
Sbjct: 77  RQLIIADGQFLWTYDEELAQATAQPMERVLAGAPIMLLSEPRPLEQDFEVSVVGERGELN 136

Query: 138 ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
                  D   +   +       R+    + D   + + I+    + N  +    F    
Sbjct: 137 WVELTPRDRDADFTRILIGMDGDRVGMMVLYDQFGQQTRIRFSNMRINPSIPAATFRFEA 196

Query: 198 D 198
            
Sbjct: 197 P 197


>gi|330810443|ref|YP_004354905.1| hypothetical protein PSEBR_a3562 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327378551|gb|AEA69901.1| Conserved hypothetical protein; putative exported protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 207

 Score = 93.0 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/198 (13%), Positives = 65/198 (32%), Gaps = 11/198 (5%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEF 66
           +I      +   +       ++ V +  +     QT+   F Q              G+ 
Sbjct: 3   LIRMLLLPVLALSTLSAHAGEKDVARLTQLLGGSQTLTARFSQLTLDGSGTQLQETAGDM 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQH 122
            + RP  FY+   +P+   ++SDG  +++++  L+  +       L      ++  +   
Sbjct: 63  ALQRPGLFYWHTDAPAEQLMVSDGKKVSLWDPDLEQVTIKTLDQRLTQTPALLLSGDISE 122

Query: 123 VIQESIQRVESNNSFI-TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           + Q      +     I              S+     +  + + +++DS  + + I    
Sbjct: 123 ISQSFEITSKEAGGVIDFTLKPKTKDSLFDSLRLSFRNGLVNDMQLIDSVGQRTNILFTG 182

Query: 182 YKENTVLDPKVFEIPYDK 199
            K N  +    F+    K
Sbjct: 183 VKANEPIAASKFKFDIPK 200


>gi|192358939|ref|YP_001983015.1| outer membrane lipoprotein carrier protein LolA [Cellvibrio
           japonicus Ueda107]
 gi|190685104|gb|ACE82782.1| outer membrane lipoprotein carrier protein LolA [Cellvibrio
           japonicus Ueda107]
          Length = 207

 Score = 93.0 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 68/190 (35%), Gaps = 11/190 (5%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMAR 70
             + +    +   +  DQ+  +  +H  ++ ++QG F Q              G+F + R
Sbjct: 7   CVALLLACCSLIAMADDQAATQLRKHLDAMNSLQGQFTQTVRDAQGEIQEQSHGDFMLMR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFSNNQHVIQ 125
           P KFY+  + P    L+S+  NI +Y+  L+T +V              +     +    
Sbjct: 67  PGKFYWNTAEPMPQLLVSNNKNIWLYDPDLETVNVREFSNDLRETPALLLSEDVEKLRKN 126

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
            +I R     +           G    +     + +L  + I DS  + +  ++   K N
Sbjct: 127 FTITRKAEGTTEQFTLTPKVTEGLFQQLVLVFGAGQLSEFVIQDSLGQMTRCELSNVKRN 186

Query: 186 TVLDPKVFEI 195
             L  + F  
Sbjct: 187 QTLPEEKFYF 196


>gi|152989440|ref|YP_001347958.1| outer-membrane lipoprotein carrier protein [Pseudomonas aeruginosa
           PA7]
 gi|166230494|sp|A6V4H3|LOLA_PSEA7 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|150964598|gb|ABR86623.1| outer membrane lipoprotein carrier protein LolA [Pseudomonas
           aeruginosa PA7]
          Length = 208

 Score = 93.0 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/200 (15%), Positives = 68/200 (34%), Gaps = 11/200 (5%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMK 63
           + ++   F +A+    +        +V++        QT+   F Q              
Sbjct: 1   MRLIRTLFVAALAMGTSLAHADDSAAVQRLTGLLNKAQTLTARFSQLTLDGSGTRLQETA 60

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFS 118
           G+  + RP  F +   +P+   LIS+G  + +Y+  L+  ++  L           +   
Sbjct: 61  GQLSLKRPGLFRWHTDAPNEQLLISNGEKVWLYDPDLEQVTIQKLDQRLTQTPALLLSGD 120

Query: 119 NNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
            ++     +I   E  N    +           ++     S ++ + +++D   + + I 
Sbjct: 121 ISKISESFAITYKEGGNVVDFVLKPKTKDTLFDTLRLSFRSGKVNDMQMIDGVGQRTNIL 180

Query: 179 ILKYKENTVLDPKVFEIPYD 198
               K N  LD K F     
Sbjct: 181 FFDVKMNEALDAKQFTFDVP 200


>gi|104781338|ref|YP_607836.1| outer-membrane lipoprotein carrier protein [Pseudomonas entomophila
           L48]
 gi|122403638|sp|Q1IBD3|LOLA_PSEE4 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|95110325|emb|CAK15032.1| Outer-membrane lipoprotein carrier protein precursor [Pseudomonas
           entomophila L48]
          Length = 207

 Score = 93.0 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/197 (14%), Positives = 61/197 (30%), Gaps = 11/197 (5%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFF 67
           I     +     A      ++ V +  +     QT+   F Q              GE  
Sbjct: 4   IRMLLVSALAMGAVSAHADEKDVARLTQLLEKSQTITARFSQLTLDASGTSLQEANGEMA 63

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVIFSNNQH 122
           + RP  FY+   +P    ++SDG  + +++  L+  ++        +  A  +    ++ 
Sbjct: 64  VKRPGLFYWHTDAPQEQVVVSDGQKVTLWDPDLEQATIKKLDVRLSQTPALLLSGDVSKI 123

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
                I   E                   S+        + + +++DS  + + I     
Sbjct: 124 SQSFDISSKEQGEVTDFTLKPKTKDTLFDSLRVSFRKGLINDMQLVDSVGQRTNILFNGV 183

Query: 183 KENTVLDPKVFEIPYDK 199
           K N  +    F+    K
Sbjct: 184 KANEAIPASKFKFDVPK 200


>gi|325273412|ref|ZP_08139667.1| lipoprotein chaperone [Pseudomonas sp. TJI-51]
 gi|324101457|gb|EGB99048.1| lipoprotein chaperone [Pseudomonas sp. TJI-51]
          Length = 207

 Score = 93.0 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/197 (15%), Positives = 65/197 (32%), Gaps = 11/197 (5%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFF 67
           I     +     +      +Q V++  +     QT++  F Q   G          G+  
Sbjct: 4   IRMLLVSALTLGSVTAYAGEQDVQRLTQLLEKSQTIEANFSQLTLGADGTSLQETSGKMT 63

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVIFSNNQH 122
           + RP  FY+   +P    ++SDG N+ +++  L+  ++        +  A  +    ++ 
Sbjct: 64  VKRPGLFYWHTDAPQEQVVVSDGKNVTLWDPDLEQATIKKLDVRLNQTPALLLSGDVSKI 123

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
                I   E                   S+        + + +++DS  + + I     
Sbjct: 124 SQSFDITSKEQGEVMDFTLKPKTKDTLFDSLRVSFRKGLINDMQLIDSVGQRTNILFNGV 183

Query: 183 KENTVLDPKVFEIPYDK 199
           K N  +    F+    K
Sbjct: 184 KANQAVPDSRFKFDIPK 200


>gi|225077422|ref|ZP_03720621.1| hypothetical protein NEIFLAOT_02483 [Neisseria flavescens
           NRL30031/H210]
 gi|224951240|gb|EEG32449.1| hypothetical protein NEIFLAOT_02483 [Neisseria flavescens
           NRL30031/H210]
          Length = 206

 Score = 93.0 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/199 (14%), Positives = 61/199 (30%), Gaps = 9/199 (4%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGE 65
           +    LF  +A    ++A    +  +V    +       + G F Q            G 
Sbjct: 1   MKTTRLFTLTAAALLSSAIGFAQAGAVDALKKFNNDADGISGNFSQTVHSKKKTQTTHGT 60

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSVIFSNNQ 121
           F + RP  F ++Y+ P   +++ DG  I +Y+  L   +             +++ +   
Sbjct: 61  FKILRPGLFKWEYTKPYKQTIVGDGKTIWLYDVDLAQVTKSSQDQTIGDSPAAILSNKTA 120

Query: 122 HVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
                +++   S N     +            +        L   ++ DS    + I   
Sbjct: 121 LDSSYTLKEDGSANGIDYVLATPKKNNAGYQYIRIGFKGDNLAAMQLKDSFGNQTSISFS 180

Query: 181 KYKENTVLDPKVFEIPYDK 199
                  L   +F+    K
Sbjct: 181 GLNTKPNLSSGMFKFTPPK 199


>gi|30249051|ref|NP_841121.1| Outer membrane lipoprotein carrier protein LolA [Nitrosomonas
           europaea ATCC 19718]
 gi|47117197|sp|Q82VM2|LOLA_NITEU RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|30138668|emb|CAD84963.1| Outer membrane lipoprotein carrier protein LolA [Nitrosomonas
           europaea ATCC 19718]
          Length = 206

 Score = 93.0 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/196 (15%), Positives = 60/196 (30%), Gaps = 12/196 (6%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------VMKGEFFMA 69
             +  +          K  +VK          T Q  F Q              G     
Sbjct: 4   LLFVLVLSVCLLPVPVKASAVKSLKTFVNKALTFQANFSQTLLDKNFQVIRKASGSMMFE 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQ 125
           RP KF + Y  P    ++ DG  +  Y+  L   +V+ L         +++   N     
Sbjct: 64  RPGKFRWTYDQPYQQLIVGDGKQVWFYDQDLAQVTVHRLDQALGSTPAALLAGGNTIERD 123

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTF--DRLSYRLLNWKIMDSSRRYSIIKILKYK 183
            ++Q ++       +        N   +       +  L    + DS  + + +   + +
Sbjct: 124 FNLQEIDVQGETEWLEAIPKNQENSFELIRLGFSKTGILREMVLRDSFDQVTWLIFSEIE 183

Query: 184 ENTVLDPKVFEIPYDK 199
           +N  L P +F+    +
Sbjct: 184 QNPTLTPDLFQFTPPE 199


>gi|254509851|ref|ZP_05121918.1| outer membrane lipoprotein carrier protein LolA [Rhodobacteraceae
           bacterium KLH11]
 gi|221533562|gb|EEE36550.1| outer membrane lipoprotein carrier protein LolA [Rhodobacteraceae
           bacterium KLH11]
          Length = 198

 Score = 92.6 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/168 (19%), Positives = 68/168 (40%), Gaps = 5/168 (2%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
               + +   +   ++T+Q TF Q  D G +  G+ ++ RP K  F+Y  P+   +++  
Sbjct: 21  DKLPLSQISNYLNQMKTVQTTFTQVNDDGSLSTGKLWLQRPGKMRFEYDPPNDAVVLARA 80

Query: 91  SNIAVYNAK-LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNS---FITIFFKDDF 146
             + +++ K       YPL+    S++ + N ++ Q ++      +     +T     + 
Sbjct: 81  GTVQIFDPKSNQPPEQYPLKRTPLSLVLARNVNLGQANMVVGHDFDGTATVVTAQDPKNP 140

Query: 147 MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
               I + F      L  W I D++   + + +    E    D  VF 
Sbjct: 141 ENGRIELMFTADPVELRKWVIHDNAGSQTTVLLGPLAEGGRFDSSVFS 188


>gi|148547065|ref|YP_001267167.1| outer-membrane lipoprotein carrier protein [Pseudomonas putida F1]
 gi|47117215|sp|Q88FS9|LOLA_PSEPK RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|166230496|sp|A5W1H3|LOLA_PSEP1 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|148511123|gb|ABQ77983.1| outer membrane lipoprotein carrier protein LolA [Pseudomonas putida
           F1]
          Length = 207

 Score = 92.6 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/197 (15%), Positives = 65/197 (32%), Gaps = 11/197 (5%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFF 67
           I     +     +      +Q V++  +     QT++  F Q   G          G+  
Sbjct: 4   IRMLLVSALTLGSVTAYAGEQDVQRLTQLLEKSQTIEANFSQLTLGADGTSLQETSGKMT 63

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVIFSNNQH 122
           + RP  FY+   +P    ++SDG N+ +++  L+  ++        +  A  +    ++ 
Sbjct: 64  VKRPGLFYWHTDAPQEQVVVSDGKNVTLWDPDLEQATIKKLDVRLNQTPALLLSGDVSKI 123

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
                I   E                   S+        + + +++DS  + + I     
Sbjct: 124 SQSFDIASKEQGEVMDFTLKPKTKDTLFDSLRVSFRKGLINDMQLIDSVGQRTNILFNGV 183

Query: 183 KENTVLDPKVFEIPYDK 199
           K N  +    F+    K
Sbjct: 184 KANQAVPDSKFKFDIPK 200


>gi|54297678|ref|YP_124047.1| hypothetical protein lpp1729 [Legionella pneumophila str. Paris]
 gi|81601795|sp|Q5X4E7|LOLA_LEGPA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|53751463|emb|CAH12881.1| hypothetical protein lpp1729 [Legionella pneumophila str. Paris]
          Length = 202

 Score = 92.6 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 61/183 (33%), Gaps = 10/183 (5%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY-----VMKGEFFMARPSKFYFKYSSP 81
           ++ +    S +       +IQTM   F Q             G   + RP +F ++   P
Sbjct: 13  SHEVFSQTSAEVLQSKLNAIQTMTANFSQIVKAKNHEVSRSSGSMALQRPGRFRWQTKDP 72

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFSNNQHVIQESIQRVESNNS 136
               +++DG  + +Y+  L+  +V              +   +        +   +    
Sbjct: 73  LEQLIVADGQKMWIYDVDLEQVTVKNQEKGLGGTAALFLSGYDETLTHDFDVSEKQKGKL 132

Query: 137 FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
            +          N   +        L+  ++ D   + + +K+++ K N  L  K+F+  
Sbjct: 133 TVFDLKSKSAKENFQRIKLIFSQSALIGLELYDQLGQITDVKLVQIKSNPKLPAKLFQFK 192

Query: 197 YDK 199
             K
Sbjct: 193 PPK 195


>gi|261364217|ref|ZP_05977100.1| outer membrane lipoprotein carrier protein LolA [Neisseria mucosa
           ATCC 25996]
 gi|288567830|gb|EFC89390.1| outer membrane lipoprotein carrier protein LolA [Neisseria mucosa
           ATCC 25996]
          Length = 207

 Score = 92.6 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/204 (15%), Positives = 55/204 (26%), Gaps = 13/204 (6%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY---- 60
           + K       LF   A     A     +  +V    +       + G+F Q   G     
Sbjct: 1   MMKQHN----LFKLLAASALTATIGFAQAGAVDALKKFNNDADGISGSFTQTVQGKKKTQ 56

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSV 115
              G F + RP  F ++Y+ P   +++ DG  I +Y+  L   +               +
Sbjct: 57  TAHGTFKILRPGLFKWEYTKPYKQTIVGDGQTIWLYDVDLAQVTKSAQDQTIGDSPAAIL 116

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
                        +   SN     +            +        L   ++ DS    +
Sbjct: 117 SNKTALDSSYSLKEDGSSNGIDYVLATPKKNNAGYQYIRIGFKGDNLAAMQLKDSFGNQT 176

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
            I          L    F+    K
Sbjct: 177 SITFGSLNTKPNLSRGAFKFTPPK 200


>gi|298369429|ref|ZP_06980747.1| outer membrane lipoprotein carrier protein LolA [Neisseria sp. oral
           taxon 014 str. F0314]
 gi|298283432|gb|EFI24919.1| outer membrane lipoprotein carrier protein LolA [Neisseria sp. oral
           taxon 014 str. F0314]
          Length = 206

 Score = 92.6 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 26/194 (13%), Positives = 52/194 (26%), Gaps = 9/194 (4%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMAR 70
           L  + A    +    + +  +V    +       + G+F Q            G F + R
Sbjct: 6   LLKFLAAAGLSITVGLAQAGAVDALKKFNNDSDGISGSFSQTVKSKKKTQTTNGTFQILR 65

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFSNNQHVIQ 125
           P  F ++Y+ P   +++ DG  I +Y+  L   +               +          
Sbjct: 66  PGLFKWEYTKPYKQTIVGDGKTIWLYDVDLAQVTKSAQDQTIGDSPAAILSNKTALDSSY 125

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
              +   SN     +            +        L   ++ D     + I        
Sbjct: 126 ALKEDGASNGISYVLATPKKNNAGYQYIRIGFKGDNLAAMQLKDGFGNETTISFSNLNTK 185

Query: 186 TVLDPKVFEIPYDK 199
             L    F+    K
Sbjct: 186 PNLSRNAFKFTPPK 199


>gi|302877498|ref|YP_003846062.1| outer membrane lipoprotein carrier protein LolA [Gallionella
           capsiferriformans ES-2]
 gi|302580287|gb|ADL54298.1| outer membrane lipoprotein carrier protein LolA [Gallionella
           capsiferriformans ES-2]
          Length = 204

 Score = 92.6 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 68/205 (33%), Gaps = 22/205 (10%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----- 60
            K ++ +++           A     +  +++K      +  + Q  F Q          
Sbjct: 1   MKYILAILL----------AALSFSAQAGAIEKLKTFIAATHSAQANFTQVVQDQNGKRM 50

Query: 61  -VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSV 115
               G     RP +F + Y  P    ++ DG+   +Y+  L+  SV  L         ++
Sbjct: 51  QSASGVMQFQRPGRFRWTYQKPYEQIIVGDGAKFWLYDKDLNQVSVKKLDAALGSSPAAL 110

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMIS--VTFDRLSYRLLNWKIMDSSRR 173
           +  +N+      ++   S   F  +        +  S  +        L+  ++ D+   
Sbjct: 111 LAGSNEIERGFVLKEAGSREGFEWLQATPKAQDSSFSAVLMGFDADASLVAMELNDTFGH 170

Query: 174 YSIIKILKYKENTVLDPKVFEIPYD 198
            ++++    + N  +  + F+    
Sbjct: 171 KTVLRFSGMQRNPRVSAQQFQFTPP 195


>gi|241759859|ref|ZP_04757959.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           flavescens SK114]
 gi|241319867|gb|EER56263.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           flavescens SK114]
          Length = 206

 Score = 92.6 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/199 (14%), Positives = 61/199 (30%), Gaps = 9/199 (4%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGE 65
           +    LF  +A    ++A    +  +V    +       + G F Q            G 
Sbjct: 1   MKTTRLFTLTAATLLSSAIGFAQAGAVDALKKFNNDADGISGNFSQTVHSKKKTQTTHGT 60

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSVIFSNNQ 121
           F + RP  F ++Y+ P   +++ DG  I +Y+  L   +             +++ +   
Sbjct: 61  FKILRPGLFKWEYTKPYKQTIVGDGKTIWLYDVDLAQVTKSSQDQTIGDSPAAILSNKTA 120

Query: 122 HVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
                +++   S N     +            +        L   ++ DS    + I   
Sbjct: 121 LDSSYTLKEDGSANGIDYVLATPKKNNAGYQYIRIGFKGDNLAAMQLKDSFGNQTSISFS 180

Query: 181 KYKENTVLDPKVFEIPYDK 199
                  L   +F+    K
Sbjct: 181 GLNTKPNLSSGMFKFTPPK 199


>gi|330958180|gb|EGH58440.1| lipoprotein chaperone [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 207

 Score = 92.6 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/198 (13%), Positives = 63/198 (31%), Gaps = 11/198 (5%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEF 66
           +I    +    F+        + V +  +     QT+   F Q              GE 
Sbjct: 3   LIRMLLATALTFSVISAHADSKDVARLTQLLEKSQTLTARFSQLTLDGGGTQLQETAGEM 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQH 122
            + RP  F +   +P    ++SDG  +++++  L+  +       L      ++  +   
Sbjct: 63  ALQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTPALLLSGDVSK 122

Query: 123 VIQESIQRVESNNSFI-TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           + +      +     I  +           S+     +  + + +++DS  + + I    
Sbjct: 123 ISESFDITAKEAGGVIDFVLKPKTKDTLFDSLRLSFRNGVINDMQLIDSVGQRTNILFTG 182

Query: 182 YKENTVLDPKVFEIPYDK 199
            K N  +    F     K
Sbjct: 183 VKANEPIPASKFRFDVPK 200


>gi|87201201|ref|YP_498458.1| outer membrane lipoprotein carrier protein LolA [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87136882|gb|ABD27624.1| outer membrane lipoprotein carrier protein LolA [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 228

 Score = 92.3 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/177 (16%), Positives = 75/177 (42%), Gaps = 8/177 (4%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISD 89
           +    V +A+    S+ T++  F+Q D +G  + G   + RP K  F+Y     + ++ D
Sbjct: 46  SPSSDVDRAVTALRSVSTLRANFVQTDRSGQSVSGVLTLKRPGKIRFQYQKGVPLLIVGD 105

Query: 90  GSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIF--FKDDFM 147
           G  + + + ++     +P+R      +   ++ V + + Q   ++   +++         
Sbjct: 106 GKALTMIDYEVRQVQRWPIRNSPLGALLDPSKDVARFAKQLPTNDRDVVSLQVRDPKHPE 165

Query: 148 GNMISVTFDRL-----SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
              I++ F R        +L +W  +DS  + + +++  ++    +D K F     +
Sbjct: 166 YGTITMIFVRNGAAPGGLQLDSWVALDSQNKRTTVRLSGHQYGVAVDDKTFRWTDPR 222


>gi|82701312|ref|YP_410878.1| outer membrane lipoprotein carrier protein LolA [Nitrosospira
           multiformis ATCC 25196]
 gi|123768325|sp|Q2YCN5|LOLA_NITMU RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|82409377|gb|ABB73486.1| outer membrane lipoprotein carrier protein LolA [Nitrosospira
           multiformis ATCC 25196]
          Length = 207

 Score = 92.3 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/193 (15%), Positives = 62/193 (32%), Gaps = 12/193 (6%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------VMKGEFFMARP 71
           +     F      T    +        + +T++  F Q              G     RP
Sbjct: 7   FCVFLFFLLFTSTTHATGIGSLKSFMENARTVRADFAQTVLDKSRHIVQTASGAMQFERP 66

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQES 127
            KF + Y  P    ++ DG  I  Y+  L   +V  L         +++  NN       
Sbjct: 67  GKFRWIYEKPYEQLIVGDGERIWFYDHDLAQVTVRKLDAAIGSSPAALLAGNNDIEKNFH 126

Query: 128 IQRV--ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +  +  + N  ++    K         +    L   L   ++ D+  + ++ +    ++N
Sbjct: 127 LLEIGLQGNIEWVEATPKTRESTFERVLLGFTLEGILRVMELHDNFGQVTVFEFSGVEQN 186

Query: 186 TVLDPKVFEIPYD 198
             L P++F+    
Sbjct: 187 RKLPPELFKFSPP 199


>gi|148359309|ref|YP_001250516.1| outer membrane lipoprotein carrier protein [Legionella pneumophila
           str. Corby]
 gi|296107356|ref|YP_003619056.1| Outer membrane lipoprotein-sorting protein [Legionella pneumophila
           2300/99 Alcoy]
 gi|172047872|sp|A5ICS0|LOLA_LEGPC RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|148281082|gb|ABQ55170.1| outer membrane lipoprotein carrier protein [Legionella pneumophila
           str. Corby]
 gi|295649257|gb|ADG25104.1| Outer membrane lipoprotein-sorting protein [Legionella pneumophila
           2300/99 Alcoy]
 gi|307610464|emb|CBX00035.1| hypothetical protein LPW_17911 [Legionella pneumophila 130b]
          Length = 202

 Score = 92.3 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 61/183 (33%), Gaps = 10/183 (5%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY-----VMKGEFFMARPSKFYFKYSSP 81
           ++ +    S +       +IQTM   F Q             G   + RP +F ++   P
Sbjct: 13  SHEVFSQTSAEVLQSKLNAIQTMTANFSQIVKAKNREVSRSSGSMALQRPGRFRWQTKDP 72

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFSNNQHVIQESIQRVESNNS 136
               +++DG  + +Y+  L+  +V              +   +        +   +    
Sbjct: 73  LEQLIVADGQKMWIYDVDLEQVTVKNQEKGLGGTAALFLSGYDETLTHDFDVSEKQKGKL 132

Query: 137 FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
            +          N   +        L+  ++ D   + + +K+++ K N  L  K+F+  
Sbjct: 133 TVFDLKSKSAKENFQRIKLIFSQSTLIGLELYDQLGQITDVKLVQIKSNPKLPAKLFQFK 192

Query: 197 YDK 199
             K
Sbjct: 193 PPK 195


>gi|313498108|gb|ADR59474.1| LolA [Pseudomonas putida BIRD-1]
          Length = 207

 Score = 91.9 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 30/197 (15%), Positives = 65/197 (32%), Gaps = 11/197 (5%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFF 67
           I     +     +      +Q V++  +     QT++  F Q   G          G+  
Sbjct: 4   IRMLLVSALTLGSVTAFAGEQDVQRLTQLLEKSQTIEANFSQLTLGADGTSLQETSGKMT 63

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVIFSNNQH 122
           + RP  FY+   +P    ++SDG N+ +++  L+  ++        +  A  +    ++ 
Sbjct: 64  VKRPGLFYWHTDAPQEQVVVSDGKNVTLWDPDLEQATIKKLDVRLNQTPALLLSGDVSKI 123

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
                I   E                   S+        + + +++DS  + + I     
Sbjct: 124 SQSFDIASKEQGEVMDFTLKPKTKDTLFDSLRVSFRKGLINDMQLIDSVGQRTNILFNGV 183

Query: 183 KENTVLDPKVFEIPYDK 199
           K N  +    F+    K
Sbjct: 184 KANQAVPDSKFKFDIPK 200


>gi|167034604|ref|YP_001669835.1| outer-membrane lipoprotein carrier protein [Pseudomonas putida
           GB-1]
 gi|189028555|sp|B0KLX1|LOLA_PSEPG RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|166861092|gb|ABY99499.1| outer membrane lipoprotein carrier protein LolA [Pseudomonas putida
           GB-1]
          Length = 207

 Score = 91.9 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 30/197 (15%), Positives = 63/197 (31%), Gaps = 11/197 (5%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFF 67
           I     +            +Q V++  +     QT++  F Q   G          G+  
Sbjct: 4   IRMLLVSALALGTVTAYAGEQDVQRLTQLLEKSQTIEANFSQLTLGADGTSLQETSGKMT 63

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVIFSNNQH 122
           + RP  FY+   +P    ++SDG N+ +++  L+  ++        +  A  +    ++ 
Sbjct: 64  VKRPGLFYWHTDAPQEQVVVSDGKNVTLWDPDLEQATIKKLDVRLNQTPALLLSGDVSKI 123

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
                I   E                   S+        + + +++DS  + + I     
Sbjct: 124 SQSFDIASKEQGEVMDFTLKPKTKDTLFDSLRVSFRKGLINDMQLIDSVGQRTNILFNGV 183

Query: 183 KENTVLDPKVFEIPYDK 199
           K N  +    F     K
Sbjct: 184 KANQAVPDSKFTFDIPK 200


>gi|319792074|ref|YP_004153714.1| outer membrane lipoprotein carrier protein lola [Variovorax
           paradoxus EPS]
 gi|315594537|gb|ADU35603.1| outer membrane lipoprotein carrier protein LolA [Variovorax
           paradoxus EPS]
          Length = 210

 Score = 91.9 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 60/196 (30%), Gaps = 18/196 (9%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----------YVMKGEFFMAR 70
           +              ++       ++++ +  F Q                  G F   R
Sbjct: 7   LLIGLLCSANAWAGGLESLETFVKTVKSGRAEFTQTVTAPSREGQPGRVKTSTGTFEFQR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM--------AFSVIFSNNQH 122
           P KF F Y  P + S+++DG  + +Y+A L+  +                 +        
Sbjct: 67  PGKFKFDYRKPFAQSIVADGKTLWLYDADLNQVTQRAQAQALGSTPAALIAAAPDLRALQ 126

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
                    E +          +  G + SV        L   +I+DS  + S++K  K 
Sbjct: 127 ADFALEAAPERDGLEWVKATPKNKDGQLQSVLVGFQGDALAALEILDSFGQRSVLKFSKV 186

Query: 183 KENTVLDPKVFEIPYD 198
           + N  L   VF+    
Sbjct: 187 EVNPSLPASVFDFKAP 202


>gi|221213646|ref|ZP_03586620.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           multivorans CGD1]
 gi|221166435|gb|EED98907.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           multivorans CGD1]
          Length = 229

 Score = 91.9 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 31/206 (15%), Positives = 56/206 (27%), Gaps = 21/206 (10%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV------------- 61
           L    A      A         ++       +++ +G F Q+                  
Sbjct: 17  LGAALAGASLMLAAAHAFAGGTEQLRAFVAQVRSAKGDFTQQIVKATAKGASAAQAAPKP 76

Query: 62  ---MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAF 113
                G F  +RP KF + Y  P    L +DG  + VY+  L+  +   L        A 
Sbjct: 77  TDNSSGTFVFSRPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLNGALGASPAA 136

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
            +  SN+           E                    +     +  L   ++ D    
Sbjct: 137 ILFGSNDLDKSYTLRDAGEKGGIEWLEMLPKAQDTQFQRIGIGFKNGTLAAMELHDVFGN 196

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            +++     + N  L    F+    K
Sbjct: 197 VTLLTFSNIQTNPPLKADTFKFVVPK 222


>gi|241765336|ref|ZP_04763312.1| outer membrane lipoprotein carrier protein LolA [Acidovorax
           delafieldii 2AN]
 gi|241364935|gb|EER59873.1| outer membrane lipoprotein carrier protein LolA [Acidovorax
           delafieldii 2AN]
          Length = 210

 Score = 91.9 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 33/212 (15%), Positives = 64/212 (30%), Gaps = 27/212 (12%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +I  +++           +  +     +K        + T +  F Q          
Sbjct: 1   MKKLIAAILI---------ATSAQLASADGLKSLESFMKGVHTGRAEFTQVVTSPPKDGQ 51

Query: 60  ----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA--- 112
                   G F   RP +F F Y  P   ++++DG  + +Y+A L+  +           
Sbjct: 52  AARTKTSSGTFEFQRPGRFKFVYKKPFEQTIVADGQTLWLYDADLNQVTQRSQAKALGST 111

Query: 113 -----FSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKI 167
                 S    +            + +     +       G + SV       +L    I
Sbjct: 112 PAALLASTPDLSALRADFTLEAAPDQDGLQWVLARPKAKEGQLQSVRVGFAGEQLAALDI 171

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           +DS  + S I+    + N  L P  F+    +
Sbjct: 172 LDSFGQRSAIRFTGMQTNATLPPATFQFQPPQ 203


>gi|239814293|ref|YP_002943203.1| outer membrane lipoprotein carrier protein LolA [Variovorax
           paradoxus S110]
 gi|239800870|gb|ACS17937.1| outer membrane lipoprotein carrier protein LolA [Variovorax
           paradoxus S110]
          Length = 210

 Score = 91.5 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 31/196 (15%), Positives = 59/196 (30%), Gaps = 18/196 (9%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA----------GYVMKGEFFMAR 70
           +              ++       ++++ +  F Q                  G F   R
Sbjct: 7   LLIGLLCSANAWAGGLESLEAFVKTVKSGRAEFTQTVTAPPREGQPGRTKTSTGTFEFQR 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM--------AFSVIFSNNQH 122
           P KF F Y  P + S+++DG  + +Y+A L+  +                 +        
Sbjct: 67  PGKFKFDYQKPFAQSIVADGKTLWLYDADLNQVTQRAQSQALGSTPAALIAAAPDLRALQ 126

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
                    E +          +  G + +V        L   +I+DS  + S++K  K 
Sbjct: 127 ADFTLEAAPERDGLQWVKATPKNKDGQLQNVQVGFQGDALAALEILDSFGQRSVLKFSKV 186

Query: 183 KENTVLDPKVFEIPYD 198
           + N  L    FE    
Sbjct: 187 EVNPALPASAFEFKAP 202


>gi|71083032|ref|YP_265751.1| Outer membrane lipoprotein carrier protein [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|91762543|ref|ZP_01264508.1| Outer membrane lipoprotein carrier protein [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|71062145|gb|AAZ21148.1| Outer membrane lipoprotein carrier protein [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|91718345|gb|EAS84995.1| Outer membrane lipoprotein carrier protein [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 184

 Score = 91.5 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 35/185 (18%), Positives = 68/185 (36%), Gaps = 1/185 (0%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKF 74
           +     I  F + Y         K I        +   F Q        G+  +  P K 
Sbjct: 1   MLKVIIILLFFSFYLPGNSSPKDKIISQMKLTNNLNFNFKQTINDKSEDGKCIIEYPKKI 60

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESN 134
           +  Y++ +   L+S+GS++ +      ++  YPL       +      + +         
Sbjct: 61  FCVYNNANKKILVSNGSSLVIETNNKGSYYRYPLNKTPLEFLLDKEYLISKIEKLEPRDI 120

Query: 135 NSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
           ++    F K     N I++ FD+    L+ W+  D  +  SI  I   K+N  +D  +F+
Sbjct: 121 DNKYLNF-KIFENNNEINIFFDKKDLNLIGWQTKDIYQNLSITFISSIKKNQEIDGNIFK 179

Query: 195 IPYDK 199
           +P + 
Sbjct: 180 LPENN 184


>gi|329120328|ref|ZP_08248996.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327462669|gb|EGF08992.1| outer membrane lipoprotein carrier protein LolA [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 201

 Score = 91.5 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 26/190 (13%), Positives = 56/190 (29%), Gaps = 9/190 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMARPSKF 74
           + I    AA+       +    +       + GTF Q            G F + RP  F
Sbjct: 5   ALILTLVAAFSAAYAGGIDALKKFNADTDGIAGTFSQTVKSKKKTQTSGGTFQILRPGLF 64

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQR 130
            ++Y+ P   +++ DG  I +Y+  L   +             +++   N      +++ 
Sbjct: 65  RWEYTKPYKQTIVGDGKIIWLYDIDLKQVTKSDQSKAIGDSPAAILSDKNALDTSYTLKE 124

Query: 131 VESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLD 189
             + +     +       G    +        L   ++ D     + I+      +    
Sbjct: 125 DGTTDGIDYVLASPKKNNGGYQYIRIGFKGDTLAAMELKDGFGNQTAIRFSNIDTHPNPP 184

Query: 190 PKVFEIPYDK 199
              F     K
Sbjct: 185 RSAFAFTPPK 194


>gi|114332439|ref|YP_748661.1| outer membrane lipoprotein carrier protein LolA [Nitrosomonas
           eutropha C91]
 gi|123026693|sp|Q0AD86|LOLA_NITEC RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|114309453|gb|ABI60696.1| outer membrane lipoprotein carrier protein LolA [Nitrosomonas
           eutropha C91]
          Length = 206

 Score = 91.5 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 29/196 (14%), Positives = 59/196 (30%), Gaps = 12/196 (6%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------VMKGEFFMA 69
             +             K  +V+          T +  F Q              G     
Sbjct: 4   LLFVFALSICLLPVSAKASAVESLKAFVNKALTFRADFSQTLLDKNFQVVKKASGSMMFE 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSVIFSNNQHVIQ 125
           RP KF + Y  P    ++ DG  +  Y+  L   +V+ L         +++   N     
Sbjct: 64  RPGKFRWVYDQPYQQLIVGDGKQVWFYDQDLAQVTVHRLDQTLGSTPAALLAGGNTIERD 123

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTF--DRLSYRLLNWKIMDSSRRYSIIKILKYK 183
            ++Q ++       +        N   +       +  L    + DS  + + +     +
Sbjct: 124 FNLQEIDVQGETEWLEAIPKNQENAFELIRLGFSQTGMLREMILRDSFDQVTWLIFSGTE 183

Query: 184 ENTVLDPKVFEIPYDK 199
           +N VL P +F+    +
Sbjct: 184 QNPVLTPDLFQFTPPE 199


>gi|255065089|ref|ZP_05316944.1| outer membrane lipoprotein carrier protein LolA [Neisseria sicca
           ATCC 29256]
 gi|255050510|gb|EET45974.1| outer membrane lipoprotein carrier protein LolA [Neisseria sicca
           ATCC 29256]
          Length = 207

 Score = 91.5 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 31/204 (15%), Positives = 56/204 (27%), Gaps = 13/204 (6%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY---- 60
           + K       LF +       A     +  +V    +       + G+F Q   G     
Sbjct: 1   MMKQHN----LFKFLTASALTATIGFAQAGAVDALKKFNNDADGISGSFTQTVQGKKKTQ 56

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSV 115
              G F + RP  F ++Y+ P   +++ DG  I +Y+  L   +               +
Sbjct: 57  TAHGTFKILRPGLFKWEYTKPYKQTIVGDGQTIWLYDVDLAQVTKSAQDQTIGDSPAAIL 116

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
              N         +   SN     +            +        L   ++ DS    +
Sbjct: 117 SNKNALDSSYSLKEDGSSNGIDYVLATPKKNNAGYQYIRIGFKGDNLAAMQLKDSFGNQT 176

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
            I          L    F+    K
Sbjct: 177 SISFGGLNTKPNLSRGAFKFTPPK 200


>gi|52841992|ref|YP_095791.1| outer membrane lipoprotein carrier protein [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|52629103|gb|AAU27844.1| outer membrane lipoprotein carrier protein [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
          Length = 204

 Score = 91.5 bits (225), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 61/183 (33%), Gaps = 10/183 (5%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY-----VMKGEFFMARPSKFYFKYSSP 81
           ++ +    S +       +IQTM   F Q             G   + RP +F ++   P
Sbjct: 15  SHEVFSQTSAEVLQSKLNAIQTMTANFSQIVKAKNREVSRSSGSMALQRPGRFRWQTKDP 74

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFSNNQHVIQESIQRVESNNS 136
               +++DG  + +Y+  L+  +V              +   +        +   +    
Sbjct: 75  LEQLIVADGQKMWIYDVDLEQVTVKNQEKGLGGTAALFLSGYDETLTHDFDVSEKQKGKL 134

Query: 137 FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
            +          N   +        L+  ++ D   + + +K+++ K N  L  K+F+  
Sbjct: 135 TVFDLKSKSAKENFQRIKLIFSQSTLIGLELYDQLGQITDVKLVQIKSNPKLPAKLFQFK 194

Query: 197 YDK 199
             K
Sbjct: 195 PPK 197


>gi|54294652|ref|YP_127067.1| hypothetical protein lpl1729 [Legionella pneumophila str. Lens]
 gi|81601313|sp|Q5WVT2|LOLA_LEGPL RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|53754484|emb|CAH15968.1| hypothetical protein lpl1729 [Legionella pneumophila str. Lens]
          Length = 202

 Score = 91.5 bits (225), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 61/183 (33%), Gaps = 10/183 (5%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY-----VMKGEFFMARPSKFYFKYSSP 81
           ++ +    S +       +IQTM   F Q             G   + RP +F ++   P
Sbjct: 13  SHEVFSQTSAEVLQSKLNAIQTMTANFSQIVKAKNREVSRSSGSMALQRPGRFRWQTKDP 72

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFSNNQHVIQESIQRVESNNS 136
               +++DG  + +Y+  L+  +V              +   +        +   +    
Sbjct: 73  LEQLIVADGQKMWIYDVDLEQVTVKNQEKGLGGTAALFLSGYDETLTHDFDVSEKQKGKL 132

Query: 137 FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
            +          N   +        L+  ++ D   + + +K+++ K N  L  K+F+  
Sbjct: 133 TVFDLKSKSAKENFQRIKLIFSQSTLIGLELYDQLGQITDVKLVQIKSNPKLPAKLFQFN 192

Query: 197 YDK 199
             K
Sbjct: 193 PPK 195


>gi|288941165|ref|YP_003443405.1| outer membrane lipoprotein carrier protein LolA [Allochromatium
           vinosum DSM 180]
 gi|288896537|gb|ADC62373.1| outer membrane lipoprotein carrier protein LolA [Allochromatium
           vinosum DSM 180]
          Length = 219

 Score = 91.5 bits (225), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 25/196 (12%), Positives = 70/196 (35%), Gaps = 11/196 (5%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------GEFFMAR 70
              A+F    +  +   +  ++  ++   + +++  F Q              G  ++ R
Sbjct: 18  LIPALFALCCSNSVFAAEGAQRVDDYLKGLNSLKADFEQFTFNAERTQMMERRGTLYLQR 77

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQE 126
           P +F ++Y  P    +I+D   + +++ +L   S              ++ + +      
Sbjct: 78  PGRFRWEYEGPDKQIIIADSQRVYMHDVELKQVSHQSQTKALRGTPALLLSNTDPIEQHF 137

Query: 127 SIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
            ++ +ES +          D   +++ +        L +  + DS  + + +     + N
Sbjct: 138 EVRPIESTDGRDWVELIPKDAETDVVRIELGFGRDTLDSLIMEDSFGQETRLNFTGAQRN 197

Query: 186 TVLDPKVFEIPYDKIH 201
             L P +F+I    + 
Sbjct: 198 VSLKPDLFKIDQRAVD 213


>gi|71897619|ref|ZP_00679864.1| Outer membrane lipoprotein carrier protein LolA [Xylella fastidiosa
           Ann-1]
 gi|182681261|ref|YP_001829421.1| outer-membrane lipoprotein carrier protein [Xylella fastidiosa M23]
 gi|28056664|gb|AAO28543.1| periplasmic chaperone [Xylella fastidiosa Temecula1]
 gi|71732522|gb|EAO34575.1| Outer membrane lipoprotein carrier protein LolA [Xylella fastidiosa
           Ann-1]
 gi|182631371|gb|ACB92147.1| outer membrane lipoprotein carrier protein LolA [Xylella fastidiosa
           M23]
 gi|307579711|gb|ADN63680.1| outer-membrane lipoprotein carrier protein [Xylella fastidiosa
           subsp. fastidiosa GB514]
          Length = 214

 Score = 91.1 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 26/217 (11%), Positives = 71/217 (32%), Gaps = 20/217 (9%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG- 59
           M +++   +       F++            +             ++T+QG F QE    
Sbjct: 1   MIWMML--MFSRFRYIFFAVALLSGPVCAGARAD----LSAFTRGLKTLQGHFSQEVIDT 54

Query: 60  -----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW----SVYPLRY 110
                    G   ++ P+   ++  +P    +++DG  + +++  L+           R 
Sbjct: 55  QGRVKERSNGTVALSLPNLLRWECDAPYKQLVVADGKRVWLFDPDLNQASVLLQDNEERN 114

Query: 111 MAFSVIFSNNQHVIQESIQRV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKI 167
                +    Q   +  +           ++++  +     +  S +F     +L   ++
Sbjct: 115 SPLIALIDPIQLDRKYDVSEEVAMRDGLRWLSLRPRGSTEASFQSASFGFSQTQLARMEL 174

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVFEI-PYDKIHNI 203
           +D+  + ++I    ++ N V     F   P   +  I
Sbjct: 175 VDNLGQRTVIAFSGWQRNPVFAVNTFRFTPGKNVDVI 211


>gi|254460832|ref|ZP_05074248.1| outer membrane lipoprotein carrier protein LolA [Rhodobacterales
           bacterium HTCC2083]
 gi|206677421|gb|EDZ41908.1| outer membrane lipoprotein carrier protein LolA [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 201

 Score = 91.1 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 30/170 (17%), Positives = 67/170 (39%), Gaps = 5/170 (2%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLIS 88
             +  S+     +   + T +G F Q  D G +  G  F+ RP +  F+Y+ P    +++
Sbjct: 21  AAEKISLNALSRYLNQLSTAKGAFTQVNDDGTISTGTIFIKRPGRIRFEYNPPEKALVLA 80

Query: 89  DGSNIAVYNAK-LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSF---ITIFFKD 144
            G  + +Y+ K  +    YPL     S+I + N ++ +  +    + +     +     +
Sbjct: 81  SGGTVVIYDPKTNEPPESYPLARTPLSIILAKNVNLSRAKMVVGHTADDKSTTVKAQDPE 140

Query: 145 DFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
                 I + F      L  W I D +   + + + +  +   ++  +F 
Sbjct: 141 HPEYGNIELVFTSNPIELRQWVINDDAGIRTTVILGELDKKARMNNTLFN 190


>gi|121608725|ref|YP_996532.1| outer membrane lipoprotein carrier protein LolA [Verminephrobacter
           eiseniae EF01-2]
 gi|121553365|gb|ABM57514.1| outer membrane lipoprotein carrier protein LolA [Verminephrobacter
           eiseniae EF01-2]
          Length = 216

 Score = 91.1 bits (224), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 61/211 (28%), Gaps = 21/211 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +     +   +       +        +K         QT +  F Q          
Sbjct: 1   MKKI---ATIIASAITIVMAGSAMGASADGLKSLEAFLQHTQTGRAEFSQSVTAPPKDGQ 57

Query: 60  ----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSV 115
                +  G F   RP +F F Y  P   ++++DG  + +Y+A L+  +         S 
Sbjct: 58  TARAKLSGGRFEFQRPGRFKFVYQKPFEQTIVADGQTLWLYDADLNQVTRRAQAQALGST 117

Query: 116 IF-------SNNQHVIQESIQRVESNNSFITIFFKDDFMGNM-ISVTFDRLSYRLLNWKI 167
                           + ++Q +        +            SV       +L    I
Sbjct: 118 PAALLASAPDLPALQAEFTLQALPDQEGLQWVQASPKNRDGQIKSVRVGFAGEQLAVLDI 177

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           +D+  + S+I+    + N  L    F+    
Sbjct: 178 LDNFGQRSVIRFTGLQTNVALPANTFQFNPP 208


>gi|161525592|ref|YP_001580604.1| outer-membrane lipoprotein carrier protein [Burkholderia
           multivorans ATCC 17616]
 gi|189349679|ref|YP_001945307.1| outer-membrane lipoprotein carrier protein [Burkholderia
           multivorans ATCC 17616]
 gi|160343021|gb|ABX16107.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           multivorans ATCC 17616]
 gi|189333701|dbj|BAG42771.1| outer membrane lipoprotein carrier protein [Burkholderia
           multivorans ATCC 17616]
          Length = 229

 Score = 91.1 bits (224), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 31/206 (15%), Positives = 56/206 (27%), Gaps = 21/206 (10%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG--------------- 59
           L    A      A         ++       +++ +G F Q+                  
Sbjct: 17  LGAALAGASLMLAATHAFAGGTEQLKAFVAQVRSAKGDFTQQIVKAPAKGASAAQAAPKP 76

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAF 113
                G F  +RP KF + Y  P    L +DG  + VY+  L+  +   L        A 
Sbjct: 77  TDNSSGTFVFSRPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLNGALGASPAA 136

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
            +  SN+           E                    +     +  L   ++ D    
Sbjct: 137 ILFGSNDLDKSYTLRDAGEKGGIEWLEMLPKAQDTQFQRIGIGFKNGTLAAMELHDVFGN 196

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            +++     + N  L    F+    K
Sbjct: 197 VTLLTFSNIQTNPPLKADTFKFVVPK 222


>gi|126667376|ref|ZP_01738348.1| outer-membrane lipoprotein carrier protein precursor [Marinobacter
           sp. ELB17]
 gi|126628132|gb|EAZ98757.1| outer-membrane lipoprotein carrier protein precursor [Marinobacter
           sp. ELB17]
          Length = 228

 Score = 90.7 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 31/202 (15%), Positives = 70/202 (34%), Gaps = 12/202 (5%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVM 62
           +  +++    +A    +      +  +  +        QT Q  F+Q   G         
Sbjct: 17  LFAMILTSAATAAVSDDLQKEGLQKDAATQLAALLRGYQTYQADFIQIVVGNGGERVQES 76

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSVIFS 118
            G     RP  FY++  +P +  ++S+G  ++VY+  L+  +V+ L          ++  
Sbjct: 77  HGSMKAKRPGFFYWESKAPMAQHIVSNGDEVSVYDPDLEQVTVHKLNSDVQATPALLLSG 136

Query: 119 NNQHVIQESIQRVE--SNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
              ++ Q          +N               +++       +L   ++ DS  + SI
Sbjct: 137 EVDNLAQTYDVSTRRVGDNIREFTLTPKSPDSLFVALRMSFFDGQLQEMRMEDSLSQISI 196

Query: 177 IKILKYKENTVLDPKVFEIPYD 198
           +       N  +   VF++ Y 
Sbjct: 197 LSFDDIVLNADIAASVFKLDYP 218


>gi|70731238|ref|YP_260979.1| outer-membrane lipoprotein carrier protein [Pseudomonas fluorescens
           Pf-5]
 gi|123654456|sp|Q4K9V4|LOLA_PSEF5 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|68345537|gb|AAY93143.1| outer membrane lipoprotein carrier protein LolA [Pseudomonas
           fluorescens Pf-5]
          Length = 207

 Score = 90.7 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/198 (14%), Positives = 62/198 (31%), Gaps = 11/198 (5%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEF 66
           +I      +            + V +  +     QT+   F Q              GE 
Sbjct: 3   LIRMLLLPVLAVTTLSAHADPKDVARLTQLLEKSQTLTARFSQLTLDGSGTQLQETAGEM 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFSNNQ 121
            + RP  FY+   +P    ++SDG  +++++  L+  ++  L           +    ++
Sbjct: 63  SLQRPGLFYWHTDAPQEQLMVSDGQKVSLWDPDLEQVTIKKLDQRLTQTPALLLSGDVSK 122

Query: 122 HVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
                 I   E+                  S+     +  + + +++DS  + + I    
Sbjct: 123 ISESFDITSKEAGGVMDFTLKPKTRDTLFDSLRLSFRNGMINDMQLIDSVGQRTNILFTG 182

Query: 182 YKENTVLDPKVFEIPYDK 199
            K N  +    F+    K
Sbjct: 183 VKANEAIPASKFKFDIPK 200


>gi|221201179|ref|ZP_03574219.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           multivorans CGD2M]
 gi|221206367|ref|ZP_03579380.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           multivorans CGD2]
 gi|221173676|gb|EEE06110.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           multivorans CGD2]
 gi|221179029|gb|EEE11436.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           multivorans CGD2M]
          Length = 229

 Score = 90.7 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/206 (15%), Positives = 56/206 (27%), Gaps = 21/206 (10%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG--------------- 59
           L    A      A         ++       +++ +G F Q+                  
Sbjct: 17  LGAALAGASLMLAATHAFAGGTEQLRAFVAQVRSAKGDFTQQIVKAPAKGASAAQAAPKP 76

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAF 113
                G F  +RP KF + Y  P    L +DG  + VY+  L+  +   L        A 
Sbjct: 77  TDNSSGTFVFSRPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLNGALGASPAA 136

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
            +  SN+           E                    +     +  L   ++ D    
Sbjct: 137 ILFGSNDLDKSYTLRDAGEKGGIEWLEMLPKAQDTQFQRIGIGFKNGTLAAMELHDVFGN 196

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            +++     + N  L    F+    K
Sbjct: 197 VTLLTFSNIQTNPPLKADTFKFVVPK 222


>gi|255019844|ref|ZP_05291920.1| Outer membrane lipoprotein carrier protein LolA [Acidithiobacillus
           caldus ATCC 51756]
 gi|254970773|gb|EET28259.1| Outer membrane lipoprotein carrier protein LolA [Acidithiobacillus
           caldus ATCC 51756]
          Length = 228

 Score = 90.7 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/193 (15%), Positives = 64/193 (33%), Gaps = 13/193 (6%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
                          +V+     F    T+   F QE A           G  +++RP K
Sbjct: 28  FTLGLLLVGVAQAAGAVQDLHRFFQDTHTVTADFSQEIANAQGEIIKRASGRLWVSRPGK 87

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA------FSVIFSNNQHVIQES 127
           F + Y+  +   ++S+G  + +Y   L   +V PL                      +  
Sbjct: 88  FRWDYAGANGQVIVSNGERVWLYEPALQQVTVQPLGKSLGSTPAALIAGRDTLDQDFKVK 147

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLS-YRLLNWKIMDSSRRYSIIKILKYKENT 186
               ++   ++ +  K+       S+        +L   ++ D+  + ++++  K + N 
Sbjct: 148 ALPAKAGLQWVLLEPKEGQTQGFTSLRLGFDGRGQLREMRMEDAFSQTTLLRFTKVRVNA 207

Query: 187 VLDPKVFEIPYDK 199
            +   VF+    K
Sbjct: 208 PVAAHVFQFVPPK 220


>gi|304320398|ref|YP_003854041.1| hypothetical protein PB2503_04122 [Parvularcula bermudensis
           HTCC2503]
 gi|303299300|gb|ADM08899.1| hypothetical protein PB2503_04122 [Parvularcula bermudensis
           HTCC2503]
          Length = 284

 Score = 90.7 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 71/166 (42%), Gaps = 3/166 (1%)

Query: 34  QSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSN 92
           +   KA+    SI  +Q  F Q   +G V  G  ++ RP K  F+Y  PS   +++ G  
Sbjct: 109 EIFDKAVVSLESIDRLQAAFAQRSPSGGVYSGTLYLDRPGKLRFEYDDPSPQLIVATGGL 168

Query: 93  IAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFI--TIFFKDDFMGNM 150
           + V++  L T   YP+     S++ S         ++ V+     +  T+   DD +   
Sbjct: 169 VYVHDEDLKTTDSYPVGETPLSLLLSERIDTQSAVLRGVQRYEDRVAVTVRSTDDAVTGD 228

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
           +++ F      L +W + ++    +++ +        L  ++F IP
Sbjct: 229 LTLIFTAPDMALRSWIVTETDGSRTVVDLSNVTAPQRLANRLFRIP 274


>gi|319638686|ref|ZP_07993446.1| outer-membrane lipoprotein carrier protein [Neisseria mucosa C102]
 gi|317400070|gb|EFV80731.1| outer-membrane lipoprotein carrier protein [Neisseria mucosa C102]
          Length = 206

 Score = 90.7 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 55/194 (28%), Gaps = 9/194 (4%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMAR 70
           LF  +A    ++A    +  +V    +       + G F Q            G F + R
Sbjct: 6   LFTLTAAALLSSAIGFAQAGAVDALKKFNNDADGISGNFSQTVHSKKKTQTTYGTFKILR 65

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFSNNQHVIQ 125
           P  F ++Y+ P   +++ DG  I +Y+  L   +               +          
Sbjct: 66  PGLFKWEYTKPYKQTIVGDGKTIWLYDVDLAQVTKSSQDQTIGDSPAAILSNKTALDSSY 125

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
              +   +N     +            +        L   ++ DS    + I        
Sbjct: 126 TLKEDGSANGIDYVLATPKKNNAGYQYIRIGFKGDNLAAMQLKDSFGNQTSISFSGLNTK 185

Query: 186 TVLDPKVFEIPYDK 199
             L   +F+    K
Sbjct: 186 PNLSSGMFKFTPPK 199


>gi|255318824|ref|ZP_05360050.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           radioresistens SK82]
 gi|262378916|ref|ZP_06072073.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           radioresistens SH164]
 gi|255304080|gb|EET83271.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           radioresistens SK82]
 gi|262300201|gb|EEY88113.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           radioresistens SH164]
          Length = 231

 Score = 90.7 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 33/222 (14%), Positives = 75/222 (33%), Gaps = 26/222 (11%)

Query: 4   LLYKSVIGVVI----LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA- 58
           +L K++  + +    L    +     A    ++ Q+    ++    IQ++   F Q    
Sbjct: 3   MLRKTICAMTVGAATLAPVISTSVIAAPVAASEQQATANLVQQLKGIQSLSANFEQTTKV 62

Query: 59  ----------------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT 102
                               KG   + RP KF+++ SSPS  ++++ G  + +Y+  L  
Sbjct: 63  SGNAPKKQKGLTAQHMNQTFKGTMKVERPGKFFWETSSPSKQTIVTTGKTVWIYDPDLQQ 122

Query: 103 W-----SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDR 157
                         A  +  + +Q +    + +     ++ T++ K++            
Sbjct: 123 AVRQSLDEQVSNTPALLLSGNTSQIMQSYRVTQPNKAKTYYTLYPKNNEGAFQSLTISFG 182

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            +       + DS  + + +K    K N  +    F     K
Sbjct: 183 TNKAPSLMILEDSLGQTTYVKFSNVKVNASIPASTFNFTPPK 224


>gi|50085964|ref|YP_047474.1| outer-membrane lipoproteins carrier protein [Acinetobacter sp.
           ADP1]
 gi|49531940|emb|CAG69652.1| outer-membrane lipoproteins carrier protein [Acinetobacter sp.
           ADP1]
          Length = 230

 Score = 90.3 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 32/223 (14%), Positives = 76/223 (34%), Gaps = 26/223 (11%)

Query: 3   FLLYKSVIGVVIL----FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA 58
             + +  +  + +              AA P ++ Q+    ++    IQ++  +F Q   
Sbjct: 1   MTMLRKTVCAIAMSAATLAPVMSTTVFAATPASEQQATSNLVKQLSGIQSLSASFEQTTK 60

Query: 59  -----------------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD 101
                                KGE  +ARP KF+++ +SPS  ++ + G  + +Y+  L 
Sbjct: 61  TTNAKAPQKKGLSAQHMNQTFKGEMKVARPGKFFWETTSPSKQTIATTGKTVWIYDPDLQ 120

Query: 102 TW-----SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFD 156
                          A  +  + +Q +    + + + + ++ T++ K+            
Sbjct: 121 QAVRQNLDDQVANTPALLLSGNTSQIMQSYRVTQPDRSKTYYTLYPKNSEGAFQSLTISF 180

Query: 157 RLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
             +       + DS  + + ++    K N  +    F     K
Sbjct: 181 GANKAPSLMILQDSLGQTTYVRFNNVKLNPAIPASTFNFTPPK 223


>gi|163855885|ref|YP_001630183.1| outer-membrane lipoprotein carrier protein [Bordetella petrii DSM
           12804]
 gi|163259613|emb|CAP41914.1| lolA [Bordetella petrii]
          Length = 208

 Score = 90.3 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/172 (14%), Positives = 56/172 (32%), Gaps = 11/172 (6%)

Query: 38  KAIEHFLSIQTMQGTFLQEDAGYVM------KGEFFMARPSKFYFKYSSPSSVSLISDGS 91
           +       I++  G+F Q   G          G F   RP KF +  S P    ++SDG 
Sbjct: 29  QLKSFVADIKSATGSFTQSTTGPQGRTQRPQSGTFAFQRPGKFKWAVSQPYEQLVVSDGQ 88

Query: 92  NIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFM 147
            +  Y+  L   +   +         +++F +        +  + + +    +  K    
Sbjct: 89  QLYQYDPDLAQVTSRKVDQAIGTSPAAILFGSGNLEQAFQVAPLPARDGLEWLRAKPRNA 148

Query: 148 G-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                 V         +  +++D+  + + +++   + N  L    F     
Sbjct: 149 DAGFAQVDIGMKDNLPVRVELLDAFGQTTRVELSNIQANPALPASEFRFTPP 200


>gi|114798962|ref|YP_762219.1| LolA family outer membrane lipoprotein carrier protein [Hyphomonas
           neptunium ATCC 15444]
 gi|114739136|gb|ABI77261.1| outer membrane lipoprotein carrier protein, LolA family [Hyphomonas
           neptunium ATCC 15444]
          Length = 220

 Score = 90.3 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/172 (22%), Positives = 78/172 (45%), Gaps = 4/172 (2%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSL 86
               +   +K+A      ++T +G F Q    G    G+F M RP K  F Y  P  + +
Sbjct: 43  SNAERATILKQASSALAGVKTARGRFEQYSPDGAYSTGQFAMQRPGKVRFDYDDPVPLLM 102

Query: 87  ISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQ---RVESNNSFITIFFK 143
           +SDG+ +A+ +A L+T    PL     S++ S+      ++     R  +  + IT+  K
Sbjct: 103 VSDGTTVALQDADLETTDRVPLGSTPLSLLLSDRLDFESQANVLDVRRANGTTNITVQDK 162

Query: 144 DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
              M   +++        L+ W+ +D++   + +++   +    L+P++F +
Sbjct: 163 AGEMEGTLTLVLSEADNSLVGWRSVDANGGNTSVQLSDIETGAKLNPRLFIL 214


>gi|78065551|ref|YP_368320.1| outer-membrane lipoprotein carrier protein [Burkholderia sp. 383]
 gi|77966296|gb|ABB07676.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           383]
          Length = 229

 Score = 90.3 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 32/206 (15%), Positives = 56/206 (27%), Gaps = 21/206 (10%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG--------------- 59
           L    A      A         ++       +++ +G F Q+                  
Sbjct: 17  LGAALAGASLMLAATHAFAGGTEQLKAFVSQVRSAKGDFTQQIVKAPAKGASAVQAVPKP 76

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAF 113
                G F  ARP KF + Y  P    L +DG  + VY+  L+  +   L        A 
Sbjct: 77  TDNSSGTFVFARPGKFIWTYQKPYQQVLQADGEKLYVYDRDLNQVTERKLNGALGASPAA 136

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
            +  SN+           E                    +     +  L   ++ D    
Sbjct: 137 ILFGSNDLDKNYTLRDAGEKGGIEWLEMLPKAQDTQFQRIGIGFKNGTLAAMELHDVFGN 196

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            +++     + N  L    F+    K
Sbjct: 197 VTLLTFTNIQTNPPLKGDTFKFVVPK 222


>gi|254418783|ref|ZP_05032507.1| Outer membrane lipoprotein carrier protein LolA [Brevundimonas sp.
           BAL3]
 gi|196184960|gb|EDX79936.1| Outer membrane lipoprotein carrier protein LolA [Brevundimonas sp.
           BAL3]
          Length = 227

 Score = 89.9 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 38/180 (21%), Positives = 74/180 (41%), Gaps = 5/180 (2%)

Query: 24  FNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPS 82
             +         V++A  +  ++ + QGTF++    G   +G F++ RP K  F+Y+SP+
Sbjct: 41  AQSNLSAEDRAVVQQAQAYLQTLTSAQGTFVETGPGGQRREGRFYLQRPGKMRFEYTSPA 100

Query: 83  SVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRV----ESNNSFI 138
            + ++SDG N+  Y+ +L+ +   PL     S   + N  + Q           S    I
Sbjct: 101 GLLVVSDGYNVKRYDPRLNNFQQVPLGRTPLSTFLARNVRLDQGVRIDRVTRMSSGAFAI 160

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           T           + + F     RL  W I D+    +  ++   +  + L   +F++   
Sbjct: 161 TARDSGRPNDGAVVLAFAGDPMRLHEWTITDAQGARTRTQLTALQPASNLASSLFQLRDP 220


>gi|261856113|ref|YP_003263396.1| outer membrane lipoprotein carrier protein LolA [Halothiobacillus
           neapolitanus c2]
 gi|261836582|gb|ACX96349.1| outer membrane lipoprotein carrier protein LolA [Halothiobacillus
           neapolitanus c2]
          Length = 273

 Score = 89.9 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/181 (16%), Positives = 61/181 (33%), Gaps = 10/181 (5%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEFFMARPSKFYFKYSSPS 82
             +    ++   E   +++T    F+Q      G       G F +ARP +F++ Y  P 
Sbjct: 85  ASSAAADIRPLTEFVRTLKTFSADFVQQQVNVRGQKQPASSGHFVLARPGRFFWAYEKPY 144

Query: 83  SVSLISDGSNIAVYNAKLDTWSVYPLRYM---AFSVIFSNNQHVIQESIQRVESNNSFIT 139
              LI++   + VY+  L   +  PL         +   N        +  +  N+    
Sbjct: 145 VQKLIANEGVLWVYDPDLAQVTRSPLADNRGAPIGIFLGNQPLQEAFDVSSIGKNDGLNW 204

Query: 140 IFFKDDFMGN-MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
              KD    +    V     +  +      D     + ++  + + N  +D  +F+    
Sbjct: 205 YSLKDRSAKSDFNQVQIGMDAKGIKAMVFTDKLDNRTTVQFSQREVNQKVDDSLFQFVPP 264

Query: 199 K 199
           K
Sbjct: 265 K 265


>gi|254449278|ref|ZP_05062725.1| outer membrane lipoprotein carrier protein LolA [gamma
           proteobacterium HTCC5015]
 gi|198261133|gb|EDY85431.1| outer membrane lipoprotein carrier protein LolA [gamma
           proteobacterium HTCC5015]
          Length = 211

 Score = 89.9 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/193 (16%), Positives = 68/193 (35%), Gaps = 14/193 (7%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------VMKGEFFMA 69
           +         A+      ++++         + ++  F Q              G   + 
Sbjct: 3   YALFGFSLLLASSASLAGEALEHLEHFLSHTKNLKADFSQTLEDSSGRQLQQQTGTVVLQ 62

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSVIFSNNQHVIQ 125
           RP++F + Y  P    L++DG N+  Y+  L+  SV PL         +++ S+     Q
Sbjct: 63  RPNRFVWHYQQPYEQQLVADGRNLWHYDVDLEQVSVRPLDEALGAAPIALLSSDTPLKEQ 122

Query: 126 ESIQRVESNNSFITIFFK---DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
             I  +   +    +  +    D       + FD    +L   ++ D   + + I +   
Sbjct: 123 FVITELGKIDGRYMVQLEAKVKDTDYGFALLAFDAQ-GQLDIMQLKDPMGQVTTIDLDNL 181

Query: 183 KENTVLDPKVFEI 195
             NT ++P  F+ 
Sbjct: 182 ASNTAIEPGTFDF 194


>gi|237800566|ref|ZP_04589027.1| lipoprotein chaperone [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331023426|gb|EGI03483.1| lipoprotein chaperone [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 207

 Score = 89.9 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/198 (13%), Positives = 64/198 (32%), Gaps = 11/198 (5%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEF 66
           +I    +    F+        + V +  +     QT+   F Q              GE 
Sbjct: 3   LIRMLLATALTFSVISAHADSKDVARLTQLLEKSQTLTARFSQLTLDGGGTQLQETTGEM 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQH 122
            + RP  F +   +P    ++SDG  +++++  L+  +       L      ++  +   
Sbjct: 63  ALQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTPALLLSGDVSK 122

Query: 123 VIQESIQRVESNNSFI-TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           + +      +     I  +           S+     +  + + +++DS  + + I    
Sbjct: 123 ISESFDITAKEAGGVIDFVLKPKTKDTLFDSLRLSFRNGIINDMQLIDSVGQRTNILFTG 182

Query: 182 YKENTVLDPKVFEIPYDK 199
            K N  +    F+    K
Sbjct: 183 VKANEPIAASKFQFQIPK 200


>gi|282403535|pdb|2W7Q|A Chain A, Structure Of Pseudomonas Aeruginosa Lola
 gi|282403536|pdb|2W7Q|B Chain B, Structure Of Pseudomonas Aeruginosa Lola
          Length = 204

 Score = 89.9 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/183 (16%), Positives = 62/183 (33%), Gaps = 11/183 (6%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSS 80
           +  I    +V++        QT+   F Q              G+  + RP  F +   +
Sbjct: 14  SIAIDDSAAVQRLTGLLNKAQTLTARFSQLTLDGSGTRLQETAGQLSLKRPGLFRWHTDA 73

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFSNNQHVIQESIQRVESNN 135
           P+   LIS+G  + +Y+  L+  ++  L           +    ++     +I   E  N
Sbjct: 74  PNEQLLISNGEKVWLYDPDLEQVTIQKLDQRLTQTPALLLSGDISKISESFAITYKEGGN 133

Query: 136 SFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
               +           ++     S ++ + +++D   + + I     K N  LD K F  
Sbjct: 134 VVDFVLKPKTKDTLFDTLRLSFRSGKVNDMQMIDGVGQRTNILFFDVKMNEALDAKQFTF 193

Query: 196 PYD 198
              
Sbjct: 194 DVP 196


>gi|261377960|ref|ZP_05982533.1| outer membrane lipoprotein carrier protein LolA [Neisseria cinerea
           ATCC 14685]
 gi|269145822|gb|EEZ72240.1| outer membrane lipoprotein carrier protein LolA [Neisseria cinerea
           ATCC 14685]
          Length = 207

 Score = 89.9 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/204 (14%), Positives = 55/204 (26%), Gaps = 13/204 (6%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY---- 60
           + K       LF + A           +  +V    +       + G+F Q   G     
Sbjct: 1   MMKQHN----LFKFLAASALTVTIGFAQAGAVDALKKFNNDADGISGSFTQTVQGKKKTQ 56

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSV 115
              G F + RP  F ++Y+ P   +++ DG  I +Y+  L   +               +
Sbjct: 57  TAHGTFKILRPGLFKWEYTKPYKQTIVGDGQTIWLYDVDLAQVTKSAQDQTIGDSPAAIL 116

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
                        +   SN     +            +        L   ++ DS    +
Sbjct: 117 SNKTALDSSYSLKEDGSSNGIDYVLATPKKNNAGYQYIRIGFKGDNLAAMQLKDSFGNQT 176

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
            I          L    F+    +
Sbjct: 177 SISFGSLNTKPNLSRGAFKFTPPQ 200


>gi|134295003|ref|YP_001118738.1| outer-membrane lipoprotein carrier protein [Burkholderia
           vietnamiensis G4]
 gi|134138160|gb|ABO53903.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           vietnamiensis G4]
          Length = 229

 Score = 89.9 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/206 (15%), Positives = 56/206 (27%), Gaps = 21/206 (10%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED----------------A 58
           L    A      A         ++       +++ +G F Q+                  
Sbjct: 17  LGAALAGASLMLAATHAFAGGTEQLKAFVSQVRSARGDFTQQIVKAPAKGASAAQVAPKP 76

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAF 113
                G F  ARP KF + Y  P    L +DG  + VY+  L+  +   L        A 
Sbjct: 77  NDNSSGTFVFARPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLNGALGASPAA 136

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
            +  SN+           E                    +     +  L   ++ D    
Sbjct: 137 ILFGSNDLDKNYTLRDAGEKGGIDWLEMLPKAQDTQFQRIGIGFRNGTLAAMELHDVFGN 196

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            +++     + N  L    F+    K
Sbjct: 197 VTLLTFTNIQTNPPLKSDTFKFVVPK 222


>gi|187923040|ref|YP_001894682.1| outer-membrane lipoprotein carrier protein [Burkholderia
           phytofirmans PsJN]
 gi|187714234|gb|ACD15458.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           phytofirmans PsJN]
          Length = 244

 Score = 89.9 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/206 (15%), Positives = 58/206 (28%), Gaps = 25/206 (12%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED--------------------A 58
            AI               ++       + + +GTF+Q++                     
Sbjct: 32  VAIGASVLFASQAFASGTEQLKAFVAQVHSARGTFVQQEVRAPSKAQGASGTLSTQGAGK 91

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAF 113
                G F  ARP KF ++Y  P +  L +DG  + VY+  L+  +V           A 
Sbjct: 92  TGTSSGTFTFARPGKFIWQYEKPYAQLLQADGDKLYVYDKDLNQVTVRSLGGALGASPAA 151

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
            +  SN+                                V        L   ++ D    
Sbjct: 152 ILFGSNDLDKNFTLRDAGVKAGIDWLELTPKAKDTQFQRVGIGFKDGNLEAMELHDVFGN 211

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            +++     ++N  L    F+    K
Sbjct: 212 VTLLTFSNIQKNPPLPADAFKFTVPK 237


>gi|289208987|ref|YP_003461053.1| outer membrane lipoprotein carrier protein LolA [Thioalkalivibrio
           sp. K90mix]
 gi|288944618|gb|ADC72317.1| outer membrane lipoprotein carrier protein LolA [Thioalkalivibrio
           sp. K90mix]
          Length = 219

 Score = 89.6 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/211 (12%), Positives = 60/211 (28%), Gaps = 13/211 (6%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY 60
           M   L   ++  +            AA       +          ++T    F Q     
Sbjct: 1   MTVRLVPRLLLALAATTMFLFAGPLAAERGPAPDARAALDRFVEGLETFTAEFTQTVRDE 60

Query: 61  V------MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS 114
                    G   +  P++  ++ + P   +++SDG ++  Y+  L   +V PL     +
Sbjct: 61  TGYVLQESDGSMQLGMPNRLRWEVTEPFPQTIVSDGEDLWTYDPDLAQATVRPLGDAFDA 120

Query: 115 VIF------SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLS-YRLLNWKI 167
                           +  +  V   ++   +    +   +   +  D      L     
Sbjct: 121 TPIAAITQPERLDEHFRMDVLPVRDASALRLLLIPRNEQADFTHLELDLTPDGDLTRMAF 180

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
            D   + + I   + + N  +D  VF     
Sbjct: 181 RDIFGQETEIHFERSERNAPVDESVFTFDPP 211


>gi|256822344|ref|YP_003146307.1| outer membrane lipoprotein carrier protein LolA [Kangiella
           koreensis DSM 16069]
 gi|256795883|gb|ACV26539.1| outer membrane lipoprotein carrier protein LolA [Kangiella
           koreensis DSM 16069]
          Length = 227

 Score = 89.6 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/208 (13%), Positives = 65/208 (31%), Gaps = 15/208 (7%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY---- 60
           + KS+   +  F  ++     +   +    + +   +   +I + +  F Q         
Sbjct: 1   MIKSIKNRLTQFVSASALLCFST--LVAADAPQDLEKKLTAIDSFKANFSQVITDEFGTL 58

Query: 61  --VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFS 118
                G F + RP  F +  S P    +I+DG N+  ++  ++  +V  L     +   +
Sbjct: 59  IDESSGYFELQRPQLFRWVVSEPFEQEIIADGVNLWQFDIDIEQINVSSLDQTLANSPAA 118

Query: 119 NNQHVIQESIQRVE-------SNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS 171
                  +     E            I      D       +  +     L+  ++ D+ 
Sbjct: 119 LLSQAQLDVATNYEVAAVQGQQEGVMIYHLMPRDPDALYEVLIIEFNGDDLVALQVKDNL 178

Query: 172 RRYSIIKILKYKENTVLDPKVFEIPYDK 199
            + +++       N   D   FE    +
Sbjct: 179 GQSTLVDFTNVVMNPPFDEDHFEFTVPE 206


>gi|77459807|ref|YP_349314.1| outer-membrane lipoprotein carrier protein [Pseudomonas fluorescens
           Pf0-1]
 gi|123744678|sp|Q3KA81|LOLA_PSEPF RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|77383810|gb|ABA75323.1| outer-membrane lipoprotein carrier protein [Pseudomonas fluorescens
           Pf0-1]
          Length = 206

 Score = 89.6 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 26/197 (13%), Positives = 66/197 (33%), Gaps = 11/197 (5%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFF 67
           ++     +           D+ V +  +   + +T+   F Q              G+  
Sbjct: 3   LIRMLLPVLALTTLTAHADDKDVARLTQLLETSKTLTANFSQLTLDGSGTQLQETTGDMT 62

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQHV 123
           + RP  FY+  ++P+  +++SDG  + +++  L+  +       L      ++  +   +
Sbjct: 63  LQRPGLFYWHTNAPAEQTMVSDGKKVTLWDPDLEQATIKKLDERLTQTPALLLSGDVSKI 122

Query: 124 IQESIQRVESNNSFI-TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
            Q      +     I              S+     +  + + +++DS  + + I     
Sbjct: 123 SQSFDITAKEAGGVIDFTLKPKTKDTLFDSLRLSFRNGLVNDMQLIDSVGQRTNILFTGV 182

Query: 183 KENTVLDPKVFEIPYDK 199
           K N  +    F+    K
Sbjct: 183 KANEAVPASKFKFDIPK 199


>gi|184159301|ref|YP_001847640.1| outer membrane lipoprotein-sorting protein [Acinetobacter baumannii
           ACICU]
 gi|183210895|gb|ACC58293.1| Outer membrane lipoprotein-sorting protein [Acinetobacter baumannii
           ACICU]
          Length = 229

 Score = 89.6 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 34/222 (15%), Positives = 72/222 (32%), Gaps = 26/222 (11%)

Query: 4   LLYKSVIGVVILFFYSA----IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA- 58
           +L K++  + +     A       F A     + Q++   +     +Q +   F Q    
Sbjct: 1   MLRKTMCAITLSASVLAPVMSTTAFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKA 60

Query: 59  ----------------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT 102
                               KG   + RP KFY++  SPS  ++++ G  + +Y+  L  
Sbjct: 61  NTKTVAQKKGLSAQHMNQTFKGSMKVERPGKFYWETVSPSKQTIVTSGKTVWIYDPDLQQ 120

Query: 103 W-----SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDR 157
                         A  +  + NQ +    + + + +  + T+F K +            
Sbjct: 121 AVRQSLDDQVADTPALLLSGNTNQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFG 180

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            +       + DS  + + ++    K N  +    F     K
Sbjct: 181 ANKAPTLMVLQDSLGQTTYVRFKNVKVNASIPASTFNFTPPK 222


>gi|170691966|ref|ZP_02883130.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           graminis C4D1M]
 gi|170143250|gb|EDT11414.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           graminis C4D1M]
          Length = 252

 Score = 89.6 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/215 (14%), Positives = 57/215 (26%), Gaps = 34/215 (15%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE---------------------- 56
            AI               ++       + + +GTF+Q+                      
Sbjct: 31  VAIGASVLVASQAFASGTEQLKAFVSQVHSARGTFVQQEVRAPGKAQGASGGSGGSGASG 90

Query: 57  -------DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-- 107
                         G F  ARP KF ++Y  P +  L +DG  + VY+  L+  +V    
Sbjct: 91  VLSTTGGSKNSTSSGTFTFARPGKFIWQYEKPYAQLLQADGDKLYVYDKDLNQVTVRSLG 150

Query: 108 ---LRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLN 164
                  A  +  SN+                                V        L  
Sbjct: 151 GALGASPAAILFGSNDLDKNFTLRDAGVKAGIDWLELTPKAKDTQFQRVGIGFKDGNLQA 210

Query: 165 WKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            ++ D     +++     ++N  L    F+    K
Sbjct: 211 MELHDVFGNVTLLTFSNIQKNPPLPADAFKFTVPK 245


>gi|71274774|ref|ZP_00651062.1| Outer membrane lipoprotein carrier protein LolA [Xylella fastidiosa
           Dixon]
 gi|170729982|ref|YP_001775415.1| outer-membrane lipoprotein carrier protein [Xylella fastidiosa M12]
 gi|71164506|gb|EAO14220.1| Outer membrane lipoprotein carrier protein LolA [Xylella fastidiosa
           Dixon]
 gi|167964775|gb|ACA11785.1| periplasmic chaperone [Xylella fastidiosa M12]
          Length = 214

 Score = 89.6 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 26/217 (11%), Positives = 71/217 (32%), Gaps = 20/217 (9%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG- 59
           M +++   +       F++            +             ++T+QG F QE    
Sbjct: 1   MIWMML--MFSRFRYIFFAVALLSGPVCAGARVD----LSAFTRGLKTLQGHFSQEVIDT 54

Query: 60  -----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW----SVYPLRY 110
                    G   ++ P+   ++  +P    +++DG  + +++  L+           R 
Sbjct: 55  QGRVKERSNGTVALSLPNLLRWECDAPYKQLVVADGKRVWLFDPDLNQASVLLQDNEERN 114

Query: 111 MAFSVIFSNNQHVIQESIQRV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKI 167
                +    Q   +  +           ++++  +     +  S +F     +L   ++
Sbjct: 115 SPLIALIDPIQLDRKYDVSEEVAMRDGLRWLSLRPRGGTEASFQSASFGFSQTQLARMEL 174

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVFEI-PYDKIHNI 203
           +D+  + ++I    ++ N V     F   P   +  I
Sbjct: 175 VDNLGQRTVIAFSGWQRNPVFAVNTFRFTPGKNVDVI 211


>gi|307728948|ref|YP_003906172.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           CCGE1003]
 gi|307583483|gb|ADN56881.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           CCGE1003]
          Length = 245

 Score = 89.6 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/212 (14%), Positives = 59/212 (27%), Gaps = 31/212 (14%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED--------------------- 57
           +A+               ++       + + +GTF+Q++                     
Sbjct: 27  AALGASMLVASQAFASGTEQLKTFVAQVHSARGTFVQQEVRAPGKAQAASSPSAGSGVLS 86

Query: 58  -----AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----- 107
                      G F  ARP KF ++Y  P +  L +DG  + VY+  L+  +V       
Sbjct: 87  TNGGGKNSTSSGTFTFARPGKFIWQYEKPYAQLLQADGDKLYVYDKDLNQVTVRSLGGAL 146

Query: 108 LRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKI 167
               A  +  SN+                                V        L   ++
Sbjct: 147 GASPAAILFGSNDLDKNFTLRDAGVKAGIDWLELTPKTKDTQFQRVGIGFKDGNLQAMEL 206

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            D     +++     ++N  L    F+    K
Sbjct: 207 HDVFGNVTLLTFSNIQKNPPLPADAFKFTVPK 238


>gi|114320864|ref|YP_742547.1| outer membrane lipoprotein carrier protein LolA [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|122941173|sp|Q0A7Y0|LOLA_ALHEH RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|114227258|gb|ABI57057.1| outer membrane lipoprotein carrier protein LolA [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 214

 Score = 89.6 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 72/204 (35%), Gaps = 13/204 (6%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----- 60
            K  +   +L                +  +      ++  + ++QG F Q+         
Sbjct: 1   MKIKLAFAVLLALCLSLSVMPVLA-EQAATRADLARYYDDVTSLQGRFTQQTHDESGRIL 59

Query: 61  -VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSV 115
               GEF++ RP +F + Y+ P    ++SDG  + VY+  LD  +V  L         ++
Sbjct: 60  EESSGEFWIERPDRFRWNYAEPWPQEIVSDGERLWVYDQDLDQVTVRSLADSLGRGPATL 119

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           +      + +            + +  ++  +     +         +  ++ D   + +
Sbjct: 120 LGGTLGELEEAFELTFPE-PGRVALQPREATLDYEHVLLR-LEDGVPVELELEDGLGQIT 177

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
           ++++   + +  +DP  FE    +
Sbjct: 178 VLRLEALERDVEIDPGRFEFQPPE 201


>gi|330875795|gb|EGH09944.1| lipoprotein chaperone [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
 gi|330965614|gb|EGH65874.1| lipoprotein chaperone [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 207

 Score = 89.2 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 27/198 (13%), Positives = 64/198 (32%), Gaps = 11/198 (5%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEF 66
           +I    +    F+        + V +  +     QT+   F Q              GE 
Sbjct: 3   LIRMLLATALTFSVIPAHADGKDVARLTQLLEKSQTLTARFSQLTLDGGGTQLQETTGEM 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQH 122
            + RP  F +   +P    ++SDG  +++++  L+  +       L      ++  +   
Sbjct: 63  ALQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTPALLLSGDVSK 122

Query: 123 VIQESIQRVESNNSFI-TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           + +      +     I  +           S+     +  + + +++DS  + + I    
Sbjct: 123 ISESFDITAKEAGGVIDFVLKPKTKDTLFDSLRLSFRNGIINDMQLIDSVGQRTNILFTG 182

Query: 182 YKENTVLDPKVFEIPYDK 199
            K N  +    F+    K
Sbjct: 183 VKANESIAASKFQFQIPK 200


>gi|153008296|ref|YP_001369511.1| outer membrane lipoprotein carrier protein LolA [Ochrobactrum
           anthropi ATCC 49188]
 gi|151560184|gb|ABS13682.1| outer membrane lipoprotein carrier protein LolA [Ochrobactrum
           anthropi ATCC 49188]
          Length = 230

 Score = 89.2 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 48/164 (29%), Positives = 81/164 (49%), Gaps = 4/164 (2%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF S++TM G F+Q    G    G F++ RP K  F Y++   + +ISDG ++ + N K
Sbjct: 62  DHFSSVRTMTGEFVQFGPKGEQTGGTFYIERPGKIRFNYNNSP-IRVISDGESVVINNRK 120

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIF--FKDDFMGNMISVTFDR 157
           LDTW +YPL      ++ ++   +    +Q V+      T+    K  F  + I++ FD 
Sbjct: 121 LDTWDLYPLSKTPLKLLLADRIDLGGGRLQNVKQEPDMTTLVLGDKSIFGDSKITMMFDP 180

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIH 201
            SY L  W I D+ +  + + I   +        +F+I Y +I 
Sbjct: 181 KSYELKQWTITDAQKLDTTVMIFNVRSGVRFTDDMFKIDYQRIA 224


>gi|260548982|ref|ZP_05823204.1| outer-membrane lipoproteins carrier protein [Acinetobacter sp.
           RUH2624]
 gi|260408150|gb|EEX01621.1| outer-membrane lipoproteins carrier protein [Acinetobacter sp.
           RUH2624]
          Length = 231

 Score = 89.2 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 35/222 (15%), Positives = 69/222 (31%), Gaps = 26/222 (11%)

Query: 4   LLYKSVIGVVILFFYSA----IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA- 58
           +L K++  + +     A       F A     + Q++   +     +Q +   F Q    
Sbjct: 3   MLRKTMCAITLSASVLAPVMSTTAFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKA 62

Query: 59  ----------------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT 102
                               KG   + RP KFY++  SPS  ++++ G  + +Y+  L  
Sbjct: 63  NTKAVAQKKGLGAQHMNQTFKGSMKVERPGKFYWETVSPSKQTIVTSGKTVWIYDPDLQQ 122

Query: 103 WSVYPLRYM----AFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRL 158
                L          ++  N   +++         +      F     G   S+T    
Sbjct: 123 AVRQSLDSQVADTPALLLSGNTSQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFG 182

Query: 159 -SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            +       + DS  + + +K    K N  +    F     K
Sbjct: 183 ANKAPTLMVLQDSLGQTTYVKFNNVKVNASIPASTFNFTPPK 224


>gi|239833025|ref|ZP_04681354.1| outer membrane lipoprotein carrier protein LolA [Ochrobactrum
           intermedium LMG 3301]
 gi|239825292|gb|EEQ96860.1| outer membrane lipoprotein carrier protein LolA [Ochrobactrum
           intermedium LMG 3301]
          Length = 230

 Score = 89.2 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 48/164 (29%), Positives = 81/164 (49%), Gaps = 4/164 (2%)

Query: 41  EHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK 99
           +HF S++TM G F+Q    G    G F++ RP K  F Y++   + +ISDG ++ + N K
Sbjct: 62  DHFSSVRTMTGEFVQFGPKGEQTGGTFYIERPGKIRFNYNNSP-IRVISDGESVVINNRK 120

Query: 100 LDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIF--FKDDFMGNMISVTFDR 157
           LDTW +YPL      ++ ++   +    +Q V+      T+    K  F  + I++ FD 
Sbjct: 121 LDTWDLYPLSKTPLKLLLADRIDLGGGRLQNVKQEPDMTTLVLGDKSIFGDSKITMMFDP 180

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIH 201
            SY L  W I D+ +  + + I   +        +F+I Y +I 
Sbjct: 181 KSYELKQWTITDAQKLDTTVMIFNVRSGVRFTDDMFKIDYQRIA 224


>gi|330815818|ref|YP_004359523.1| Outer membrane lipoprotein carrier protein LolA [Burkholderia
           gladioli BSR3]
 gi|327368211|gb|AEA59567.1| Outer membrane lipoprotein carrier protein LolA [Burkholderia
           gladioli BSR3]
          Length = 227

 Score = 89.2 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 30/206 (14%), Positives = 52/206 (25%), Gaps = 21/206 (10%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG--------------- 59
                A     A           +       ++T +G F Q+                  
Sbjct: 15  FVAALAGASLMAVASQAFAGGTDQLKAFIAQVKTAKGGFTQQIVKAPSKGASGAMPTVKP 74

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAF 113
                G F  +RP +F + Y  P    L +DG  + VY+  L+  +   L        A 
Sbjct: 75  TDNSSGTFVFSRPGRFVWSYEKPYQQLLQADGDTLYVYDKDLNQVTERKLSGALGASPAA 134

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
            +  SN+           E                    +        L   ++ D    
Sbjct: 135 ILFGSNDIEKNYTLRDAGEKGGIDWVEMQPKSQDTQFQRIGIGFKGGTLAAMELHDVFGN 194

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            +++     + N  L    F     K
Sbjct: 195 VTLLTFTNMQTNPALPADTFRFAVPK 220


>gi|289625406|ref|ZP_06458360.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. aesculi str. NCPPB3681]
 gi|289649311|ref|ZP_06480654.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. aesculi str. 2250]
 gi|330866857|gb|EGH01566.1| lipoprotein chaperone [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 207

 Score = 89.2 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 27/198 (13%), Positives = 64/198 (32%), Gaps = 11/198 (5%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEF 66
           +I    +    F+        + V +  +     QT+   F Q              GE 
Sbjct: 3   LIRMLLATALTFSVMSAHADSKDVARLTQLLEKSQTLTARFSQLTLDGGGTQLQETTGEM 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQH 122
            + RP  F +   +P    ++SDG  +++++  L+  +       L      ++  +   
Sbjct: 63  TLQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTPALLLSGDVSK 122

Query: 123 VIQESIQRVESNNSFI-TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           + +      +     I  +           S+     +  + + +++DS  + + I    
Sbjct: 123 ISESFDITAKEAGGVIDFVLKPKTRDTLFDSLRLSFRNGIINDMQLIDSVGQRTNILFTG 182

Query: 182 YKENTVLDPKVFEIPYDK 199
            K N  +    F+    K
Sbjct: 183 VKANEPVAASKFQFQIPK 200


>gi|167586456|ref|ZP_02378844.1| outer-membrane lipoprotein carrier protein [Burkholderia ubonensis
           Bu]
          Length = 229

 Score = 89.2 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/206 (15%), Positives = 56/206 (27%), Gaps = 21/206 (10%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED----------------A 58
           L    A      A         ++       +++ +G F Q+                 +
Sbjct: 17  LGAALAGASLMLAATHAFAGGTEQLKAFVSQVRSAKGEFTQQIVKAPAKGASAAQAAPKS 76

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAF 113
                G F  ARP KF + Y  P    L +DG  + VY+  L+  +            A 
Sbjct: 77  TDNSSGTFVFARPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLAGALGASPAA 136

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
            +  SN+           E                    +     +  L   ++ D    
Sbjct: 137 ILFGSNDLDKNYTLRDAGEKGGIEWLEMLPKAQDTQFQRIGIGFRNGTLAAMELHDVFGN 196

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            +++     + N  L    F+    K
Sbjct: 197 VTLLTFTNIQTNPPLKSDTFKFVVPK 222


>gi|162453352|ref|YP_001615719.1| hypothetical protein sce5076 [Sorangium cellulosum 'So ce 56']
 gi|161163934|emb|CAN95239.1| putative exported protein [Sorangium cellulosum 'So ce 56']
          Length = 232

 Score = 89.2 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 27/204 (13%), Positives = 68/204 (33%), Gaps = 17/204 (8%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGE 65
           + ++    A    + A   T ++  ++  + + S +T + +F Q       D   V  G+
Sbjct: 21  LTVVLATLATAGESQAAGPTAEELGRRVQQFYDSTKTFKASFTQTYTIKVQDVKKVSTGK 80

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVY--NAKLDTWSVYPLRYMAFSVIF------ 117
               +P K  + Y +P+   ++SDG  I VY  + +    +         ++ F      
Sbjct: 81  VTFEKPGKMSWIYDAPNGNRVVSDGVTIKVYEKDNEQMFETPVKGSQYPAALAFLMGKGQ 140

Query: 118 ---SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
                +  ++  +  + E          +       + +  D  + ++    I+D+    
Sbjct: 141 LTKDFSLRLLDPAQMKFEGGYVLEGTPKEATPAYQKMLLYVDGQTNQVRRVLILDAQGNR 200

Query: 175 SIIKILKYKENTVLDPKVFEIPYD 198
           +         N  +    F+    
Sbjct: 201 NRFDFSSPVVNQPVGKTEFDFTPP 224


>gi|90415911|ref|ZP_01223844.1| periplasmic chaperone LolA [marine gamma proteobacterium HTCC2207]
 gi|90332285|gb|EAS47482.1| periplasmic chaperone LolA [marine gamma proteobacterium HTCC2207]
          Length = 225

 Score = 89.2 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/215 (13%), Positives = 79/215 (36%), Gaps = 17/215 (7%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKD-QSVKKAIEHFLSIQTMQGTFLQEDAG---- 59
           + +S+  + +  F       + A       + +++  +    I ++   F Q+ +     
Sbjct: 13  MMRSLHKIALPLFLLLTPFVSTASWSGGAPEDIQQLRDLLQPITSLSARFEQKISDAEGF 72

Query: 60  --YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD----TWSVYPLRYMAF 113
                +G F +++P++  +   +P    +I+DG  + VY+  L+          +     
Sbjct: 73  ELQASEGLFQVSQPNRLRWIVEAPMPQQIIADGLTLWVYDPDLEQVIIQPFNQDMAATPA 132

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
            +   +   +         +   F     +   + N +++ FD  +    + ++ D+  +
Sbjct: 133 ILFSGDLDRLDDAYFVTQLAEGRFELKPEQGGSLFNSMTIAFDGSTPT--SIRLTDTLGQ 190

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK----IHNIN 204
            + I+  + + N VL   +F          I+N N
Sbjct: 191 TTTIRFSQLELNPVLSGDLFVFQAPDGVDVINNAN 225


>gi|170698491|ref|ZP_02889562.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           ambifaria IOP40-10]
 gi|171315513|ref|ZP_02904749.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           ambifaria MEX-5]
 gi|172059903|ref|YP_001807555.1| outer-membrane lipoprotein carrier protein [Burkholderia ambifaria
           MC40-6]
 gi|170136575|gb|EDT04832.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           ambifaria IOP40-10]
 gi|171099350|gb|EDT44088.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           ambifaria MEX-5]
 gi|171992420|gb|ACB63339.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           ambifaria MC40-6]
          Length = 229

 Score = 89.2 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/206 (15%), Positives = 56/206 (27%), Gaps = 21/206 (10%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED----------------A 58
           L    A      A         ++       +++ +G F Q+                  
Sbjct: 17  LGAALAGASLMLAATHAFASGTEQLKAFVSQVRSAKGEFTQQIVKAPSKGASAAQAAPKP 76

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAF 113
                G F  +RP KF + Y  P    L +DG  + VY+  L+  +   L        A 
Sbjct: 77  NDNSSGTFVFSRPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLNGALGASPAA 136

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
            +  SN+           E                    +     +  L   ++ D    
Sbjct: 137 ILFGSNDLDKNYTLRDAGEKGGIDWLEMLPKAQDTQFQRIGIGFRNGTLAAMELHDVFGN 196

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            +++     + N  L    F+    K
Sbjct: 197 VTLLTFTNIQTNPPLKGDTFKFVVPK 222


>gi|297538758|ref|YP_003674527.1| outer membrane lipoprotein carrier protein LolA [Methylotenera sp.
           301]
 gi|297258105|gb|ADI29950.1| outer membrane lipoprotein carrier protein LolA [Methylotenera sp.
           301]
          Length = 205

 Score = 89.2 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 30/180 (16%), Positives = 57/180 (31%), Gaps = 11/180 (6%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------GEFFMARPSKFYFKYSSPSS 83
                 V    + +     ++  F Q       +      GE  + RP+KF + Y  P  
Sbjct: 18  AANADGVSSLKKFYDETHAVKADFHQIVTDKQGQKIQEVYGEMQLKRPNKFRWDYHKPFE 77

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFSNNQHVIQESIQRVESNNSFI 138
             +ISDG  + +Y+ +L   SV  L           +   ++     + +     +    
Sbjct: 78  QQIISDGKQVWLYDTELAQVSVRELSKALGSSPAALLAGDDSLDKNFKLVNAFRKDGLDW 137

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                 D       ++    +  L    ++DS    + I       N V++PK F     
Sbjct: 138 VSTNPKDSDTGFNKISLAFKNDVLQEMDMIDSFGHQTKILFSNVVHNPVIEPKSFLFKPP 197


>gi|71737139|ref|YP_275262.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|257485417|ref|ZP_05639458.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|298487531|ref|ZP_07005573.1| Outer-membrane lipoprotein carrier protein precursor [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|123635962|sp|Q48H71|LOLA_PSE14 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|71557692|gb|AAZ36903.1| outer membrane lipoprotein carrier protein LolA [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|298157915|gb|EFH98993.1| Outer-membrane lipoprotein carrier protein precursor [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|320323769|gb|EFW79853.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. glycinea str. B076]
 gi|320327910|gb|EFW83915.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. glycinea str. race 4]
 gi|330881212|gb|EGH15361.1| lipoprotein chaperone [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330889678|gb|EGH22339.1| lipoprotein chaperone [Pseudomonas syringae pv. mori str. 301020]
 gi|330987922|gb|EGH86025.1| lipoprotein chaperone [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331010746|gb|EGH90802.1| lipoprotein chaperone [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 207

 Score = 88.8 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 27/198 (13%), Positives = 64/198 (32%), Gaps = 11/198 (5%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEF 66
           +I    +    F+        + V +  +     QT+   F Q              GE 
Sbjct: 3   LIRMLLATALTFSVMSAHADSKDVARLTQLLEKSQTLTARFSQLTLDGGGTQLQETTGEM 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQH 122
            + RP  F +   +P    ++SDG  +++++  L+  +       L      ++  +   
Sbjct: 63  TLQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTPALLLSGDVSK 122

Query: 123 VIQESIQRVESNNSFI-TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           + +      +     I  +           S+     +  + + +++DS  + + I    
Sbjct: 123 ISESFDITAKEAGGVIDFVLKPKTKDTLFDSLRLSFRNGIINDMQLIDSVGQRTNILFTG 182

Query: 182 YKENTVLDPKVFEIPYDK 199
            K N  +    F+    K
Sbjct: 183 VKANEPVAASKFQFQIPK 200


>gi|295675836|ref|YP_003604360.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           CCGE1002]
 gi|295435679|gb|ADG14849.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           CCGE1002]
          Length = 243

 Score = 88.8 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 33/206 (16%), Positives = 62/206 (30%), Gaps = 25/206 (12%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE--------------------DA 58
            AI               ++       + + +GTF+Q+                      
Sbjct: 31  VAIGASLLVASHAFASGTEQLKAFVSQVHSARGTFVQQEVRAPSKAQGASGALSTANPTK 90

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFS 114
                G F  ARP KF ++Y  P S  L +DG  + VY+  L+  +V  L         +
Sbjct: 91  PTTSSGTFMFARPGKFIWQYEKPYSQLLQADGDKLFVYDKDLNQVTVRALGNALGASPAA 150

Query: 115 VIFSNNQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
           ++F +N      +++                        V        L   ++ D    
Sbjct: 151 ILFGSNDLDKNFTLRDAGVKAGIDWLELTPKAKDTQFERVGIGFKDGNLEAMELHDVFGN 210

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            +++     ++N  L    F+    K
Sbjct: 211 VTLLTFSNIQKNPQLPSDAFKFTVPK 236


>gi|209520406|ref|ZP_03269168.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           H160]
 gi|209499143|gb|EDZ99236.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           H160]
          Length = 240

 Score = 88.8 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 32/206 (15%), Positives = 62/206 (30%), Gaps = 25/206 (12%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ--------------------EDA 58
            A+               ++       + + +GTF+Q                       
Sbjct: 28  VAVGASLLVASHAFASGTEQLKAFVAQVHSARGTFVQQEVRAPNKAQGASDALSTANVGK 87

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFS 114
                G F  ARP KF ++Y  P +  L +DG  + VY+  L+  +V  L         +
Sbjct: 88  PTTSSGTFMFARPGKFIWQYEKPYAQLLQADGDKLYVYDKDLNQVTVRALGNALGASPAA 147

Query: 115 VIFSNNQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
           ++F +N      +++                        V        L   ++ D    
Sbjct: 148 ILFGSNDLDKNFTLRDAGVKAGIDWLELTPKAKDTQFERVGIGFKDGNLEAMELHDVFGN 207

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            +++     ++N  L P  F+    K
Sbjct: 208 VTLLTFSNIQKNPQLPPDAFKFTVPK 233


>gi|302185004|ref|ZP_07261677.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. syringae 642]
 gi|330954582|gb|EGH54842.1| lipoprotein chaperone [Pseudomonas syringae Cit 7]
 gi|330981391|gb|EGH79494.1| lipoprotein chaperone [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 207

 Score = 88.8 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 27/198 (13%), Positives = 64/198 (32%), Gaps = 11/198 (5%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEF 66
           +I    +    F+        + V +  +     QT+   F Q              GE 
Sbjct: 3   LIRMLLATALTFSMIPAHADSKDVARLTQLLEKSQTLTARFSQLTLDGGGTQLQETTGEM 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQH 122
            + RP  F +   +P    ++SDG  +++++  L+  +       L      ++  +   
Sbjct: 63  ALQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTPALLLSGDVSK 122

Query: 123 VIQESIQRVESNNSFI-TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           + +      +     I  +           S+     +  + + +++DS  + + I    
Sbjct: 123 ISESFDITAKEAGGVIDFVLKPKTKDTLFDSLRLSFRNGIINDMQLIDSVGQRTNILFTG 182

Query: 182 YKENTVLDPKVFEIPYDK 199
            K N  +    F+    K
Sbjct: 183 VKANESIAASKFQFQIPK 200


>gi|194288877|ref|YP_002004784.1| outer-membrane lipoprotein carrier protein [Cupriavidus taiwanensis
           LMG 19424]
 gi|229485826|sp|B3R334|LOLA_CUPTR RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|193222712|emb|CAQ68715.1| putative periplasmic outer membrane lipoprotein carrier protein
           [Cupriavidus taiwanensis LMG 19424]
          Length = 211

 Score = 88.8 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 30/200 (15%), Positives = 66/200 (33%), Gaps = 14/200 (7%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGY--------VMKG 64
           IL    A     A        +  +       +++ +G F Q +  G            G
Sbjct: 5   ILVSACAALAMFAMQAPAHAAATDQLQSFVTGVKSARGEFTQRQVKGQGANVKVTGTSSG 64

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNN 120
            F  +RP KF ++Y+ P    L +DG  + +Y+  L+  +   L         +++F +N
Sbjct: 65  TFVFSRPGKFTWRYTKPYEQLLQADGQTLYIYDKDLNQVTERKLDGALGSSPAAILFGSN 124

Query: 121 QHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
                  ++   + +    +             +     +  L   ++ D+    +++  
Sbjct: 125 DLDKNFVVRNGPTRDGVEWLELTPKAKDTQFERIGIGFKAGNLEAMELRDAFGNTTLLTF 184

Query: 180 LKYKENTVLDPKVFEIPYDK 199
              ++N  L    F     K
Sbjct: 185 TGMQKNPPLAADAFRFTVPK 204


>gi|332285170|ref|YP_004417081.1| outer-membrane lipoprotein carrier protein [Pusillimonas sp. T7-7]
 gi|330429123|gb|AEC20457.1| outer-membrane lipoprotein carrier protein [Pusillimonas sp. T7-7]
          Length = 211

 Score = 88.8 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 29/204 (14%), Positives = 59/204 (28%), Gaps = 13/204 (6%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM--- 62
            KS  G         +     A         ++  +    +++  G F Q+         
Sbjct: 1   MKSNFGFKQFVTTIVLAVSPLAAWSVPA--PEQLEQFIAQVKSATGDFTQQRLDQNSQGR 58

Query: 63  ---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSV 115
               G+F   RP +F +    P    +ISDG  +  Y+  L   +   +         ++
Sbjct: 59  PAQSGQFSFKRPGQFKWAVVKPYEQLIISDGKRVYQYDPDLAQVTERGVDQSIGASPAAI 118

Query: 116 IFSNNQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +F +       +I  + S +                  V     +      +++DS  + 
Sbjct: 119 LFGSGSLEEAFTISSLPSKDGLDWLRAQPRSADAGFTHVDIGFKNAMPARLELLDSFGQT 178

Query: 175 SIIKILKYKENTVLDPKVFEIPYD 198
           + I +     N  L    F     
Sbjct: 179 TRIDLSNIVANPTLGADEFSFTPP 202


>gi|161484694|ref|NP_778894.2| outer-membrane lipoprotein carrier protein [Xylella fastidiosa
           Temecula1]
          Length = 208

 Score = 88.8 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 26/201 (12%), Positives = 65/201 (32%), Gaps = 14/201 (6%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMAR 70
           F    F            +          ++T+QG F QE             G   ++ 
Sbjct: 5   FRYIFFAVALLSGPVCAGARADLSAFTRGLKTLQGHFSQEVIDTQGRVKERSNGTVALSL 64

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW----SVYPLRYMAFSVIFSNNQHVIQE 126
           P+   ++  +P    +++DG  + +++  L+           R      +    Q   + 
Sbjct: 65  PNLLRWECDAPYKQLVVADGKRVWLFDPDLNQASVLLQDNEERNSPLIALIDPIQLDRKY 124

Query: 127 SIQRV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
            +           ++++  +     +  S +F     +L   +++D+  + ++I    ++
Sbjct: 125 DVSEEVAMRDGLRWLSLRPRGSTEASFQSASFGFSQTQLARMELVDNLGQRTVIAFSGWQ 184

Query: 184 ENTVLDPKVFEI-PYDKIHNI 203
            N V     F   P   +  I
Sbjct: 185 RNPVFAVNTFRFTPGKNVDVI 205


>gi|115350890|ref|YP_772729.1| outer-membrane lipoprotein carrier protein [Burkholderia ambifaria
           AMMD]
 gi|115280878|gb|ABI86395.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           ambifaria AMMD]
          Length = 229

 Score = 88.8 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 31/206 (15%), Positives = 56/206 (27%), Gaps = 21/206 (10%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED----------------A 58
           L    A      A         ++       +++ +G F Q+                  
Sbjct: 17  LGAALAGASLMLAATHAFASGTEQLKAFVSQVRSAKGEFTQQIVKAPSKGASAAQAAPKP 76

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAF 113
                G F  +RP KF + Y  P    L +DG  + VY+  L+  +   L        A 
Sbjct: 77  NDNSSGTFVFSRPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLNGALGASPAA 136

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
            +  SN+           E                    +     +  L   ++ D    
Sbjct: 137 ILFGSNDLDKNYTLRDAGEKGGIDWLEMLPKAQDTQFQRIGIGFRNGTLAAMELHDVFGN 196

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            +++     + N  L    F+    K
Sbjct: 197 VTLLTFTNIQTNPPLRGDTFKFVVPK 222


>gi|169794924|ref|YP_001712717.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii AYE]
 gi|213157671|ref|YP_002320469.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii AB0057]
 gi|215482470|ref|YP_002324656.1| outer membrane lipocarrier protein LolA [Acinetobacter baumannii
           AB307-0294]
 gi|239502307|ref|ZP_04661617.1| outer membrane lipocarrier protein LolA [Acinetobacter baumannii
           AB900]
 gi|301344902|ref|ZP_07225643.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii AB056]
 gi|301511073|ref|ZP_07236310.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii AB058]
 gi|301595148|ref|ZP_07240156.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii AB059]
 gi|332854212|ref|ZP_08435232.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii 6013150]
 gi|332866346|ref|ZP_08436951.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii 6013113]
 gi|332872561|ref|ZP_08440530.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii 6014059]
 gi|169147851|emb|CAM85714.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii AYE]
 gi|193078191|gb|ABO13142.2| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii ATCC 17978]
 gi|213056831|gb|ACJ41733.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii AB0057]
 gi|213986802|gb|ACJ57101.1| outer membrane lipocarrier protein LolA [Acinetobacter baumannii
           AB307-0294]
 gi|322509212|gb|ADX04666.1| Outer membrane lipoproteins carrier protein [Acinetobacter
           baumannii 1656-2]
 gi|323519241|gb|ADX93622.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii TCDC-AB0715]
 gi|332728137|gb|EGJ59525.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii 6013150]
 gi|332734694|gb|EGJ65798.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii 6013113]
 gi|332739247|gb|EGJ70105.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii 6014059]
          Length = 231

 Score = 88.8 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 34/222 (15%), Positives = 72/222 (32%), Gaps = 26/222 (11%)

Query: 4   LLYKSVIGVVILFFYSA----IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA- 58
           +L K++  + +     A       F A     + Q++   +     +Q +   F Q    
Sbjct: 3   MLRKTMCAITLSASVLAPVMSTTAFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKA 62

Query: 59  ----------------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT 102
                               KG   + RP KFY++  SPS  ++++ G  + +Y+  L  
Sbjct: 63  NTKTVAQKKGLSAQHMNQTFKGSMKVERPGKFYWETVSPSKQTIVTSGKTVWIYDPDLQQ 122

Query: 103 W-----SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDR 157
                         A  +  + NQ +    + + + +  + T+F K +            
Sbjct: 123 AVRQSLDDQVADTPALLLSGNTNQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFG 182

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            +       + DS  + + ++    K N  +    F     K
Sbjct: 183 ANKAPTLMVLQDSLGQTTYVRFKNVKVNASIPASTFNFTPPK 224


>gi|28870512|ref|NP_793131.1| outer membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213970052|ref|ZP_03398184.1| outer membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. tomato T1]
 gi|301381408|ref|ZP_07229826.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. tomato Max13]
 gi|302058406|ref|ZP_07249947.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. tomato K40]
 gi|302130345|ref|ZP_07256335.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. tomato NCPPB 1108]
 gi|47117213|sp|Q87ZS6|LOLA_PSESM RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|28853760|gb|AAO56826.1| outer membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213925156|gb|EEB58719.1| outer membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. tomato T1]
 gi|331017253|gb|EGH97309.1| lipoprotein chaperone [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 207

 Score = 88.8 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 27/198 (13%), Positives = 64/198 (32%), Gaps = 11/198 (5%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEF 66
           +I    +    F+        + V +  +     QT+   F Q              GE 
Sbjct: 3   LIRMLLATALTFSVIPAHADGKDVARLTQLLEKSQTLTARFSQLTLDGGGTQLQETTGEM 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQH 122
            + RP  F +   +P    ++SDG  +++++  L+  +       L      ++  +   
Sbjct: 63  ALQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTPALLLSGDVSK 122

Query: 123 VIQESIQRVESNNSFI-TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           + +      +     I  +           S+     +  + + +++DS  + + I    
Sbjct: 123 ISESFDITAKEAGGVIDFMLKPKTKDTLFDSLRLSFRNGIINDMQLIDSVGQRTNILFTG 182

Query: 182 YKENTVLDPKVFEIPYDK 199
            K N  +    F+    K
Sbjct: 183 VKANESIAASKFQFQIPK 200


>gi|134094253|ref|YP_001099328.1| outer-membrane lipoprotein carrier protein [Herminiimonas
           arsenicoxydans]
 gi|133738156|emb|CAL61201.1| Outer-membrane lipoprotein carrier protein precursor [Herminiimonas
           arsenicoxydans]
          Length = 225

 Score = 88.4 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 35/210 (16%), Positives = 72/210 (34%), Gaps = 14/210 (6%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-------- 55
           L  K++   + LF    +             ++ +      S Q+ +G F Q        
Sbjct: 10  LTAKTIDLRIALFATVLVAGALLLTAQAHAAALDQFKSFVSSTQSARGEFTQQLVKVDSG 69

Query: 56  -EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----Y 110
                    G F  ARP KF + Y  P    L +DG  + +Y+  L+  ++  L      
Sbjct: 70  TTKVSNKSTGTFTFARPGKFIWTYQKPYEQLLQADGEKLYIYDKDLNQVTIKKLGDALGS 129

Query: 111 MAFSVIFSNNQHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDRLSYRLLNWKIMD 169
              +++F +N      +++   + N    +             +     +      ++ D
Sbjct: 130 SPAAILFGSNDLEKNFTLKEAGTKNGLEWLEATPKAKDTTFDHIGIGLRNGAPEAMELRD 189

Query: 170 SSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           S  + S++   K+++N  L    F+    K
Sbjct: 190 SFGQVSLLSFTKFEKNPPLPANQFKFAVPK 219


>gi|78485110|ref|YP_391035.1| outer membrane lipoprotein carrier protein LolA [Thiomicrospira
           crunogena XCL-2]
 gi|78363396|gb|ABB41361.1| outer membrane lipoprotein carrier protein LolA [Thiomicrospira
           crunogena XCL-2]
          Length = 217

 Score = 88.4 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 31/204 (15%), Positives = 66/204 (32%), Gaps = 13/204 (6%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----- 60
            K ++  +++    A    ++A    K   +        ++ T    F Q          
Sbjct: 7   IKKIMSGLVMVCVLASPVLSSASDRAK---LSDLNAFVANLNTFSAKFEQTQPDESLFAM 63

Query: 61  -VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSV 115
               G F M RP +  + Y  P    +ISDG N+ VY+  LD  +V  L  +      S 
Sbjct: 64  NRSTGYFSMKRPGQLLWVYEKPEPQKIISDGRNVWVYDVDLDQATVRALANVEADFPLSW 123

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           +        + +I      +                S+       +++   +  ++   +
Sbjct: 124 LLYKEPLSERFNIIPGSIKDGVSWYNLTPKEGTFFQSLEVAIADGKMVQIWMYQNADNVT 183

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
            +     ++N  +  + F+    K
Sbjct: 184 KVVFNDIRQNQPVRDQQFDFQPPK 207


>gi|9106472|gb|AAF84261.1|AE003975_4 chaperone [Xylella fastidiosa 9a5c]
          Length = 214

 Score = 88.4 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 27/217 (12%), Positives = 73/217 (33%), Gaps = 20/217 (9%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG- 59
           M +++   +        ++            +             ++T+QG F QE    
Sbjct: 1   MIWMM--PMFSRFRYIVFTVALLSGPVCAGPRAD----LSAFTRGLKTLQGHFSQEIIDT 54

Query: 60  -----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV----YPLRY 110
                    G   ++ P+   ++  +P    +++DG  + +++  L+  SV       R 
Sbjct: 55  QGRVKERSNGTVALSLPNLLRWECDAPYKQLVVADGKRVWLFDPDLNQASVRLQGNEERN 114

Query: 111 MAFSVIFSNNQHVIQESIQRV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKI 167
                +    Q  ++  +           ++++  +     +  S +F     +L   ++
Sbjct: 115 SPLIALIDPIQLDLKYDVSEEVAMRDGLRWLSLRPRVGIEASFQSASFGFAQTQLARMEL 174

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVFEI-PYDKIHNI 203
           +D+  + ++I    ++ N V     F   P   +  I
Sbjct: 175 VDNLGQRTVIVFSGWQRNPVFAVDTFRFTPGKNVDVI 211


>gi|254427179|ref|ZP_05040886.1| outer membrane lipoprotein carrier protein LolA [Alcanivorax sp.
           DG881]
 gi|196193348|gb|EDX88307.1| outer membrane lipoprotein carrier protein LolA [Alcanivorax sp.
           DG881]
          Length = 207

 Score = 88.4 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 28/195 (14%), Positives = 59/195 (30%), Gaps = 12/195 (6%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------VMKGEFFMAR 70
              ++ P           +    ++   ++++M+G F Q              G F +AR
Sbjct: 4   LLLSLAPAVLLASTAWAGATDDLLDRLQTLKSMKGQFEQVVLDQGGTHMQEATGRFQVAR 63

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSVIFSNNQHVIQE 126
            ++FY+   +P      SDG  + VY+  L+   V PL          +       V + 
Sbjct: 64  GNQFYWLTETPYEQMAASDGETVWVYDKDLEQVVVRPLSQDLGQTPALLFGGKPADVAKA 123

Query: 127 SIQRVESNNS--FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
                  N                    +          + ++ D+  + ++I       
Sbjct: 124 FSISERDNQGSEVTYRLTPKGQDPLFDQLDVTFKGDEPASMRLQDALGQQTVIDFKSLTL 183

Query: 185 NTVLDPKVFEIPYDK 199
           N  +D  +F     +
Sbjct: 184 NGGIDSDLFHFEPPE 198


>gi|330826247|ref|YP_004389550.1| outer-membrane lipoprotein carrier protein [Alicycliphilus
           denitrificans K601]
 gi|329311619|gb|AEB86034.1| Outer-membrane lipoprotein carrier protein [Alicycliphilus
           denitrificans K601]
          Length = 210

 Score = 88.4 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 33/211 (15%), Positives = 65/211 (30%), Gaps = 27/211 (12%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA------- 58
            K  I  +++           +        +K   +   +  + +  F Q          
Sbjct: 1   MKKPIAAILI---------AVSAQWASADGLKSLEQFMAAAHSGRADFTQTVTAPAKDGQ 51

Query: 59  ---GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----M 111
                +  G F   RP +F F Y  P   ++++DG  + +Y+A L+  +  P        
Sbjct: 52  AQRPKLSSGSFEFQRPGRFKFVYKKPFEQTIVADGKTLWLYDADLNQVTERPQAQALGST 111

Query: 112 AFSVIFSNNQHV----IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKI 167
             +++ S           +     E +     +       G + SV       RL    I
Sbjct: 112 PAALLTSAPDLAALRADYQLQSAPEQDGLQWVLATPKASEGQLKSVRVGFEGDRLAALDI 171

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           +D   + S I+    + N  L    F+    
Sbjct: 172 VDGFGQRSQIRFSGMQINPALPAGTFQFKPP 202


>gi|169632600|ref|YP_001706336.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii SDF]
 gi|169151392|emb|CAP00117.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii]
          Length = 231

 Score = 88.4 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 34/222 (15%), Positives = 72/222 (32%), Gaps = 26/222 (11%)

Query: 4   LLYKSVIGVVILFFYSA----IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA- 58
           +L K++  + +     A       F A     + Q++   +     +Q +   F Q    
Sbjct: 3   MLRKTMCAITLSASVLAPVMSTTAFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKA 62

Query: 59  ----------------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT 102
                               KG   + RP KFY++  SPS  ++++ G  + +Y+  L  
Sbjct: 63  NTKTVVQKKGLSAQHMNQTFKGSMKVERPGKFYWETVSPSKQTIVTSGKTVWIYDPDLQQ 122

Query: 103 W-----SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDR 157
                         A  +  + NQ +    + + + +  + T+F K +            
Sbjct: 123 AVRQSLDDQVADTPALLLSGNTNQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFG 182

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            +       + DS  + + ++    K N  +    F     K
Sbjct: 183 ANKAPTLMVLQDSLGQTTYVRFKNVKVNASIPASTFNFTPPK 224


>gi|262281250|ref|ZP_06059032.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           calcoaceticus RUH2202]
 gi|262257481|gb|EEY76217.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           calcoaceticus RUH2202]
          Length = 231

 Score = 88.4 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 35/222 (15%), Positives = 73/222 (32%), Gaps = 26/222 (11%)

Query: 4   LLYKSVIGVVILFFYSA----IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA- 58
           +L K++  + +     A       F A     + Q++   +     +Q +   F Q    
Sbjct: 3   MLRKTMCAITLSASVLAPVMSTTVFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKA 62

Query: 59  ----------------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT 102
                               KG   + RP KFY++  SPS  ++++ G  + +Y+  L  
Sbjct: 63  NTKTVAQKKSLSAQHMNQTFKGSMKVERPGKFYWETVSPSKQTIVTSGKTVWIYDPDLQQ 122

Query: 103 W-----SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDR 157
                         A  +  + NQ +    + + + +  + T+F K +            
Sbjct: 123 AVRQSLDDQVADTPALLLSGNTNQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFG 182

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            +       + DS  + + ++    K N  +   VF     K
Sbjct: 183 ANKAPTLMVLQDSLGQTTYVRFKNVKVNASIPASVFNFTPPK 224


>gi|187479167|ref|YP_787192.1| outer-membrane lipoprotein carrier protein [Bordetella avium 197N]
 gi|123738543|sp|Q2KWE1|LOLA_BORA1 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|115423754|emb|CAJ50305.1| outer-membrane lipoprotein carrier protein [Bordetella avium 197N]
          Length = 209

 Score = 88.4 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 26/173 (15%), Positives = 55/173 (31%), Gaps = 11/173 (6%)

Query: 37  KKAIEHFLSIQTMQGTFLQEDAGYVM------KGEFFMARPSKFYFKYSSPSSVSLISDG 90
            +       +Q+  G F Q   G          G F   RP KF +  + P    +ISDG
Sbjct: 29  DQLKAFVAKVQSATGDFTQSTVGPQGRTQPAQSGSFAFQRPGKFKWAVARPYEQLVISDG 88

Query: 91  SNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDF 146
             +  Y+  L   +   +         +++F +        +  +   +    +  K   
Sbjct: 89  KQVYQYDPDLAQVTERKVDQAIGTSPAAILFGSGDLDKAFHVSPLPDRDGLQWLRAKPRN 148

Query: 147 MGNMISVTFDRLSYRL-LNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                S     ++  L    +++D+  + + + +   + N  L    F     
Sbjct: 149 ADAGFSQVDIAMNGDLPARVELLDAFGQTTRVDLSNIQANPKLPAAEFHFTAP 201


>gi|119470157|ref|ZP_01612923.1| putative periplasmic chaperone effects translocation of
           lipoproteins from inner membrane to outer membrane
           [Alteromonadales bacterium TW-7]
 gi|119446578|gb|EAW27852.1| putative periplasmic chaperone effects translocation of
           lipoproteins from inner membrane to outer membrane
           [Alteromonadales bacterium TW-7]
          Length = 208

 Score = 88.4 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 26/204 (12%), Positives = 67/204 (32%), Gaps = 17/204 (8%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM--- 62
            K +  ++++       P             +   +   ++++ +  F Q+         
Sbjct: 1   MKKLNSLLLVLSGLIAAPSF-------ADDSQALQDKLATLKSFKAQFAQKVTDKEGQAV 53

Query: 63  ---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN----AKLDTWSVYPLRYMAFSV 115
              +G   + +P    ++ ++P     +S+G     ++          +   +    F +
Sbjct: 54  MQGEGTIALKQPMMIRWEQTNPDDTLFVSNGDKTYYFDSFAEQVTIMNTHSLIDSTPFVL 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           + S +    ++   +   +   +T     +     + +TF      L    + D+S + S
Sbjct: 114 LTSKDPAQWEKYSVQATDSGYSVTPNKGVESQVEQLDITFVDNQAGLAKLVVTDNSGQLS 173

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
                  K NT LD  VFE    +
Sbjct: 174 SFTFNDAKVNTELDATVFEFTPPE 197


>gi|296162239|ref|ZP_06845034.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           Ch1-1]
 gi|295887506|gb|EFG67329.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           Ch1-1]
          Length = 244

 Score = 88.4 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 34/206 (16%), Positives = 58/206 (28%), Gaps = 25/206 (12%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------------------EDAGY 60
            AI               ++       + + +GTF+Q                    AG 
Sbjct: 32  VAIGASVLFASQAFASGTEQLKAFVAQVHSARGTFVQQEVRAPSKAQGASGTLSTTGAGK 91

Query: 61  V--MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAF 113
                G F  ARP KF ++Y  P +  L +DG  + VY+  L+  +V           A 
Sbjct: 92  TGTSSGTFTFARPGKFIWQYEKPYAQLLQADGDKLFVYDKDLNQVTVRSLGGALGASPAA 151

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
            +  SN+                                V        L   ++ D    
Sbjct: 152 ILFGSNDLDRNFTLRDAGVKAGIDWLELTPKAKDTQFQRVGIGFKDGNLEAMELHDVFGN 211

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            +++     ++N  L    F+    K
Sbjct: 212 VTLLTFSNIQKNPPLPADAFKFTVPK 237


>gi|113866782|ref|YP_725271.1| outer-membrane lipoprotein carrier protein [Ralstonia eutropha H16]
 gi|123329507|sp|Q0KDL8|LOLA_RALEH RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|113525558|emb|CAJ91903.1| outer membrane lipoprotein-sorting protein [Ralstonia eutropha H16]
          Length = 211

 Score = 88.0 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 29/200 (14%), Positives = 65/200 (32%), Gaps = 14/200 (7%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGY---VMKG 64
           I+    A     A        +  +       +++ +G F Q         G       G
Sbjct: 5   IIVSACAALAMFAIQAPAHAAATDQLQSFVTGVKSARGEFTQRQVKGQGANGKVTGTSSG 64

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNN 120
            F  +RP KF ++Y+ P    L +DG  + +Y+  L+  +   L         +++F +N
Sbjct: 65  TFVFSRPGKFTWRYTKPYDQLLQADGQTLYIYDKDLNQVTERKLDGALGSSPAAILFGSN 124

Query: 121 QHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
                  ++   + +    +             +     +  L   ++ D+    +++  
Sbjct: 125 DLEKNFVVKNGPTRDGVEWLELTPKAKDTQFERIGIGFKAGNLEAMELRDAFGNTTLLTF 184

Query: 180 LKYKENTVLDPKVFEIPYDK 199
              ++N  L    F     K
Sbjct: 185 TGMQKNPPLAADAFRFTVPK 204


>gi|66046407|ref|YP_236248.1| outer-membrane lipoprotein carrier protein [Pseudomonas syringae
           pv. syringae B728a]
 gi|9910773|sp|Q9Z3U0|LOLA_PSEU2 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|4063381|gb|AAC98299.1| periplasmic chaperone protein [Pseudomonas syringae pv. syringae]
 gi|63257114|gb|AAY38210.1| Outer membrane lipoprotein carrier protein LolA [Pseudomonas
           syringae pv. syringae B728a]
 gi|330972889|gb|EGH72955.1| lipoprotein chaperone [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 207

 Score = 88.0 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 27/198 (13%), Positives = 63/198 (31%), Gaps = 11/198 (5%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEF 66
           +I    +    F+        + V +  +     QT+   F Q              GE 
Sbjct: 3   LIRMLLATALTFSMIPAHADSKDVARLTQLLEKSQTLTARFSQLTLDGGGTQLQETTGEM 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQH 122
            + RP  F +   +P    ++SDG  +++++  L+  +       L      ++  +   
Sbjct: 63  ALQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTPALLLSGDVSK 122

Query: 123 VIQESIQRVESNNSFI-TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           + +      +     I              S+     +  + + +++DS  + + I    
Sbjct: 123 ISESFDITAKEAGGVIDFTLKPKTKDTLFDSLRLSFRNGIINDMQLIDSVGQRTNILFTG 182

Query: 182 YKENTVLDPKVFEIPYDK 199
            K N  +    F+    K
Sbjct: 183 VKANESIAASKFQFQIPK 200


>gi|32129707|sp|Q87DL0|LOLA_XYLFT RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
          Length = 210

 Score = 88.0 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 26/201 (12%), Positives = 65/201 (32%), Gaps = 14/201 (6%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMAR 70
           F    F            +          ++T+QG F QE             G   ++ 
Sbjct: 7   FRYIFFAVALLSGPVCAGARADLSAFTRGLKTLQGHFSQEVIDTQGRVKERSNGTVALSL 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW----SVYPLRYMAFSVIFSNNQHVIQE 126
           P+   ++  +P    +++DG  + +++  L+           R      +    Q   + 
Sbjct: 67  PNLLRWECDAPYKQLVVADGKRVWLFDPDLNQASVLLQDNEERNSPLIALIDPIQLDRKY 126

Query: 127 SIQRV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
            +           ++++  +     +  S +F     +L   +++D+  + ++I    ++
Sbjct: 127 DVSEEVAMRDGLRWLSLRPRGSTEASFQSASFGFSQTQLARMELVDNLGQRTVIAFSGWQ 186

Query: 184 ENTVLDPKVFEI-PYDKIHNI 203
            N V     F   P   +  I
Sbjct: 187 RNPVFAVNTFRFTPGKNVDVI 207


>gi|91782390|ref|YP_557596.1| outer-membrane lipoprotein carrier protein [Burkholderia xenovorans
           LB400]
 gi|91686344|gb|ABE29544.1| Putative outer membrane lipoprotein carrier protein [Burkholderia
           xenovorans LB400]
          Length = 244

 Score = 88.0 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 34/206 (16%), Positives = 58/206 (28%), Gaps = 25/206 (12%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------------------EDAGY 60
            AI               ++       + + +GTF+Q                    AG 
Sbjct: 32  VAIGASVLFASQAFASGTEQLKAFVAQVHSARGTFVQQEVRAPSKAQGASGTLSTTGAGK 91

Query: 61  V--MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAF 113
                G F  ARP KF ++Y  P +  L +DG  + VY+  L+  +V           A 
Sbjct: 92  TGTSSGTFTFARPGKFIWQYEKPYAQLLQADGDKLFVYDKDLNQVTVRSLGGALGASPAA 151

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
            +  SN+                                V        L   ++ D    
Sbjct: 152 ILFGSNDLDKNFTLRDAGVKAGIDWLELTPKAKDTQFQRVGIGFKDGNLEAMELHDVFGN 211

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            +++     ++N  L    F+    K
Sbjct: 212 VTLLTFSNIQKNPPLPADAFKFTVPK 237


>gi|217970179|ref|YP_002355413.1| outer membrane lipoprotein carrier protein LolA [Thauera sp. MZ1T]
 gi|217507506|gb|ACK54517.1| outer membrane lipoprotein carrier protein LolA [Thauera sp. MZ1T]
          Length = 219

 Score = 88.0 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 25/173 (14%), Positives = 58/173 (33%), Gaps = 11/173 (6%)

Query: 37  KKAIEHFLSIQTMQGTFLQEDA------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           ++  +     ++ +G F Q              G F  ARP +F+++Y  P    L+ DG
Sbjct: 34  QQLRDFVTGARSAEGEFEQVVTAQSGRRPQEASGSFAYARPGRFHWEYDRPYRQVLVGDG 93

Query: 91  SNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSF-ITIFFKDD 145
             +  ++  L+  +V  +         +++F +        +      +           
Sbjct: 94  KTLWSWDPDLNQVTVRAIGEALGATPAAILFGSGALDDNFELADAGERDGLAWAEARPKR 153

Query: 146 FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                 S+       +L   ++ D   + ++I+  + + N VL    F     
Sbjct: 154 TESGFESLRIGLAEGQLRRMEMRDHFGQTTVIRFTRLRANPVLAEDRFRFEPP 206


>gi|126728546|ref|ZP_01744362.1| outer membrane lipoprotein carrier protein LolA, putative
           [Sagittula stellata E-37]
 gi|126711511|gb|EBA10561.1| outer membrane lipoprotein carrier protein LolA, putative
           [Sagittula stellata E-37]
          Length = 222

 Score = 88.0 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 65/173 (37%), Gaps = 6/173 (3%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISD 89
            +  S+ +   +  ++QT++  F Q    G +  G   + RP K  F Y+ P    ++  
Sbjct: 48  AQQLSLNEISRYLNTLQTVKSPFTQINSDGTISTGTISIKRPGKARFDYNPPERGLVLVS 107

Query: 90  GSNIAVYNAKLD-TWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNS---FITIFFKDD 145
             ++ + + KL      YPL     S+I + N ++ Q  +    S +     +T      
Sbjct: 108 SGSVYILDRKLGGMPETYPLEQTPLSIILARNVNLGQAGMVTGHSFDGTATVVTAQDPRR 167

Query: 146 FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                I + F      L  W I D     + + +   ++ T +    F I  +
Sbjct: 168 PEYGNIQLKFTANPTELRQWIITDGDGVKTTVVLGGLQK-TSIPTSQFLIDTE 219


>gi|161378168|ref|NP_298741.2| outer-membrane lipoprotein carrier protein [Xylella fastidiosa
           9a5c]
          Length = 208

 Score = 88.0 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 28/201 (13%), Positives = 68/201 (33%), Gaps = 14/201 (6%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMAR 70
           F   +F                       ++T+QG F QE             G   ++ 
Sbjct: 5   FRYIVFTVALLSGPVCAGPRADLSAFTRGLKTLQGHFSQEIIDTQGRVKERSNGTVALSL 64

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQE 126
           P+   ++  +P    +++DG  + +++  L+  SV       R      +    Q  ++ 
Sbjct: 65  PNLLRWECDAPYKQLVVADGKRVWLFDPDLNQASVRLQGNEERNSPLIALIDPIQLDLKY 124

Query: 127 SIQRV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
            +           ++++  +     +  S +F     +L   +++D+  + ++I    ++
Sbjct: 125 DVSEEVAMRDGLRWLSLRPRVGIEASFQSASFGFAQTQLARMELVDNLGQRTVIVFSGWQ 184

Query: 184 ENTVLDPKVFEI-PYDKIHNI 203
            N V     F   P   +  I
Sbjct: 185 RNPVFAVDTFRFTPGKNVDVI 205


>gi|299768959|ref|YP_003730985.1| outer-membrane lipoproteins carrier protein [Acinetobacter sp. DR1]
 gi|298699047|gb|ADI89612.1| outer-membrane lipoproteins carrier protein [Acinetobacter sp. DR1]
          Length = 231

 Score = 88.0 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 34/222 (15%), Positives = 73/222 (32%), Gaps = 26/222 (11%)

Query: 4   LLYKSVIGVVILFFYSA----IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA- 58
           +L K++  + +     A       F A     + Q++   +     +Q +   F Q    
Sbjct: 3   MLRKTMCAITLSASVLAPVMSTTVFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKA 62

Query: 59  ----------------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT 102
                               KG   + RP KFY++  SP+  ++++ G  + +Y+  L  
Sbjct: 63  NTKTVAQKKSLSAQHMNQTFKGSMKVERPGKFYWETVSPAKQTIVTSGKTVWIYDPDLQQ 122

Query: 103 W-----SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDR 157
                         A  +  + NQ +    + + + +  + T+F K +            
Sbjct: 123 AVRQSLDDQVADTPALLLSGNTNQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFG 182

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            +       + DS  + + ++    K N  +   VF     K
Sbjct: 183 ANKAPTLMVLQDSLGQTTYVRFKNVKVNASIPASVFNFTPPK 224


>gi|293610925|ref|ZP_06693224.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826577|gb|EFF84943.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 231

 Score = 88.0 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 34/222 (15%), Positives = 73/222 (32%), Gaps = 26/222 (11%)

Query: 4   LLYKSVIGVVILFFYSA----IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA- 58
           +L K++  + +     A       F A     + Q++   +     +Q +   F Q    
Sbjct: 3   MLRKTMCAITLSASVLAPVMSTTVFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKA 62

Query: 59  ----------------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT 102
                               KG   + RP KFY++  SP+  ++++ G  + +Y+  L  
Sbjct: 63  NTKTVAQKKSLSAQHMNQTFKGSMKVERPGKFYWETVSPAKQTIVTSGKTVWIYDPDLQQ 122

Query: 103 W-----SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDR 157
                         A  +  + NQ +    + + + +  + T+F K +            
Sbjct: 123 AVRQNLDDQVADTPALLLSGNTNQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFG 182

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            +       + DS  + + ++    K N  +   VF     K
Sbjct: 183 ANKAPTLMVLQDSLGQTTYVRFKNVKVNASIPASVFNFTPPK 224


>gi|294788015|ref|ZP_06753259.1| outer membrane lipoprotein carrier protein LolA [Simonsiella
           muelleri ATCC 29453]
 gi|294484308|gb|EFG31991.1| outer membrane lipoprotein carrier protein LolA [Simonsiella
           muelleri ATCC 29453]
          Length = 205

 Score = 88.0 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 25/191 (13%), Positives = 51/191 (26%), Gaps = 9/191 (4%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED----AGYVMKGEFFMARPSK 73
            S +             ++    +       + G F Q            G F + RP  
Sbjct: 8   LSVLLTATFLSSTAHAGAIDALKKFNQDADGLSGNFTQTVQSKKKNQTSSGTFQILRPGL 67

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFSNNQHVIQESI 128
           F + Y SP   +++ DG+NI +Y+  L   +               +   +         
Sbjct: 68  FKWDYKSPYKQTIVGDGANIWLYDVDLKQVTKSNQDQTIGDSPAAILSNKSALDASYMLK 127

Query: 129 QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
           +   S +    +            +       +L   ++ D     + I+         L
Sbjct: 128 EDGTSGDIQYVLATPKRANAGYQYIRIGFQGDKLAAMQLKDGFGNQTSIRFNGVNTKPNL 187

Query: 189 DPKVFEIPYDK 199
               F+    K
Sbjct: 188 SRGAFKFVVPK 198


>gi|9977696|sp|Q9PDC7|LOLA_XYLFA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
          Length = 210

 Score = 87.6 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 28/201 (13%), Positives = 68/201 (33%), Gaps = 14/201 (6%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMAR 70
           F   +F                       ++T+QG F QE             G   ++ 
Sbjct: 7   FRYIVFTVALLSGPVCAGPRADLSAFTRGLKTLQGHFSQEIIDTQGRVKERSNGTVALSL 66

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQE 126
           P+   ++  +P    +++DG  + +++  L+  SV       R      +    Q  ++ 
Sbjct: 67  PNLLRWECDAPYKQLVVADGKRVWLFDPDLNQASVRLQGNEERNSPLIALIDPIQLDLKY 126

Query: 127 SIQRV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
            +           ++++  +     +  S +F     +L   +++D+  + ++I    ++
Sbjct: 127 DVSEEVAMRDGLRWLSLRPRVGIEASFQSASFGFAQTQLARMELVDNLGQRTVIVFSGWQ 186

Query: 184 ENTVLDPKVFEI-PYDKIHNI 203
            N V     F   P   +  I
Sbjct: 187 RNPVFAVDTFRFTPGKNVDVI 207


>gi|83718722|ref|YP_442106.1| outer-membrane lipoprotein carrier protein [Burkholderia
           thailandensis E264]
 gi|167580958|ref|ZP_02373832.1| outer-membrane lipoprotein carrier protein [Burkholderia
           thailandensis TXDOH]
 gi|257138291|ref|ZP_05586553.1| outer-membrane lipoprotein carrier protein [Burkholderia
           thailandensis E264]
 gi|83652547|gb|ABC36610.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           thailandensis E264]
          Length = 236

 Score = 87.6 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 50/192 (26%), Gaps = 21/192 (10%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----------------YVMKGEFFMARPS 72
                   ++       +   +G F Q+                       G F  +RP 
Sbjct: 38  SHACAGGTEQLKAFVAKVHAAKGDFTQQIVKAPSKAASGAVPTVKPTDNSSGSFVFSRPG 97

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVIFSNNQHVIQES 127
           KF + Y  P    L +DG  + VY+  L+  +            A  +  SN+       
Sbjct: 98  KFIWTYQKPYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSNDIDKNYTL 157

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
               E                    +     +  L   ++ D     +++     + N  
Sbjct: 158 RDAGEKGGIDWLEMVPKAQDTQFQRIGIGFRNGMLAAMELHDVFGNVTLLTFTNIQTNPP 217

Query: 188 LDPKVFEIPYDK 199
           L    F+    K
Sbjct: 218 LKADQFKFVVPK 229


>gi|171057446|ref|YP_001789795.1| outer membrane lipoprotein carrier protein LolA [Leptothrix
           cholodnii SP-6]
 gi|229485833|sp|B1Y153|LOLA_LEPCP RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|170774891|gb|ACB33030.1| outer membrane lipoprotein carrier protein LolA [Leptothrix
           cholodnii SP-6]
          Length = 212

 Score = 87.6 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 28/191 (14%), Positives = 66/191 (34%), Gaps = 10/191 (5%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFM 68
             F + +      +   +   V    +   ++Q+ + TF Q              G F  
Sbjct: 11  FSFQALLLCAAGWHGAAQADGVSALRDFVQNVQSGRATFNQTVTSPDGAKKKTSTGSFEF 70

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVI 124
            RP++F F Y+ P    +++DG  + +++  L+  +V P          +++   +    
Sbjct: 71  LRPNRFRFDYTKPYEQQIVADGVKVWLHDVDLNQVTVRPFDQALGSTPAALLAGASIERD 130

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
                  E               G++ S+        L  ++I D+  + S +   +++ 
Sbjct: 131 FTLANLPEEAGLQWVQALPKAREGSIRSLRVAFRGKDLAAFEITDAFGQRSRLDFNRFEG 190

Query: 185 NTVLDPKVFEI 195
           N  +    F+ 
Sbjct: 191 NAAVPAARFKF 201


>gi|330994724|ref|ZP_08318647.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           sp. SXCC-1]
 gi|329758365|gb|EGG74886.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           sp. SXCC-1]
          Length = 213

 Score = 87.6 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 67/182 (36%), Gaps = 6/182 (3%)

Query: 24  FNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSK-FYFKYSSP 81
                       +++   H  +I  ++  F Q    G    G  ++ R ++   F+Y  P
Sbjct: 31  MAVGASDQDHALLEQVEHHLDAISQLKARFRQTAPDGKQSTGTAWIDRANRRMRFQYDPP 90

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNS---FI 138
           S + L+++   +   +++LD  +  P+      ++   +  +  +      S++     I
Sbjct: 91  SPLLLVANHDQVVFNDSQLDQTTTMPMEKTPLGLLLRPHLQLSGDVTVTGLSHDGHTLNI 150

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE-NTVLDPKVFEIPY 197
           T+   D      +++ F     RL  W I D+ +  + + +L       V    +F    
Sbjct: 151 TLVRTDSPGDGSMTLVFHDSPLRLRGWIIQDAQQETTRVDLLDITTSGGVPPDSLFNTDL 210

Query: 198 DK 199
            +
Sbjct: 211 PE 212


>gi|222111889|ref|YP_002554153.1| outer membrane lipoprotein carrier protein lola [Acidovorax ebreus
           TPSY]
 gi|221731333|gb|ACM34153.1| outer membrane lipoprotein carrier protein LolA [Acidovorax ebreus
           TPSY]
          Length = 212

 Score = 87.6 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 34/213 (15%), Positives = 59/213 (27%), Gaps = 27/213 (12%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG---- 59
           ++ K +                A         +K       S Q+ +  F Q        
Sbjct: 1   MVLKKIFAA---------ILIAAGAGCAWADGLKSLETFMKSAQSGRSEFTQTVTSPPKD 51

Query: 60  ------YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA- 112
                     G F   RP +F F Y  P    +++DG  + +Y+A L+  +         
Sbjct: 52  GQAGRTKTSSGSFEFQRPGRFKFHYRKPFEQLIVADGQTLWLYDADLNQVTQRTQSKALG 111

Query: 113 -------FSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNW 165
                   S                 E +     +       G + SV       +L   
Sbjct: 112 STPAALLASAPDLAALRADFALESAPEQDGLQWVLATPKAKDGQLKSVRVGFAGEQLAAL 171

Query: 166 KIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
            I+DS  + S+I+    + N  L    F+    
Sbjct: 172 DILDSFGQRSLIRFTGMQLNPALPAGTFQFKPP 204


>gi|260557289|ref|ZP_05829505.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii ATCC 19606]
 gi|260409395|gb|EEX02697.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           baumannii ATCC 19606]
          Length = 231

 Score = 87.6 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 34/222 (15%), Positives = 72/222 (32%), Gaps = 26/222 (11%)

Query: 4   LLYKSVIGVVILFFYSA----IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA- 58
           +L K++  + +     A       F A     + Q++   +     +Q +   F Q    
Sbjct: 3   MLRKTMCAITLSASVLAPVMSTTAFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQITKA 62

Query: 59  ----------------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT 102
                               KG   + RP KFY++  SPS  ++++ G  + +Y+  L  
Sbjct: 63  NTKTVAQKKGLSAQHMNQTFKGSMKVERPGKFYWETVSPSKQTIVTSGKTVWIYDPDLQQ 122

Query: 103 W-----SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDR 157
                         A  +  + NQ +    + + + +  + T+F K +            
Sbjct: 123 AVRQSLDDQVADTPALLLSGNTNQIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFG 182

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            +       + DS  + + ++    K N  +    F     K
Sbjct: 183 ANKAPTLMVLQDSLGQTTYVRFKNVKVNASIPASTFNFTPPK 224


>gi|73542284|ref|YP_296804.1| outer-membrane lipoprotein carrier protein [Ralstonia eutropha
           JMP134]
 gi|123624308|sp|Q46Y23|LOLA_RALEJ RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|72119697|gb|AAZ61960.1| Outer membrane lipoprotein carrier protein LolA [Ralstonia eutropha
           JMP134]
          Length = 212

 Score = 87.6 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/185 (14%), Positives = 63/185 (34%), Gaps = 14/185 (7%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGY--------VMKGEFFMARPSKFYFKYS 79
           P     +  +       +++ +G F Q +  G            G F  +RP KF ++Y+
Sbjct: 21  PTALAAATDQLQSFVTGVKSAKGEFTQRQVKGQGDSLKVTGTSSGSFVFSRPGKFTWRYA 80

Query: 80  SPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQESIQRVESNN 135
            P    L +DG  + +Y+  L+  +   L         +++F +N      +++   + +
Sbjct: 81  KPYEQLLQADGQTLYIYDKDLNQVTERKLDGALGSSPAAILFGSNDLEKNFTVKNGPTRD 140

Query: 136 SFITIF-FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
               +             +        L   ++ D+    +++     ++N  L    F 
Sbjct: 141 GVEWLELTPKSKDTQFERIGIGFKGGNLEAMELRDAFGNTTLLTFSAMQKNPQLPANAFR 200

Query: 195 IPYDK 199
               K
Sbjct: 201 FTVPK 205


>gi|170732289|ref|YP_001764236.1| outer-membrane lipoprotein carrier protein [Burkholderia
           cenocepacia MC0-3]
 gi|169815531|gb|ACA90114.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           cenocepacia MC0-3]
          Length = 229

 Score = 87.6 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/206 (15%), Positives = 56/206 (27%), Gaps = 21/206 (10%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG--------------- 59
           L    A      A         ++       +++ +G F Q+                  
Sbjct: 17  LGAALAGASLMLAATHAFAGGTEQLKAFVSQVRSAKGDFTQQIVKAPAKGASAAQAAPKP 76

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAF 113
                G F  ARP KF + Y  P    L +DG  + VY+  L+  +   L        A 
Sbjct: 77  TDNSSGTFVFARPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLNGALGASPAA 136

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
            +  SN+           E                    +     +  L   ++ D    
Sbjct: 137 ILFGSNDLDKNYTLRDAGEKGGIDWLEMLPKAQDTQFQRIGIGFRNGTLAAMELHDVFGN 196

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            +++     + N  L    F+    K
Sbjct: 197 VTLLTFTNIQTNPPLKGDTFKFVVPK 222


>gi|329891193|ref|ZP_08269536.1| outer membrane lipocarrier protein LolA family protein
           [Brevundimonas diminuta ATCC 11568]
 gi|328846494|gb|EGF96058.1| outer membrane lipocarrier protein LolA family protein
           [Brevundimonas diminuta ATCC 11568]
          Length = 213

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 33/179 (18%), Positives = 72/179 (40%), Gaps = 5/179 (2%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVSLI 87
                  +++A  +  ++ T QGTF++         G +++ RP K  F+Y+ P  + ++
Sbjct: 32  SADDQAVLRQAQTYLTAMTTAQGTFVETGPNNQRRTGRYYLQRPGKMRFEYTEPEGLLVV 91

Query: 88  SDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRV----ESNNSFITIFFK 143
           +DG+N++ ++ +L+ +   PL     S   +    + Q          +S    IT    
Sbjct: 92  ADGNNVSRWDPRLNVFRQAPLGQTPLSTFLAREVRLDQGVKIDRITRMDSGAFAITARDA 151

Query: 144 DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHN 202
                  + + F     RL  W I D+    + +++   +    L   +F++      N
Sbjct: 152 RRPNEGSVILAFAGSPVRLQEWTITDAQGSRTRVQLTTLQPAPGLAASLFQLRDPTRRN 210


>gi|257453966|ref|ZP_05619242.1| outer membrane lipoprotein carrier protein LolA [Enhydrobacter
           aerosaccus SK60]
 gi|257448631|gb|EEV23598.1| outer membrane lipoprotein carrier protein LolA [Enhydrobacter
           aerosaccus SK60]
          Length = 233

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 23/176 (13%), Positives = 59/176 (33%), Gaps = 14/176 (7%)

Query: 38  KAIEHFLSIQTMQGTFLQEDAG----------YVMKGEFFMARPSKFYFKYSSPSSVSLI 87
                  ++++M   F Q  +G              G   + RP++F ++    +S  ++
Sbjct: 51  NLNNLLKNVKSMTANFSQTTSGAGGKGLSKASRNFSGTMAVQRPNQFRWQIDGTASQLIV 110

Query: 88  SDGSNIAVYNAKLDTWSVYPLRYM----AFSVIFSNNQHVIQESIQRVESNNSFITIFFK 143
           ++G+ + VY+  L+  +   +          ++  +   +           +    + + 
Sbjct: 111 ANGNTLWVYDKDLNQATKQSVSNQVGDTPALILSGDPSKIANSFNVTQPIASKNYYVLYP 170

Query: 144 DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                N  S+     S   +   + D+  + + I+    K NT +    F     K
Sbjct: 171 KSGNANFKSLGIAFNSGNPVMMVLNDNLGQTTTIRFSNVKRNTSIASNQFSFTPPK 226


>gi|186475402|ref|YP_001856872.1| outer-membrane lipoprotein carrier protein [Burkholderia phymatum
           STM815]
 gi|184191861|gb|ACC69826.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           phymatum STM815]
          Length = 231

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 33/211 (15%), Positives = 58/211 (27%), Gaps = 26/211 (12%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------------------ 56
           L    A                ++  +    +++ +G F+Q                   
Sbjct: 14  LMRALAFGASMLITSHAFASGTEQLKQFVSQVRSARGEFVQTEVRAPSNAQQQASGVLST 73

Query: 57  ---DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----L 108
                  V  G F  ARP KF + Y  P +  L +DG  + VY+  L+  +V        
Sbjct: 74  QNASQNKVSSGSFTFARPGKFIWAYEKPYAQLLQADGDKLYVYDKDLNQVTVRKLGGALG 133

Query: 109 RYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIM 168
              A  +  SN+                                V        L   ++ 
Sbjct: 134 ASPAAILFGSNDLDKNFTLKDAGVKAGIDWLELIPKSKDTQFQRVGIGFKEGNLEAMELH 193

Query: 169 DSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           D     +++K    ++N  L    F+    K
Sbjct: 194 DVFGNVTLLKFSNIQKNPSLPADAFKFTVPK 224


>gi|107022055|ref|YP_620382.1| outer-membrane lipoprotein carrier protein [Burkholderia
           cenocepacia AU 1054]
 gi|116688999|ref|YP_834622.1| outer-membrane lipoprotein carrier protein [Burkholderia
           cenocepacia HI2424]
 gi|105892244|gb|ABF75409.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           cenocepacia AU 1054]
 gi|116647088|gb|ABK07729.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           cenocepacia HI2424]
          Length = 229

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/206 (15%), Positives = 56/206 (27%), Gaps = 21/206 (10%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG--------------- 59
           L    A      A         ++       +++ +G F Q+                  
Sbjct: 17  LGAALAGASLMLAATHAFAGGTEQLKAFVSQVRSAKGDFTQQIVKAPAKGASAAQAAPKP 76

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAF 113
                G F  ARP KF + Y  P    L +DG  + VY+  L+  +   L        A 
Sbjct: 77  TDNSSGTFVFARPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLNGALGASPAA 136

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
            +  SN+           E                    +     +  L   ++ D    
Sbjct: 137 ILFGSNDLDKNYTLRDAGEKGGIDWLEMLPKAQDTQFQRIGIGFRNGALAAMELHDVFGN 196

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            +++     + N  L    F+    K
Sbjct: 197 VTLLTFTNIQTNPPLKGDTFKFVVPK 222


>gi|329847404|ref|ZP_08262432.1| outer membrane lipocarrier protein LolA family protein
           [Asticcacaulis biprosthecum C19]
 gi|328842467|gb|EGF92036.1| outer membrane lipocarrier protein LolA family protein
           [Asticcacaulis biprosthecum C19]
          Length = 223

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 33/182 (18%), Positives = 81/182 (44%), Gaps = 7/182 (3%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVS 85
            +       + KA ++  ++ T QG F Q D  G    G ++++RP K  F+Y +P S+ 
Sbjct: 41  TFNAADKGRIDKATQYLQALTTAQGRFEQTDFRGRKTLGNWYLSRPGKIRFEYDAPYSLL 100

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSF---ITIFF 142
           +++DG  + +++ +L ++  YPL     S+  S    + Q  +     +++    ++   
Sbjct: 101 IVADGQKVKMWDPRLKSFDEYPLGETPLSLFLSRQIRLDQNVVVTQVKSSALGFTLSARD 160

Query: 143 KDDFMGNMISVTFDR---LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           +   +   I++ FD+    +  L  W + D+  + + + +  +         +F +   +
Sbjct: 161 RRKQVEGHIALVFDQAGNGNLTLREWTVTDAQGKATRVHLTSFNRGGGFKSDLFVLSKSQ 220

Query: 200 IH 201
           + 
Sbjct: 221 MK 222


>gi|262371906|ref|ZP_06065185.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           junii SH205]
 gi|262311931|gb|EEY93016.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           junii SH205]
          Length = 231

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/212 (15%), Positives = 69/212 (32%), Gaps = 22/212 (10%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA----------- 58
           IG + L    +     A    +  Q+    ++    +Q +   F Q              
Sbjct: 13  IGAMTLAPVVSTQLSAAPTAASAQQATSSLVKQLSGLQRLTADFEQTTKVTNSKPSKNKS 72

Query: 59  ------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW-----SVYP 107
                     KG   + RP KFY++ +SP+  ++++ G  + +Y+  L            
Sbjct: 73  LTAQHMNQTFKGTMKVERPGKFYWETTSPAKQTIVTTGKLVWIYDPDLQQAVRQSLDDQI 132

Query: 108 LRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKI 167
               A  +  + NQ +    + + +    + T++ K +             +       +
Sbjct: 133 ANTPALLLSGNTNQIMQSYRVTQPDRTKLYYTLYPKQEDSAFQSMTISFGANKAPNLMIL 192

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            DS  + + ++    K N  +   VF     K
Sbjct: 193 QDSLGQTTYVRFSNIKVNPKIPASVFNFAPPK 224


>gi|94309631|ref|YP_582841.1| outer-membrane lipoprotein carrier protein [Cupriavidus
           metallidurans CH34]
 gi|123260347|sp|Q1LQK4|LOLA_RALME RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|93353483|gb|ABF07572.1| Outer membrane lipoprotein carrier protein LolA precursor;
           chaperone for lipoproteins [Cupriavidus metallidurans
           CH34]
          Length = 214

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/177 (15%), Positives = 61/177 (34%), Gaps = 14/177 (7%)

Query: 37  KKAIEHFLSIQTMQGTFLQEDAG---------YVMKGEFFMARPSKFYFKYSSPSSVSLI 87
            +      S++T +G F Q+                G F  +RP KF ++Y+ P    L 
Sbjct: 31  DQLQSFVTSVKTARGEFTQQQMKGKGADLKVASTSSGTFVFSRPGKFAWRYTKPYEQLLQ 90

Query: 88  SDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQESIQRVESNNSFITIF-F 142
           +DG  + +Y+  L+  +   L         +++F +N       ++   + +    +   
Sbjct: 91  ADGQVLYIYDKDLNQVTERKLDGALGSSPAAILFGSNDLSKNFDVKNGATRDGVEWLELT 150

Query: 143 KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
             +       +        L   ++ D+    +I+     ++N  L    F     K
Sbjct: 151 PKEKDTQFERIGIGFKGGNLEAMELRDAFGNTTILTFSAIQKNPSLPADAFRFTVPK 207


>gi|262376676|ref|ZP_06069904.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           lwoffii SH145]
 gi|262308386|gb|EEY89521.1| outer membrane lipoprotein carrier protein LolA [Acinetobacter
           lwoffii SH145]
          Length = 231

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 37/222 (16%), Positives = 76/222 (34%), Gaps = 26/222 (11%)

Query: 4   LLYKSV----IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA- 58
           +L K+V    +G V L    +   F A    ++ Q+    ++    +++M   F Q    
Sbjct: 3   MLRKTVCAMALGAVTLAPVMSTTVFAAPVAASEQQATASLVKQLNHVRSMTANFEQSTKV 62

Query: 59  ----------------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT 102
                               KG   +ARP KFY++ ++PS   + + G  + +Y+  L  
Sbjct: 63  TNPRATQKKGLTAQHMNQTFKGVMKVARPGKFYWETTAPSKQVIATTGKTVWIYDPDLQQ 122

Query: 103 W-----SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDR 157
                         A  +  + +Q +    + +     ++ T++ K+             
Sbjct: 123 AVRQSLDEQVANTPALLLSGNTSQIMQSYRVTQPNKGKTYYTLYPKNTDGVFESLTISFG 182

Query: 158 LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            +       + DS  + + IK    K N+ +    F     K
Sbjct: 183 ANKAPSLMILQDSLGQTTNIKFSNVKVNSSIPASTFNFTPPK 224


>gi|167570878|ref|ZP_02363752.1| outer-membrane lipoprotein carrier protein [Burkholderia
           oklahomensis C6786]
          Length = 231

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 55/192 (28%), Gaps = 21/192 (10%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----------------YVMKGEFFMARPS 72
                   ++       +   +G F Q+                       G F  +RP 
Sbjct: 33  SHAFASGTEQLRAFVSKVHAAKGDFTQQIVKAPSKAASGAVPTVKPTDNSSGSFVFSRPG 92

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQESI 128
           KF + Y  P    L +DG  + VY+  L+  +   L         +++F +N      ++
Sbjct: 93  KFIWTYQKPYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSNDLEKNYTL 152

Query: 129 QR-VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
           +   E                    +     +  L   ++ D     +++     + N  
Sbjct: 153 RDAGEKGGIDWLEMVPKAQDTQFQRIGIGFRNGVLAAMELHDVFGNVTLLTFTNIQTNPP 212

Query: 188 LDPKVFEIPYDK 199
           L    F+    K
Sbjct: 213 LKADQFKFVVPK 224


>gi|167563731|ref|ZP_02356647.1| outer-membrane lipoprotein carrier protein [Burkholderia
           oklahomensis EO147]
          Length = 236

 Score = 86.9 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 55/192 (28%), Gaps = 21/192 (10%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----------------YVMKGEFFMARPS 72
                   ++       +   +G F Q+                       G F  +RP 
Sbjct: 38  SHAFASGTEQLRAFVSKVHAAKGDFTQQIVKAPSKAASGAVPTVKPTDNSSGSFVFSRPG 97

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQESI 128
           KF + Y  P    L +DG  + VY+  L+  +   L         +++F +N      ++
Sbjct: 98  KFIWTYQKPYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSNDLEKNYTL 157

Query: 129 QR-VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
           +   E                    +     +  L   ++ D     +++     + N  
Sbjct: 158 RDAGEKGGIDWLEMVPKAQDTQFQRIGIGFRNGVLAAMELHDVFGNVTLLTFTNIQTNPP 217

Query: 188 LDPKVFEIPYDK 199
           L    F+    K
Sbjct: 218 LKADQFKFVVPK 229


>gi|120612078|ref|YP_971756.1| outer membrane lipoprotein carrier protein LolA [Acidovorax
           citrulli AAC00-1]
 gi|120590542|gb|ABM33982.1| outer membrane lipoprotein carrier protein LolA [Acidovorax
           citrulli AAC00-1]
          Length = 211

 Score = 86.9 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/213 (14%), Positives = 61/213 (28%), Gaps = 27/213 (12%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K  + +  +                    +          Q  +  F Q         
Sbjct: 1   MMKQWMAIAAI---------AVGAQSAWADGLASLESFMKGAQAGRADFTQTVTSPPKDG 51

Query: 60  -----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-- 112
                    G F   RP +F F Y+ P + ++++DG ++ +Y+A L+  +          
Sbjct: 52  QASRTRTSSGTFEFQRPGRFKFTYTKPFAQTIVADGKSLWLYDADLNQVTQRAQAQALGT 111

Query: 113 ------FSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWK 166
                  S                 + +     +       G + SV       +L    
Sbjct: 112 TPAALLASAPDLQALRKDFTLESAPDQDGLQWVLATPRTRDGQLKSVRVGFQGEQLAALD 171

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           I+DS  + S+I+    + +  L    FE    +
Sbjct: 172 ILDSFGQRSVIRFANVQSSASLPASTFEFKPPQ 204


>gi|326318087|ref|YP_004235759.1| outer membrane lipoprotein carrier protein LolA [Acidovorax avenae
           subsp. avenae ATCC 19860]
 gi|323374923|gb|ADX47192.1| outer membrane lipoprotein carrier protein LolA [Acidovorax avenae
           subsp. avenae ATCC 19860]
          Length = 211

 Score = 86.9 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/213 (15%), Positives = 61/213 (28%), Gaps = 27/213 (12%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K          + AI              +          Q  +  F Q         
Sbjct: 1   MMKQ---------WLAIAAIAVGAQSAWADGLGSLESFMKGAQAGRADFTQTVTSPPKDG 51

Query: 60  -----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-- 112
                    G F   RP +F F Y+ P + ++++DG ++ +Y+A L+  +          
Sbjct: 52  QAPRTRTSSGTFEFQRPGRFKFTYTKPFAQTIVADGKSLWLYDADLNQVTQRAQAQALGT 111

Query: 113 ------FSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWK 166
                  S                 + +     +       G + SV       +L    
Sbjct: 112 TPAALLASAPDLQALRKDFTLESAPDQDGLQWVLATPKTRDGQLKSVRVGFQGEQLAALD 171

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           I+DS  + S+I+    + +  L    FE    +
Sbjct: 172 ILDSFGQRSVIRFANVQSSASLPASTFEFKPPQ 204


>gi|325528342|gb|EGD05495.1| lipoprotein chaperone [Burkholderia sp. TJI49]
          Length = 229

 Score = 86.9 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/220 (14%), Positives = 60/220 (27%), Gaps = 26/220 (11%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED--- 57
           M+    +   G  +      +   +A          ++       ++  +G F Q+    
Sbjct: 8   MSLRSTRRWFGAALAGASLMLAATHAF-----ASGTEQLRAFVSQVRAAKGEFTQQIVKA 62

Query: 58  -------------AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS 104
                              G F  +RP KF + Y  P    L +DG  + VY+  L+  +
Sbjct: 63  PSKGASAAQAAPKPNDNSSGTFVFSRPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVT 122

Query: 105 VYPLR-----YMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLS 159
              L        A  +  SN+           E                    +     +
Sbjct: 123 ERKLNGALGASPAAILFGSNDLDKNYTLRDAGEKGGIDWLEMLPKAQDTQFQRIGIGFRN 182

Query: 160 YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
             L   ++ D     +++     + N  L    F+    K
Sbjct: 183 GTLAAMELHDVFGNVTLLTFTNIQTNPPLKADTFKFVVPK 222


>gi|167619049|ref|ZP_02387680.1| outer-membrane lipoprotein carrier protein [Burkholderia
           thailandensis Bt4]
          Length = 236

 Score = 86.9 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 51/192 (26%), Gaps = 21/192 (10%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----------------YVMKGEFFMARPS 72
                   ++       +   +G F Q+                       G F  +RP 
Sbjct: 38  SHACAGGTEQLKAFVAKVHAAKGDFTQQIVKAPSKAASGAVPTVKPTDNSSGSFVFSRPG 97

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVIFSNNQHVIQES 127
           KF + Y  P    L +DG  + VY+  L+  +            A  +  SN+       
Sbjct: 98  KFIWTYQKPYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSNDIDKNYTL 157

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
               E +                  +     +  L   ++ D     +++     + N  
Sbjct: 158 RDAGEKSGIDWLEMVPKAQDTQFQRIGIGFRNGMLAAMELHDVFGNVTLLTFTNIQTNPP 217

Query: 188 LDPKVFEIPYDK 199
           L    F+    K
Sbjct: 218 LKADQFKFVVPK 229


>gi|121606100|ref|YP_983429.1| outer membrane lipoprotein carrier protein LolA [Polaromonas
           naphthalenivorans CJ2]
 gi|120595069|gb|ABM38508.1| outer membrane lipoprotein carrier protein LolA [Polaromonas
           naphthalenivorans CJ2]
          Length = 216

 Score = 86.5 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/205 (14%), Positives = 60/205 (29%), Gaps = 22/205 (10%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA----------GYVMKGEF 66
            + A     A+        ++       ++ + +  F Q                  G F
Sbjct: 5   CFFATVLIAASAHAACANGLESLASFVKTVSSGRADFTQVVTAPAKEGQTARSKTSSGTF 64

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIF-------SN 119
             +RP++F F Y  P   S+++DG  + +Y+A L+  +         S            
Sbjct: 65  EFSRPNRFKFLYKKPFEQSIVADGQTLWLYDADLNQVTARKQSAALGSTPAALIAAAPDL 124

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTF-----DRLSYRLLNWKIMDSSRRY 174
                  ++      +    +          +               L   +I+DS  + 
Sbjct: 125 RALQADFTLAAAPEKDGLEWVVATPKTKEGQLQAVRVGFRAGEKPAGLAALEILDSFGQR 184

Query: 175 SIIKILKYKENTVLDPKVFEIPYDK 199
           S++   K + N  L    F+    K
Sbjct: 185 SVLSFSKVEVNPALPKDAFQFITPK 209


>gi|254292392|ref|YP_003058415.1| outer membrane lipoprotein carrier protein LolA [Hirschia baltica
           ATCC 49814]
 gi|254040923|gb|ACT57718.1| outer membrane lipoprotein carrier protein LolA [Hirschia baltica
           ATCC 49814]
          Length = 227

 Score = 86.5 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/180 (18%), Positives = 77/180 (42%), Gaps = 8/180 (4%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVS 85
           A     ++ + K        +T +G F Q D  G +  G+F++ RP +  F+Y++P+   
Sbjct: 42  AVDFQNNELLTKINARMADTKTARGGFKQTDAMGEITTGDFYLRRPGRVRFEYAAPTPYL 101

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQ-------RVESNNSFI 138
           ++SDG+ +A+ + +LDT    PL             ++ +++                  
Sbjct: 102 IVSDGTTVAIEDKELDTIDRAPLSATPLKHFLKKTLNLAEDTTILDVRSLPDSHLVVIED 161

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                D+ +  ++ + F + +Y L+ W  +D     + + +   + N  + P++F +  +
Sbjct: 162 NPKNGDEAIDGLVFLKFSKENYDLMGWVTIDGLGNETRVDLFDMELNGNISPRLFVLEDE 221


>gi|206561378|ref|YP_002232143.1| outer-membrane lipoprotein carrier protein [Burkholderia
           cenocepacia J2315]
 gi|198037420|emb|CAR53355.1| probable outer-membrane lipoproteins carrier protein [Burkholderia
           cenocepacia J2315]
          Length = 229

 Score = 86.5 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/206 (15%), Positives = 56/206 (27%), Gaps = 21/206 (10%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG--------------- 59
           L    A      A         ++       +++ +G F Q+                  
Sbjct: 17  LGAALAGASLMLAATHAFAGGTEQLKAFVSQVRSAKGDFTQQIVKAPAKGASAAQAAPKP 76

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAF 113
                G F  ARP KF + Y  P    L +DG  + VY+  L+  +   L        A 
Sbjct: 77  TDNSSGTFVFARPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLNGALGASPAA 136

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
            +  SN+           E                    +     +  L   ++ D    
Sbjct: 137 ILFGSNDLDKNYTLRDAGEKGGIEWLEMLPKAQDTQFQRIGIGFRNGTLAAMELHDVFGN 196

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            +++     + N  L    F+    K
Sbjct: 197 VTLLTFTNIQTNPALKGDTFKFVVPK 222


>gi|90421801|ref|YP_530171.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris BisB18]
 gi|90103815|gb|ABD85852.1| outer membrane lipoprotein carrier protein LolA [Rhodopseudomonas
           palustris BisB18]
          Length = 280

 Score = 86.5 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/154 (20%), Positives = 69/154 (44%), Gaps = 5/154 (3%)

Query: 51  GTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR 109
           G F+Q    G   KG+F++ +P K  F+Y  PS +++I+DG+++AV + KL T  +YPL 
Sbjct: 121 GNFVQVGPDGSRTKGDFYIQKPGKVRFEYDEPSPIAIIADGNSVAVRDRKLATQDIYPLS 180

Query: 110 YMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFM----GNMISVTFDRLSYRLLNW 165
                 + S+   +++++     + +        ++       + + +       +L  W
Sbjct: 181 QTPLRYLLSDRIDLLRDTNVVSVTADDVFISVVIEEKQVLVGTSRLMLMIGAKDNQLKQW 240

Query: 166 KIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            + D     + + +         DP +F+I +  
Sbjct: 241 TVTDPQGYDTTVAVYNLDATKKPDPGMFKIDFTN 274


>gi|258404932|ref|YP_003197674.1| outer membrane lipoprotein carrier protein LolA [Desulfohalobium
           retbaense DSM 5692]
 gi|257797159|gb|ACV68096.1| outer membrane lipoprotein carrier protein LolA [Desulfohalobium
           retbaense DSM 5692]
          Length = 234

 Score = 86.5 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/208 (11%), Positives = 63/208 (30%), Gaps = 14/208 (6%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE----DAGY 60
           L + ++  +++         + A    ++    +  + +  +Q  +  F+Q      +G 
Sbjct: 7   LMRLIVAAMLVLGLVCGGLGSQAAAQGEEDLPGRIQQQYEQLQGFETDFVQVLTNASSGE 66

Query: 61  VMK--GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIF- 117
                G     +P    ++ +SP    LI     +  Y    +    Y  + +  S    
Sbjct: 67  QETRRGTIAFEQPRSIRWETTSPEQELLIVGPEAVWDYFPAEEVAYTYAPQQVFQSKTML 126

Query: 118 -------SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
                  +  +    E  +   + +    I  + +    +  +  +  S  L    ++D 
Sbjct: 127 RFISGEANITEDFRIERQKSDTNWSKLKLIPKQPEPNLVLAYIWVEPESALLRQVLLVDF 186

Query: 171 SRRYSIIKILKYKENTVLDPKVFEIPYD 198
               + +     K +    P  FE    
Sbjct: 187 FGNGNKLTFKDIKLDPEFAPGWFEFEPP 214


>gi|190574294|ref|YP_001972139.1| outer-membrane lipoprotein carrier protein [Stenotrophomonas
           maltophilia K279a]
 gi|190012216|emb|CAQ45839.1| putative outer membrane lipoprotein carrier protein
           [Stenotrophomonas maltophilia K279a]
          Length = 212

 Score = 86.5 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/203 (12%), Positives = 61/203 (30%), Gaps = 13/203 (6%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMK 63
                    + +    AA       +          ++ + G F Q+             
Sbjct: 3   FRFRRFLATTTLAVACAAAGSVWAGARDDLKTFTSGLKGLDGQFSQQVFDSRGKVKESTS 62

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSN 119
           G   ++ P  F ++Y  P    +++DG  + +Y   L+  +V       +    + + + 
Sbjct: 63  GRVALSAPRLFRWEYVRPHEQLIVADGKKVWMYEPDLEQATVREQGKEEQNSPLTALINP 122

Query: 120 NQHVIQESIQRV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
                Q  +           ++++  K +   +         +  L   +I D+  + ++
Sbjct: 123 ALLEQQYDVSEEAAQRDGLQWLSLSPKRETEASFQYAALGFNAQGLAKMEITDAVGQRTV 182

Query: 177 IKILKYKENTVLDPKVFEIPYDK 199
           I    +K N       F     K
Sbjct: 183 ISFSGWKRNPGFAAGTFSFTPPK 205


>gi|121595681|ref|YP_987577.1| outer membrane lipoprotein carrier protein LolA [Acidovorax sp.
           JS42]
 gi|120607761|gb|ABM43501.1| outer membrane lipoprotein carrier protein LolA [Acidovorax sp.
           JS42]
          Length = 210

 Score = 86.5 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 54/186 (29%), Gaps = 18/186 (9%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQEDAG----------YVMKGEFFMARPSKFYFKYSS 80
                +K       S Q+ +  F Q                  G F   RP +F F Y  
Sbjct: 17  AWADGLKSLETFMKSAQSGRSEFTQTVTSPPKDGQAGRTKTSSGSFEFQRPGRFKFHYRK 76

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA--------FSVIFSNNQHVIQESIQRVE 132
           P    +++DG  + +Y+A L+  +                 S                 E
Sbjct: 77  PFEQLIVADGQTLWLYDADLNQVTQRTQSKALGSTPAALLASAPDLAALRADFALESAPE 136

Query: 133 SNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
            +     +       G + SV       +L    I+DS  + S+I+    + N  L    
Sbjct: 137 QDGLQWVLATPKAKDGQLKSVRVGFAGEQLAALDILDSFGQRSLIRFTGMQLNPALPAGT 196

Query: 193 FEIPYD 198
           F+    
Sbjct: 197 FQFKPP 202


>gi|307545646|ref|YP_003898125.1| outer-membrane lipoprotein carrier protein [Halomonas elongata DSM
           2581]
 gi|307217670|emb|CBV42940.1| outer-membrane lipoprotein carrier protein [Halomonas elongata DSM
           2581]
          Length = 210

 Score = 86.1 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 64/179 (35%), Gaps = 11/179 (6%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQEDAGY------VMKGEFFMARPSKFYFKYSSPSSVS 85
            D++ ++       ++T    F QE             G  ++ARP +F ++  +P    
Sbjct: 23  ADEAAERLTHLLEPVKTYVADFDQEILDSSGQRLQEASGRMWLARPGRFRWEVDAPYEQI 82

Query: 86  LISDGSNIAVYNAKLDTWSVY-----PLRYMAFSVIFSNNQHVIQESIQRVESNNSFITI 140
           ++S+G  + +Y+  L   ++           A  +  S ++      + R +   +    
Sbjct: 83  VVSNGDEVTLYDPDLQQATIQALDERVTHTPALLLSGSTDELTESYEVTRSQQGTAETFT 142

Query: 141 FFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
               D      S+        L   ++ DS+ + + I     ++N  +    F++   +
Sbjct: 143 LTPHDADTLFESLKMTFYGETLGRLQMTDSTGQRTAIGFDDAQQNVEVADSRFQLDLPE 201


>gi|110834152|ref|YP_693011.1| outer membrane lipoprotein carrier protein [Alcanivorax borkumensis
           SK2]
 gi|122959498|sp|Q0VQ09|LOLA_ALCBS RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|110647263|emb|CAL16739.1| outer membrane lipoprotein carrier protein [Alcanivorax borkumensis
           SK2]
          Length = 209

 Score = 86.1 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/206 (15%), Positives = 65/206 (31%), Gaps = 18/206 (8%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK-- 63
            K       L    A+ P     P     +    +    ++++M+G F Q          
Sbjct: 1   MKK------LLLTLAMVPAVLFSPTAWGDATDDLLGRLQTLESMKGGFEQVVLDQSGTHM 54

Query: 64  ----GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSV 115
               G+F +AR ++FY+   +P      SDG+ + VY+  L+   V PL          +
Sbjct: 55  QEALGKFQVARGNRFYWLTETPYEQMAASDGTTVWVYDKDLEQVVVRPLSQDLGQTPALL 114

Query: 116 IFSNNQHVIQESIQRVESNNS--FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
                  V +        N                    +       +  + ++ D+  +
Sbjct: 115 FGGKPADVAKAFTISERDNRGAEVTYRLTPKGQDPLFDQLDVTFKGGQPASMRLQDALGQ 174

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            ++I  +    N  +D  +F     +
Sbjct: 175 QTVIDFIGLTLNDGIDSSLFHFDPPE 200


>gi|167648963|ref|YP_001686626.1| outer membrane lipoprotein carrier protein LolA [Caulobacter sp.
           K31]
 gi|167351393|gb|ABZ74128.1| outer membrane lipoprotein carrier protein LolA [Caulobacter sp.
           K31]
          Length = 212

 Score = 86.1 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 35/206 (16%), Positives = 84/206 (40%), Gaps = 7/206 (3%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAY----PITKDQSVKKAIEHFLSIQTMQGTFLQE 56
           M     + +I   +    +                +   V +A  +  ++ + +G F+Q 
Sbjct: 1   MTTTTRRLIIAAGLSLAVAGPALAAQPPAARLSADEQALVDRATAYIQTLGSAKGRFVQT 60

Query: 57  D-AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSV 115
           D  G   +G F++ RP K  F Y  P+ + ++S+G+N+ +Y+++L T+  YPL     ++
Sbjct: 61  DARGSQTQGLFYLQRPGKARFAYDGPAGLLVVSNGANVNIYDSRLKTFESYPLNRTPLAL 120

Query: 116 IFSNNQHVIQESIQR--VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
           + +    + +        + ++ F                     +  L  W + D    
Sbjct: 121 LLAREVRLDRGVTITGVRKLSDGFTITAVDAKRQTLGRIALDFSNAPALTGWTVTDVKGG 180

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            + +++  +++ + LDPK+F +   +
Sbjct: 181 ETRVRLADFEKTSGLDPKLFVLSDPR 206


>gi|167837526|ref|ZP_02464409.1| outer-membrane lipoprotein carrier protein [Burkholderia
           thailandensis MSMB43]
          Length = 236

 Score = 86.1 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 54/192 (28%), Gaps = 21/192 (10%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----------------YVMKGEFFMARPS 72
                   ++       +   +G F Q+                       G F  +RP 
Sbjct: 38  SRAFASGTEQLKAFVAKVHAARGDFTQQIVKAPSKAASGAVPTVKPTDNSSGSFVFSRPG 97

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQESI 128
           KF + Y  P    L +DG  + VY+  L+  +   L         +++F +N      ++
Sbjct: 98  KFIWTYQKPYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSNDLEKNYTL 157

Query: 129 QR-VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
           +   E                    +     +  L   ++ D     +++     + N  
Sbjct: 158 RDAGEKGGIDWLEMVPKAQDTQFQRIGIGFRNGMLAAMELHDVFGNVTLLTFTNIQTNPP 217

Query: 188 LDPKVFEIPYDK 199
           L    F     K
Sbjct: 218 LKADQFRFVVPK 229


>gi|325123241|gb|ADY82764.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 215

 Score = 85.7 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 31/198 (15%), Positives = 65/198 (32%), Gaps = 22/198 (11%)

Query: 24  FNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-----------------GYVMKGEF 66
           F A     + Q++   +     +Q +   F Q                        KG  
Sbjct: 11  FAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKANTKTVAQKKSLSAQHMNQTFKGSM 70

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW-----SVYPLRYMAFSVIFSNNQ 121
            + RP KFY++  SP+  ++++ G  + +Y+  L                A  +  + NQ
Sbjct: 71  KVERPGKFYWETVSPAKQTIVTSGKTVWIYDPDLQQAVRQSLDDQVADTPALLLSGNTNQ 130

Query: 122 HVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
            +    + + + +  + T+F K +             +       + DS  + + ++   
Sbjct: 131 IMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFGANKAPTLMVLQDSLGQTTYVRFKN 190

Query: 182 YKENTVLDPKVFEIPYDK 199
            K N  +   VF     K
Sbjct: 191 VKVNASIPASVFNFTPPK 208


>gi|126442023|ref|YP_001060002.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei 668]
 gi|126221516|gb|ABN85022.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 668]
          Length = 240

 Score = 85.7 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 50/192 (26%), Gaps = 21/192 (10%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----------------YVMKGEFFMARPS 72
                   ++       +   +G F Q+                       G F  +RP 
Sbjct: 42  SHAFASGTEQLKAFVAKVHAAKGEFTQQIVKAPPKAASGAVPTVKPTDNSSGSFVFSRPG 101

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVIFSNNQHVIQES 127
           KF + Y  P    L +DG  + VY+  L+  +            A  +  SN+       
Sbjct: 102 KFIWTYQKPYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSNDLDKNYTL 161

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
               E                    +     +  L   ++ D     +++     + N  
Sbjct: 162 RDAGEKGGIDWLEMVPKAQDTQFQRIGIGFRNGMLAAMELHDVFGNVTLLTFTNIQTNPP 221

Query: 188 LDPKVFEIPYDK 199
           L    F+    K
Sbjct: 222 LKADQFKFVVPK 233


>gi|312795384|ref|YP_004028306.1| outer-membrane lipoproteins carrier protein [Burkholderia
           rhizoxinica HKI 454]
 gi|312167159|emb|CBW74162.1| Outer-membrane lipoproteins carrier protein [Burkholderia
           rhizoxinica HKI 454]
          Length = 248

 Score = 85.7 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 33/219 (15%), Positives = 63/219 (28%), Gaps = 24/219 (10%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------- 56
           L+  S+          A+    AA P        +       +++  G F+Q        
Sbjct: 24  LMMGSLFRATRAAATGALIAL-AAVPCAHASGTAQLKAFVAQVRSADGEFVQRQVKAAGG 82

Query: 57  -----------DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV 105
                       +     G F  ARP +F + Y  P    L SDG  + V++  L+  + 
Sbjct: 83  SASQAQGQAARTSMATSSGTFRFARPGRFVWAYQKPYEQLLQSDGDKLYVWDKDLNQVTA 142

Query: 106 YPLR----YMAFSVIFSNNQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSY 160
             L         +++F +N      +++                        V       
Sbjct: 143 RALNGVLGASPAAILFGSNDLEKNFTLRDAGVKQGIDWLELVPKSRDTQFERVGIGFRDG 202

Query: 161 RLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            L   ++ D     +++      +N  L    F+    K
Sbjct: 203 NLEAMELHDVFGNVTLLTFSNIHKNPALPANTFKFTVPK 241


>gi|293603788|ref|ZP_06686204.1| outer membrane lipoprotein carrier protein LolA [Achromobacter
           piechaudii ATCC 43553]
 gi|292817786|gb|EFF76851.1| outer membrane lipoprotein carrier protein LolA [Achromobacter
           piechaudii ATCC 43553]
          Length = 208

 Score = 85.3 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 28/206 (13%), Positives = 64/206 (31%), Gaps = 16/206 (7%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM-- 62
           + K+   + ++   S     + A       + ++      ++ +  G+F Q         
Sbjct: 1   MMKTFHRLAVVAALSLAPALSFA-----ASAQEQLKSFVTTVTSATGSFSQYTVNNQGRT 55

Query: 63  ----KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFS 114
                G F   RP KF +    P    ++SDG  +  ++  L   +   +         +
Sbjct: 56  QPAQTGVFSFQRPGKFKWAVQKPYEQLVVSDGRVLFQFDPDLAQVTERKVDAAIGTSPAA 115

Query: 115 VIFSNNQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
           ++F +        +  + S +                  V         +  +++DS  +
Sbjct: 116 ILFGSGSLEQSFDVSALPSKDGVDWLRAKPRTADAGFSRVDIGMKDNLPVRVELLDSFGQ 175

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            + + +     N  L  K FE    K
Sbjct: 176 TTRVDLSAIAANPSLPAKEFEFTAPK 201


>gi|315122020|ref|YP_004062509.1| possible lolA type protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495422|gb|ADR52021.1| possible lolA type protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 207

 Score = 85.3 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 116/173 (67%), Positives = 144/173 (83%), Gaps = 1/173 (0%)

Query: 32  KDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           K+ +V+KAI+HFLSIQT+QG F+QED  G V+KGEFFM RPSKFYFKYSSPSS SL+SDG
Sbjct: 34  KEHAVQKAIDHFLSIQTIQGIFVQEDTVGNVIKGEFFMTRPSKFYFKYSSPSSGSLVSDG 93

Query: 91  SNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNM 150
            N+A+YNAKLD W+VYPL   AF +IFSN ++ +Q+SIQR+E+NN+FIT+FF++    NM
Sbjct: 94  RNVAIYNAKLDAWTVYPLPNTAFGIIFSNKRNEMQQSIQRIETNNAFITLFFREVLTKNM 153

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           IS+TFDRLSYRLLNW+I DSS    ++KILKYKEN  L  ++F IPYDKIHNI
Sbjct: 154 ISLTFDRLSYRLLNWEITDSSGTSILVKILKYKENITLKSELFVIPYDKIHNI 206


>gi|311694709|gb|ADP97582.1| outer-membrane lipoprotein carrier protein precursor [marine
           bacterium HP15]
          Length = 215

 Score = 85.3 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 28/202 (13%), Positives = 67/202 (33%), Gaps = 12/202 (5%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------VMK 63
               ++    A+             S  +        ++ Q  F+Q             +
Sbjct: 5   FLKCLVTLVMAVLIAGPLSASEGSDSANELASLLKGYESYQADFIQIVVNENGNKVQETR 64

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSN 119
           G     RP  FY++ S+P S  ++SDG  + VY+  L+  +++     ++     ++   
Sbjct: 65  GSLKAKRPGLFYWETSAPLSQFIVSDGETVEVYDPDLEQVTIHNLDDRVQSTPALLLSGE 124

Query: 120 NQHVIQESIQRVE--SNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             ++            +N+               S+        L   ++ DS  + S++
Sbjct: 125 VDNLEDTYRVSGRQIGDNTLEFTLQPRSPDSLFTSLRLTFFKGELQEMRMQDSLAQLSVL 184

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
              + + N  ++   F + Y +
Sbjct: 185 SFDRIRLNEPVEAGAFTLDYPE 206


>gi|330900605|gb|EGH32024.1| lipoprotein chaperone [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 207

 Score = 85.3 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 27/198 (13%), Positives = 64/198 (32%), Gaps = 11/198 (5%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEF 66
           +I    +    F+        + V +  +     QT+   F Q              GE 
Sbjct: 3   LIRMLLATALTFSMIPAHADSKDVARLTQLLEKSQTLTPRFSQLTLDGGGTQLQETTGEM 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQH 122
            + RP  F +   +P    ++SDG  +++++  L+  +       L      ++  +   
Sbjct: 63  ALQRPGLFNWHTDAPQEQLMVSDGKKVSLWDPDLEQVTIKKLDQRLTQTPALLLSGDVSK 122

Query: 123 VIQESIQRVESNNSFI-TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
           + +      +     I  +           S+     +  + + +++DS  + + I    
Sbjct: 123 ISESFDITAKEAGGVIDFVLKPKTKDTLFDSLRLSFRNGIINDMQLIDSVGQRTNILFTG 182

Query: 182 YKENTVLDPKVFEIPYDK 199
            K N  +    F+    K
Sbjct: 183 VKANESIAASKFQFQIPK 200


>gi|300311229|ref|YP_003775321.1| outer-membrane lipoprotein-sorting protein [Herbaspirillum
           seropedicae SmR1]
 gi|300074014|gb|ADJ63413.1| outer-membrane lipoprotein-sorting protein [Herbaspirillum
           seropedicae SmR1]
          Length = 237

 Score = 84.9 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 32/211 (15%), Positives = 72/211 (34%), Gaps = 16/211 (7%)

Query: 5   LYKSVIGVVI--LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ----EDA 58
           L + ++   +  L    AI             ++ +  +   S Q+ +G F Q     + 
Sbjct: 20  LRRRLMAAGLSALVVAGAITITALTPGRASAAALDQFKQFVSSTQSAKGAFTQRMVRTEN 79

Query: 59  G-----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY--- 110
           G         G F  +RP KF + Y  P    + +DG  + +Y+  L+  +   L     
Sbjct: 80  GATKVVNTSSGSFVFSRPGKFIWTYQKPYEQVIQADGEKLFIYDKDLNQVTTKKLGNALG 139

Query: 111 -MAFSVIFSNNQHVIQESIQRVESNNSFITIFF-KDDFMGNMISVTFDRLSYRLLNWKIM 168
               +++F +N      +++     +    +             +     +   +  ++ 
Sbjct: 140 SSPAAILFGSNDLEKNFTLKEAGDKDGLEWLEAVPKSKDTTFDRIGIGLKNGTPVAMELH 199

Query: 169 DSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           DS  + S++    +++N  L    F     K
Sbjct: 200 DSFGQVSLLSFDSFEKNPPLKVNSFSFTIPK 230


>gi|53720213|ref|YP_109199.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei K96243]
 gi|53726032|ref|YP_103692.1| outer-membrane lipoprotein carrier protein [Burkholderia mallei
           ATCC 23344]
 gi|67643956|ref|ZP_00442699.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei GB8 horse 4]
 gi|76808561|ref|YP_334449.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei 1710b]
 gi|121600147|ref|YP_992136.1| outer-membrane lipoprotein carrier protein [Burkholderia mallei
           SAVP1]
 gi|124383961|ref|YP_001028580.1| outer-membrane lipoprotein carrier protein [Burkholderia mallei
           NCTC 10229]
 gi|126451282|ref|YP_001081521.1| outer-membrane lipoprotein carrier protein [Burkholderia mallei
           NCTC 10247]
 gi|126452390|ref|YP_001067281.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei 1106a]
 gi|134280238|ref|ZP_01766949.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 305]
 gi|166998318|ref|ZP_02264178.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei PRL-20]
 gi|167720768|ref|ZP_02404004.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei DM98]
 gi|167739752|ref|ZP_02412526.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei 14]
 gi|167816972|ref|ZP_02448652.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei 91]
 gi|167825382|ref|ZP_02456853.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei 9]
 gi|167912101|ref|ZP_02499192.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei 112]
 gi|217420385|ref|ZP_03451890.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 576]
 gi|226193752|ref|ZP_03789354.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei Pakistan 9]
 gi|242316681|ref|ZP_04815697.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 1106b]
 gi|254175419|ref|ZP_04882079.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei ATCC 10399]
 gi|254191851|ref|ZP_04898354.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254196031|ref|ZP_04902456.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei S13]
 gi|254202388|ref|ZP_04908751.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei FMH]
 gi|254207720|ref|ZP_04914070.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei JHU]
 gi|254261881|ref|ZP_04952935.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 1710a]
 gi|254298873|ref|ZP_04966323.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 406e]
 gi|254356380|ref|ZP_04972656.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei 2002721280]
 gi|52210627|emb|CAH36611.1| probable outer-membrane lipoproteins carrier protein [Burkholderia
           pseudomallei K96243]
 gi|52429455|gb|AAU50048.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei ATCC 23344]
 gi|76578014|gb|ABA47489.1| Outer-membrane lipoprotein carrier protein precursor [Burkholderia
           pseudomallei 1710b]
 gi|121228957|gb|ABM51475.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei SAVP1]
 gi|124291981|gb|ABN01250.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei NCTC 10229]
 gi|126226032|gb|ABN89572.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 1106a]
 gi|126244152|gb|ABO07245.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei NCTC 10247]
 gi|134248245|gb|EBA48328.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 305]
 gi|147746635|gb|EDK53712.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei FMH]
 gi|147751614|gb|EDK58681.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei JHU]
 gi|148025377|gb|EDK83531.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei 2002721280]
 gi|157809118|gb|EDO86288.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 406e]
 gi|157939522|gb|EDO95192.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160696463|gb|EDP86433.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei ATCC 10399]
 gi|169652775|gb|EDS85468.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei S13]
 gi|217395797|gb|EEC35814.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 576]
 gi|225934057|gb|EEH30042.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei Pakistan 9]
 gi|238525429|gb|EEP88857.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei GB8 horse 4]
 gi|242139920|gb|EES26322.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 1106b]
 gi|243065390|gb|EES47576.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           mallei PRL-20]
 gi|254220570|gb|EET09954.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 1710a]
          Length = 238

 Score = 84.9 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 50/192 (26%), Gaps = 21/192 (10%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----------------YVMKGEFFMARPS 72
                   ++       +   +G F Q+                       G F  +RP 
Sbjct: 40  SHAFASGTEQLKAFVAKVHAAKGEFTQQIVKAPPKAASGAVPTVKPTDNSSGSFVFSRPG 99

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVIFSNNQHVIQES 127
           KF + Y  P    L +DG  + VY+  L+  +            A  +  SN+       
Sbjct: 100 KFIWTYQKPYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSNDLDKNYTL 159

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
               E                    +     +  L   ++ D     +++     + N  
Sbjct: 160 RDAGEKGGIDWLEMVPKAQDTQFQRIGIGFRNGMLAAMELHDVFGNVTLLTFTNIQTNPP 219

Query: 188 LDPKVFEIPYDK 199
           L    F+    K
Sbjct: 220 LKADQFKFVVPK 231


>gi|296112926|ref|YP_003626864.1| outer membrane lipocarrier protein LolA [Moraxella catarrhalis RH4]
 gi|295920620|gb|ADG60971.1| outer membrane lipocarrier protein LolA [Moraxella catarrhalis RH4]
          Length = 222

 Score = 84.9 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 27/189 (14%), Positives = 62/189 (32%), Gaps = 8/189 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE----DAGYVMKGEFFMARPSKF 74
            A+     A   ++ Q+ K        I++M   F Q     +      G   + R ++F
Sbjct: 27  VALTTVAHAAAASQSQATKNLNSQLSGIRSMTANFSQTTQAGNKKTNFTGMMGVQRQNQF 86

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSVIFSNNQHVIQESIQR 130
            ++  SP+   ++++G+ + +Y+  L   +   +          ++  +   + +     
Sbjct: 87  RWETKSPAEQLIVANGNTMWIYDKDLQQATRQSVGSQIGEVPALLLSGDPSQIDRHFNVS 146

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
               N    I        N  S++      R +   + DS  + + I+      N  L  
Sbjct: 147 QPDANKNYFILTPKSSNANFGSLSLSFNGGRPVMMVLQDSLGQTTTIQFSNIALNKKLPA 206

Query: 191 KVFEIPYDK 199
             F      
Sbjct: 207 TQFNFTPPN 215


>gi|126642760|ref|YP_001085744.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           baumannii ATCC 17978]
          Length = 210

 Score = 84.9 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 31/199 (15%), Positives = 64/199 (32%), Gaps = 22/199 (11%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-----------------GYVMKGE 65
            F A     + Q++   +     +Q +   F Q                        KG 
Sbjct: 5   AFAAPVAAPEQQAIGNLVNQLSGLQRLTADFEQTTKANTKTVAQKKGLSAQHMNQTFKGS 64

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW-----SVYPLRYMAFSVIFSNN 120
             + RP KFY++  SPS  ++++ G  + +Y+  L                A  +  + N
Sbjct: 65  MKVERPGKFYWETVSPSKQTIVTSGKTVWIYDPDLQQAVRQSLDDQVADTPALLLSGNTN 124

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
           Q +    + + + +  + T+F K +             +       + DS  + + ++  
Sbjct: 125 QIMKSYRVTQPDKSKLYFTLFPKKEDGAFQSLTISFGANKAPTLMVLQDSLGQTTYVRFK 184

Query: 181 KYKENTVLDPKVFEIPYDK 199
             K N  +    F     K
Sbjct: 185 NVKVNASIPASTFNFTPPK 203


>gi|85858682|ref|YP_460884.1| outer membrane lipoprotein carrier protein [Syntrophus
           aciditrophicus SB]
 gi|85721773|gb|ABC76716.1| outer membrane lipoprotein carrier protein [Syntrophus
           aciditrophicus SB]
          Length = 237

 Score = 84.9 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 25/212 (11%), Positives = 69/212 (32%), Gaps = 20/212 (9%)

Query: 7   KSVIGVVILFFYSA--IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA------ 58
           + ++ V++     +       AA P++    + +    +   + ++ +F+QE +      
Sbjct: 17  RIILSVLVFLGILSWGSGSLQAAEPLSLSALISRMQVAYERTRDLKASFIQEVSLKSMGR 76

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM------- 111
               +G  ++  P +  + Y  P    L+ +     +Y  +     V     +       
Sbjct: 77  AEREEGILYLKNPKRMLWDYHKPQMKKLVVNPQKAWLYVPEDHVVYVQNADQIFKSKMAV 136

Query: 112 -----AFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWK 166
                   +    +           E N     +  +     + +++T D+ SY+++   
Sbjct: 137 RFLSGMGKLQEDFSIRFAASGAVDKEGNYQLTLVPKRPGLGTDQLNLTVDKKSYQIIEGS 196

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
             D+    + I+    + N  L   +F     
Sbjct: 197 FTDTYGNETRIQFRNIRVNNRLSDSLFNFRVP 228


>gi|300024805|ref|YP_003757416.1| outer membrane lipoprotein carrier protein LolA [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526626|gb|ADJ25095.1| outer membrane lipoprotein carrier protein LolA [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 251

 Score = 84.9 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 45/171 (26%), Positives = 80/171 (46%), Gaps = 5/171 (2%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFMARPSKFYFKYSSPSSVSLIS 88
             + + VK+  ++F S+Q ++G F+Q D     MKG+FF+ RP +F F YS PS   +IS
Sbjct: 70  AEQTKLVKQVSDYFGSVQGLKGAFVQVDADNKRMKGKFFVKRPGRFRFDYSLPSKQIIIS 129

Query: 89  DGSNIAVYNAKLDTWSVYPLRYMAF-SVIFSNNQHVIQESIQRVESNNSFITI--FFKDD 145
           DG N+A+ +  L+      L    F  ++  +   +    I  V+  +  I +    KD 
Sbjct: 130 DGENLAIQDLDLNNEDRVSLDQTPFRMLLRKDVDLLRDAKITEVQQADDLIVLGLEDKDP 189

Query: 146 FMGNMISVTFDRLS-YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
                I +         L  W   D+    + +++L  +++  LD  +F+I
Sbjct: 190 DAPGKIKLYLATKPNIELKEWVTTDAQGLNTRVELLGLEKSNDLDSNLFKI 240


>gi|325982388|ref|YP_004294790.1| outer membrane lipoprotein carrier protein LolA [Nitrosomonas sp.
           AL212]
 gi|325531907|gb|ADZ26628.1| outer membrane lipoprotein carrier protein LolA [Nitrosomonas sp.
           AL212]
          Length = 207

 Score = 84.9 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 21/194 (10%), Positives = 56/194 (28%), Gaps = 12/194 (6%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------VMKGEFFMAR 70
                        + +  ++          +T++  F Q              G     R
Sbjct: 6   CSIFFLLLTLIPVLAEATAINSLKTFIHETRTVRAKFSQTLYDKNSRAIQESTGTMQFER 65

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQE 126
           P KF + Y  P    ++ +G+ +  Y+  L+  ++            +++  ++      
Sbjct: 66  PEKFRWTYEEPYEQLIVGNGTQVWFYDPDLNQVTIRQFSIAIGSSPAALLAGSSTIEDNF 125

Query: 127 SIQRVESNNS--FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
            +  +   N   ++    K                  L    + DS  + + +   +  +
Sbjct: 126 ELVELGMQNEMEWLEAIPKSKESAFEFIQMGFSPEGELKIMALRDSFGQTTFLSFSELDK 185

Query: 185 NTVLDPKVFEIPYD 198
           N  L  ++F+    
Sbjct: 186 NPTLPTELFKFTPP 199


>gi|319761901|ref|YP_004125838.1| outer membrane lipoprotein carrier protein lola [Alicycliphilus
           denitrificans BC]
 gi|317116462|gb|ADU98950.1| outer membrane lipoprotein carrier protein LolA [Alicycliphilus
           denitrificans BC]
          Length = 210

 Score = 84.9 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 31/186 (16%), Positives = 59/186 (31%), Gaps = 18/186 (9%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQEDA----------GYVMKGEFFMARPSKFYFKYSS 80
                +K   +   +  + +  F Q               +  G F   RP +F F Y  
Sbjct: 17  ASADGLKSLEQFMAAAHSGRADFTQTVTAPAKDGQAQRPKLSSGSFEFQRPGRFKFVYKK 76

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHV----IQESIQRVE 132
           P   ++++DG  + +Y+A L+  +  P          +++ S           +     E
Sbjct: 77  PFEQTIVADGKTLWLYDADLNQVTERPQAQALGSTPAALLTSAPDLAALRADYQLQSAPE 136

Query: 133 SNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
            +     +       G + SV       RL    I+D   + S I+    + N  L    
Sbjct: 137 QDGLQWVLATPKASEGQLKSVRVGFEGDRLAALDIVDGFGQRSQIRFSGMQINPALPAGT 196

Query: 193 FEIPYD 198
           F+    
Sbjct: 197 FQFKPP 202


>gi|160900794|ref|YP_001566376.1| outer membrane lipoprotein carrier protein LolA [Delftia
           acidovorans SPH-1]
 gi|160366378|gb|ABX37991.1| outer membrane lipoprotein carrier protein LolA [Delftia
           acidovorans SPH-1]
          Length = 211

 Score = 84.9 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 31/212 (14%), Positives = 64/212 (30%), Gaps = 28/212 (13%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA------- 58
            K ++  V++          A+   +    +K       + Q  +  F Q          
Sbjct: 1   MKRLLTAVVI---------AASATASWADGLKSLEAFMKNSQAGRAEFTQAVTAPSKDGQ 51

Query: 59  ---GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM---- 111
                   G+F   RP KF F Y+ P   ++++DG  + +Y+A L+  +  P        
Sbjct: 52  PPRTKNSSGQFEFQRPGKFRFVYTKPFEQTIVADGKTLWLYDADLNQVTQRPQAQALGST 111

Query: 112 ---AFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTF--DRLSYRLLNWK 166
                +             +Q     +    +          +           +L    
Sbjct: 112 PAAILASANDLKALSADFDLQSAPEQDGLQWVQASPKDKNGQLKSVRVGFAADGQLSALD 171

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           I+DS  + S+I+  + +    L    F+    
Sbjct: 172 ILDSFGQRSLIRFNQLQTQASLPASTFDFKVP 203


>gi|294085376|ref|YP_003552136.1| outer membrane lipoprotein carrier protein LolA [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664951|gb|ADE40052.1| outer membrane lipoprotein carrier protein LolA [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 195

 Score = 84.9 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 34/193 (17%), Positives = 70/193 (36%), Gaps = 8/193 (4%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKG 64
            K +   ++     +I     +       +V  A + F  + TMQ  F Q    G   +G
Sbjct: 1   MKRLSSGLV----FSIIVMQMSLVAQAADAVSAAEDWFADLTTMQADFTQISSDGSAAEG 56

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQH-- 122
             ++ RP +   +Y    ++ LI+    + V   K    + YP+   A S+I        
Sbjct: 57  TLYLRRPHRMKIEYDGDDALVLITTPVWLHVDQPKQKRVTSYPISETALSLILKEKVVLR 116

Query: 123 -VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
               ++  RV    + I +  +       +++ F    ++L  W + DS    + + +  
Sbjct: 117 ADDFQTSARVADGIATIYLSKESGEAAGDLALEFSLQPFQLRKWTVRDSVGVTTSVTLQN 176

Query: 182 YKENTVLDPKVFE 194
            K       ++F 
Sbjct: 177 MKFGLTFRNELFR 189


>gi|159042614|ref|YP_001531408.1| outer membrane lipoprotein carrier protein [Dinoroseobacter shibae
           DFL 12]
 gi|157910374|gb|ABV91807.1| outer membrane lipoprotein carrier protein [Dinoroseobacter shibae
           DFL 12]
          Length = 234

 Score = 84.9 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 34/197 (17%), Positives = 69/197 (35%), Gaps = 9/197 (4%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMK 63
           + +     + L    A               + +   +   +  +Q  F Q    G    
Sbjct: 34  MNRRQFTALTL----AGLATPGLARAASLIPLPEIAAYLRGLDLVQARFTQRNADGSTST 89

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN-AKLDTWSVYPLRYMAFSVIFSNNQH 122
           G  ++ RP +  F+Y  P+ V ++  G  +A+++     T   YPLR    +VI S    
Sbjct: 90  GTLYLRRPGRARFEYDPPAEVLVMVGGGTVAIFDAKGDPTPESYPLRRTPLNVILSREVD 149

Query: 123 ---VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
                     +++ + + +            I++ F     RL  W I+  +   ++I++
Sbjct: 150 LEGSDAIFGHQLDGDLTTVLAHDPAHPEYGRIALQFAADPVRLARWVIVGETGEQTVIEL 209

Query: 180 LKYKENTVLDPKVFEIP 196
                   L   +F IP
Sbjct: 210 GPLTRPAQLSSNLFNIP 226


>gi|254456048|ref|ZP_05069477.1| outer membrane lipoprotein carrier protein [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207083050|gb|EDZ60476.1| outer membrane lipoprotein carrier protein [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 181

 Score = 84.9 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 38/185 (20%), Positives = 77/185 (41%), Gaps = 4/185 (2%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKF 74
           +F Y  I  F      +K +  +K IE+  +++ ++  F Q   G +  G   +  P K 
Sbjct: 1   MFKYILILIFFVLISNSKAEIKEKIIENLQNVENLKFKFEQNINGKIENGICTIKYPKKI 60

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESN 134
           Y KYS  + + + +  S +        ++  Y L+    ++I   N  + + +  +    
Sbjct: 61  YCKYSKNNKILVSNGKSLVI---KTETSFYRYSLKKTPLNLILDKNFLIKKINFLKENII 117

Query: 135 NSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
           +  + I +      N I V FD  ++ L+ WK  D  +  +I  +   + N  +   +F+
Sbjct: 118 DKNL-INYTIVENDNEIDVFFDIKTFNLVGWKTRDIYQNTNITYLSSIETNKEITKNLFK 176

Query: 195 IPYDK 199
           IP   
Sbjct: 177 IPSQN 181


>gi|325266750|ref|ZP_08133424.1| outer membrane lipoprotein carrier protein LolA [Kingella
           denitrificans ATCC 33394]
 gi|324981798|gb|EGC17436.1| outer membrane lipoprotein carrier protein LolA [Kingella
           denitrificans ATCC 33394]
          Length = 205

 Score = 84.9 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 24/203 (11%), Positives = 57/203 (28%), Gaps = 15/203 (7%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED----AGY 60
           + K+                       +  ++    +       + G F Q         
Sbjct: 1   MMKNWKTA------FGTAIVCLMAAQAQAGAIDALKQFNSDADGISGNFTQTVRARNKNQ 54

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSVI 116
              G F + RP  F + Y+ P    ++ DGS+I +Y+  L   +             +++
Sbjct: 55  TASGTFQILRPGLFKWSYTRPYKQVIVGDGSHIWLYDMDLKQVTRSNQDQTIGDSPAAIL 114

Query: 117 FSNNQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
            + +      +++   + N     +            +        L   ++ DS    +
Sbjct: 115 SNKSALESSYTLKEDGNKNGIDYVLATPRKNNAGYQFIRIGFKGNALAAMELKDSFGNQT 174

Query: 176 IIKILKYKENTVLDPKVFEIPYD 198
            I+  +      L    F+    
Sbjct: 175 TIQFNQLNTKPNLSRSAFKFTPP 197


>gi|258593355|emb|CBE69694.1| putative Outer-membrane lipoprotein carrier protein precursor [NC10
           bacterium 'Dutch sediment']
          Length = 240

 Score = 84.5 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 27/188 (14%), Positives = 60/188 (31%), Gaps = 17/188 (9%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM------KGEFFMARPSKFYFKYSSP 81
             +T D+   K    +     +QG+F Q     +        G  F+  P +  ++Y  P
Sbjct: 39  SALTADEVADKVQATYQGFSDLQGSFFQRATNKLSGMTQEASGRLFLKWPGRMRWEYEKP 98

Query: 82  SSVSLISDGSNIAVYNAKLDT-----------WSVYPLRYMAFSVIFSNNQHVIQESIQR 130
            S   + DG  +  Y+                 +   + +   ++        I  +  R
Sbjct: 99  ESRLFLIDGKTLWSYSPSERQAIAQDVSGALTTTPIGILFGMSNLRRDFQVRPIVHAGIR 158

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
             S +               + +  DR S+ +    + D     + +++ K   N+ L  
Sbjct: 159 DSSESILELTPKGKGLAFKRVILGVDRASFLIRRLTVFDLYGNTTTVELSKQTVNSNLKD 218

Query: 191 KVFEIPYD 198
           ++F+    
Sbjct: 219 ELFQFSPP 226


>gi|121998176|ref|YP_001002963.1| outer membrane lipoprotein carrier protein LolA [Halorhodospira
           halophila SL1]
 gi|189028553|sp|A1WWU9|LOLA_HALHL RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|121589581|gb|ABM62161.1| outer membrane lipoprotein carrier protein LolA [Halorhodospira
           halophila SL1]
          Length = 208

 Score = 84.5 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 30/181 (16%), Positives = 71/181 (39%), Gaps = 13/181 (7%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSPS 82
              +   ++   +++  ++T+QG F Q              G+F + RP +F++ Y+ P 
Sbjct: 17  NTAQAGQLQALEDYYRDVETVQGVFNQFTLDDRGQVIEESSGDFAIHRPDRFHWSYAGPF 76

Query: 83  SVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQESIQRVESNNSFI 138
           S  +I+DG  + VY+ +LD  +V   R         ++  +   + +        +   +
Sbjct: 77  SQEIIADGERLWVYDVELDQVTVRDQRAVLGSAPAQLLSGDYADLEELFELAETEDYVRL 136

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           T     +          D     L   +I D+  + + +++ + + N  +D + F     
Sbjct: 137 TPRDGGEAFDEARLGMRDGHPSAL---EIDDALGQVTRVELDEVRLNDAVDEERFRFEPP 193

Query: 199 K 199
           +
Sbjct: 194 E 194


>gi|167895449|ref|ZP_02482851.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei 7894]
 gi|237813405|ref|YP_002897856.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei MSHR346]
 gi|254181007|ref|ZP_04887605.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 1655]
 gi|184211546|gb|EDU08589.1| outer membrane lipoprotein carrier protein LolA [Burkholderia
           pseudomallei 1655]
 gi|237506051|gb|ACQ98369.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei MSHR346]
          Length = 236

 Score = 84.5 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 50/192 (26%), Gaps = 21/192 (10%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----------------YVMKGEFFMARPS 72
                   ++       +   +G F Q+                       G F  +RP 
Sbjct: 38  SHAFASGTEQLKAFVAKVHAAKGEFTQQIVKAPPKAASGAVPTVKPTDNSSGSFVFSRPG 97

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVIFSNNQHVIQES 127
           KF + Y  P    L +DG  + VY+  L+  +            A  +  SN+       
Sbjct: 98  KFIWTYQKPYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSNDLDKNYTL 157

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
               E                    +     +  L   ++ D     +++     + N  
Sbjct: 158 RDAGEKGGIDWLEMVPKAQDTQFQRIGIGFRNGMLAAMELHDVFGNVTLLTFTNIQTNPP 217

Query: 188 LDPKVFEIPYDK 199
           L    F+    K
Sbjct: 218 LKADQFKFVVPK 229


>gi|167903835|ref|ZP_02491040.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei NCTC 13177]
          Length = 238

 Score = 84.5 bits (207), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 50/192 (26%), Gaps = 21/192 (10%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----------------YVMKGEFFMARPS 72
                   ++       +   +G F Q+                       G F  +RP 
Sbjct: 40  SHAFASGTEQLKAFVAKVHAAKGEFTQQIVKAPPKAASGAMPTVKPTDNSSGSFVFSRPG 99

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVIFSNNQHVIQES 127
           KF + Y  P    L +DG  + VY+  L+  +            A  +  SN+       
Sbjct: 100 KFIWTYQKPYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSNDLDKNYTL 159

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
               E                    +     +  L   ++ D     +++     + N  
Sbjct: 160 RDAGEKGGIDWLEMVPKAQDTQFQRIGIGFRNGMLAAMELHDVFGNVTLLTFTNIQTNPP 219

Query: 188 LDPKVFEIPYDK 199
           L    F+    K
Sbjct: 220 LKADQFKFVVPK 231


>gi|332306868|ref|YP_004434719.1| outer membrane lipoprotein carrier protein LolA [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332174197|gb|AEE23451.1| outer membrane lipoprotein carrier protein LolA [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 220

 Score = 84.5 bits (207), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 63/204 (30%), Gaps = 10/204 (4%)

Query: 6   YKSVIGVVILFFYSAIFPFN---AAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG--- 59
            K +     L   SAI       A     +     K      ++      F Q+      
Sbjct: 8   MKKMKYSSALGKVSAILCLAMGLAFSAYAQQSDEDKLKTRLETLNYFSADFTQKVTDANH 67

Query: 60  ---YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVI 116
                  G   + +P+K Y++   P+   LI+DG+ +   +  ++  +         +  
Sbjct: 68  EVLQEATGVIKLKQPNKLYWELDPPNENILIADGTTLWNVDPFVEQVTAINQSQAVANNP 127

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNM-ISVTFDRLSYRLLNWKIMDSSRRYS 175
                    ++       ++  T         +   S+       +L +  + DS ++ S
Sbjct: 128 LILLTQPNSDAWGDFTVTHTNDTFRIDAKSPDSAVHSLVLVFDGEQLSSMSMQDSQQQIS 187

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
            +     ++N  L  +VF     +
Sbjct: 188 DLYFDNIQQNKALSDEVFTFTLPE 211


>gi|320106588|ref|YP_004182178.1| outer membrane lipoprotein carrier protein LolA [Terriglobus
           saanensis SP1PR4]
 gi|319925109|gb|ADV82184.1| outer membrane lipoprotein carrier protein LolA [Terriglobus
           saanensis SP1PR4]
          Length = 218

 Score = 84.2 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 29/203 (14%), Positives = 66/203 (32%), Gaps = 12/203 (5%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----Y 60
           + + V  + +   + AI P   A      +   +   H+  + +++  + +  +G     
Sbjct: 1   MKEKVRSLWLFCAFLAISPLLCAQSPDLHEIAGRVDAHYNHLTSLKLDYTERYSGMGQTR 60

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY-----MAFSV 115
           V  G   + +P +  + Y+SP+    I +      Y            +           
Sbjct: 61  VETGTLLLKKPGRMRWNYASPAGKVFILNSKYAWFYTPGDPQAQRVAAKQLDDLRSPLRF 120

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTF---DRLSYRLLNWKIMDSSR 172
           +    +   + +   +ES+ +   I      M   I+      +  +  L   KI D+  
Sbjct: 121 LLGRLKIEKELTNLTIESSQNSAKIKGVPKGMEQRINAMTLACNTPTGILTGLKIEDADG 180

Query: 173 RYSIIKILKYKENTVLDPKVFEI 195
             +       +EN  L+   FE 
Sbjct: 181 SITEFSFTNLQENVPLNDADFEF 203


>gi|323525158|ref|YP_004227311.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           CCGE1001]
 gi|323382160|gb|ADX54251.1| outer membrane lipoprotein carrier protein LolA [Burkholderia sp.
           CCGE1001]
          Length = 247

 Score = 84.2 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/209 (15%), Positives = 57/209 (27%), Gaps = 28/209 (13%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-----DAGYVMKG--------- 64
            AI               ++       + + +GTF+Q+            G         
Sbjct: 32  LAIGASMLVASQAFASGTEQLKAFVAQVHSARGTFVQQEVRAPSKAQAASGASGVLSTNG 91

Query: 65  ---------EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRY 110
                     F  ARP KF ++Y  P +  L +DG  + VY+  L+  +V          
Sbjct: 92  GGKSSTSSGTFTFARPGKFIWQYEKPYAQLLQADGDKLYVYDKDLNQVTVRSLGGALGAS 151

Query: 111 MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
            A  +  SN+                                V        L   ++ D 
Sbjct: 152 PAAILFGSNDLDKNFTLRDAGVKAGIDWLELTPKTRDTQFQRVGIGFKDGNLQAMELHDV 211

Query: 171 SRRYSIIKILKYKENTVLDPKVFEIPYDK 199
               +++     ++N  L    F+    K
Sbjct: 212 FGNVTLLTFSNIQKNPPLPADAFKFTVPK 240


>gi|323697858|ref|ZP_08109770.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio sp.
           ND132]
 gi|323457790|gb|EGB13655.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           desulfuricans ND132]
          Length = 230

 Score = 84.2 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/219 (11%), Positives = 68/219 (31%), Gaps = 24/219 (10%)

Query: 5   LYKSVIGVVILFFYSAI-FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG---- 59
           + +  + V ++     +     AA PI          + + +++T +  F QE       
Sbjct: 1   MSRLSVAVFVMVSCLLLPVLAGAAEPIPAQDLPDLIQKRYETLKTFRADFSQELTNVASG 60

Query: 60  --YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAK------------LDTWSV 105
                +G+ +  +PS+  ++ S+P    L+        Y               LD+ ++
Sbjct: 61  EVDKREGKIWFRQPSQVRWETSAPEKELLVVGPEFAWDYIPDEELAIKYGVAALLDSKTI 120

Query: 106 YPLRYMAFSVIFSNNQHVIQESIQRVESNNS-----FITIFFKDDFMGNMISVTFDRLSY 160
                   ++               V +           +  + +    +  V  +  + 
Sbjct: 121 LRFLSGQANIKEDFVVKTEWPGADEVRAKWGKDLTVLQLVPKEAEPGMVLAFVGVEPATG 180

Query: 161 RLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            L    I+D     + +++   + +  L P +F     +
Sbjct: 181 LLRQVMIVDFYGNGNEVRLSNVETDVDLAPDMFTFTPPE 219


>gi|264677022|ref|YP_003276928.1| outer membrane lipoprotein carrier protein LolA [Comamonas
           testosteroni CNB-2]
 gi|262207534|gb|ACY31632.1| outer membrane lipoprotein carrier protein LolA [Comamonas
           testosteroni CNB-2]
          Length = 211

 Score = 84.2 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/213 (13%), Positives = 58/213 (27%), Gaps = 28/213 (13%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K ++  +++           +        +K       + Q  +  F Q          
Sbjct: 1   MKRLLTAILI---------AGSASAAMADGLKSLESFMKNAQAGKADFTQSVTSPPKSGQ 51

Query: 60  ----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----- 110
                V  G F   RP KF F Y+ P    +++DG  + +Y+A L+  +           
Sbjct: 52  EARTKVSSGSFEFQRPGKFRFNYTKPFEQLIVADGKTLWLYDADLNQVTERAQAQVLGST 111

Query: 111 --MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYR--LLNWK 166
                +             +      +    +       G  +       +    L    
Sbjct: 112 PAAILTSATDLKALKADFELGNQPDADGLEWVLASPRQKGGQLKSVRIGFTPEGKLAALD 171

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           I DS  + S+++    +    L    F     K
Sbjct: 172 IEDSFGQRSLMQFKGLQTQASLPASTFHFTVPK 204


>gi|303248053|ref|ZP_07334319.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           fructosovorans JJ]
 gi|302490610|gb|EFL50515.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           fructosovorans JJ]
          Length = 225

 Score = 84.2 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/216 (11%), Positives = 54/216 (25%), Gaps = 20/216 (9%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM-- 62
           + K    + + F  +       A  +   +   +    + +I     +F Q         
Sbjct: 1   MKKRAFFLAVCFVLA---TAATARAVDPTELAGRIQNKYATINAFSASFTQAIRNAASGD 57

Query: 63  ----KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY-----PLRYMAF 113
                G FF  +P    ++   P    LI     +  Y  +      Y            
Sbjct: 58  TEHRSGSFFFKKPVLVRWETVKPEKELLIVGKDAVWDYFEEDKEAYRYAVKEIISSKTML 117

Query: 114 SVIFSNNQHVIQESIQRVESNN------SFITIFFKDDFMGNMISVTFDRLSYRLLNWKI 167
             +           +   ++++             + +    M  V  D  +  +    I
Sbjct: 118 RFLTGKANLTEDFFVAAGKASDAGPGQAVLDLAPREPEPGLVMARVWVDLSTDMIARVFI 177

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            D     + + +     N  L   +F     K   +
Sbjct: 178 QDFYANTNDLTLTGVAVNPKLADTLFTFTPPKDAKV 213


>gi|89092933|ref|ZP_01165885.1| periplasmic chaperone LolA [Oceanospirillum sp. MED92]
 gi|89082958|gb|EAR62178.1| periplasmic chaperone LolA [Oceanospirillum sp. MED92]
          Length = 218

 Score = 83.8 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/207 (12%), Positives = 65/207 (31%), Gaps = 12/207 (5%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED------ 57
           +L+      V+    +A+   +++         +K  E     Q+    F+Q        
Sbjct: 1   MLFNHFKKAVVRSSIAAMVLASSSLVNAASDGAEKLKEMLNGYQSFSTNFVQVTLAENGR 60

Query: 58  AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAF 113
                +G   +A+P+ F ++   P    ++SDG  I +++  L+  +             
Sbjct: 61  EAQKTEGSLKLAKPNLFRWETQQPFPQEIVSDGQYIWIHDPDLEQVTRRSADSSQGSAPA 120

Query: 114 SVIFSNNQHVIQESIQRVESNNSF--ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS 171
            ++      + Q    R+  ++    +          N   +     +  +    + D+ 
Sbjct: 121 LILNGQIDTLRQTYNIRLVDDSGSEQLFDLQPVSDQHNFSRIRLAFANQIISEIMLEDAL 180

Query: 172 RRYSIIKILKYKENTVLDPKVFEIPYD 198
            + + +     + N   D   F     
Sbjct: 181 GQRTSVVFNDQELNPDFDKTAFLFRVP 207


>gi|167846875|ref|ZP_02472383.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei B7210]
 gi|167920075|ref|ZP_02507166.1| outer-membrane lipoprotein carrier protein [Burkholderia
           pseudomallei BCC215]
          Length = 242

 Score = 83.8 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 50/192 (26%), Gaps = 21/192 (10%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----------------YVMKGEFFMARPS 72
                   ++       +   +G F Q+                       G F  +RP 
Sbjct: 44  SHAFASGTEQLKAFVAKVHAAKGEFTQQIVKAPPKAASGAVPTVKPTDNSSGSFVFSRPG 103

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVIFSNNQHVIQES 127
           KF + Y  P    L +DG  + VY+  L+  +            A  +  SN+       
Sbjct: 104 KFIWTYQKPYQQVLQADGDKLYVYDKDLNQVTERKLAGALGASPAAILFGSNDLDKNYTL 163

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
               E                    +     +  L   ++ D     +++     + N  
Sbjct: 164 RDAGEKGGIDWLEMVPKAQDTQFQRIGIGFRNGMLAAMELHDVFGNVTLLTFTNIQTNPP 223

Query: 188 LDPKVFEIPYDK 199
           L    F+    K
Sbjct: 224 LKADQFKFVVPK 235


>gi|332535767|ref|ZP_08411509.1| outer membrane lipoprotein carrier protein LolA [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332034835|gb|EGI71369.1| outer membrane lipoprotein carrier protein LolA [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 208

 Score = 83.8 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/204 (11%), Positives = 65/204 (31%), Gaps = 17/204 (8%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM--- 62
            K V  ++++         +     +     +   +   ++++ +  F Q+         
Sbjct: 1   MKKVNALLLVL-------GSVLAAPSFADDSQALQDRLATLKSFKAQFAQQVTDKEGQAV 53

Query: 63  ---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN----AKLDTWSVYPLRYMAFSV 115
              +G   + +P    ++ ++P     +S+G     ++          +   +    F +
Sbjct: 54  MQGEGTIALQQPMMIRWQQTNPDDTLFVSNGDKTYYFDSFAEQVTIMKTSSLIDSTPFVL 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           + S +    ++      S    +T     +     + + F      L    + D+S + S
Sbjct: 114 LTSKDPAQWEKYSVLATSTGFSVTPNKGVESQVEQLDIAFAGNEQGLAKLVVTDNSGQLS 173

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
                  + NT LD   FE    +
Sbjct: 174 SFTFNNAQVNTPLDQSTFEFTPPE 197


>gi|167041847|gb|ABZ06588.1| putative Outer membrane lipoprotein carrier protein LolA
           [uncultured marine microorganism HF4000_097M14]
          Length = 192

 Score = 83.8 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/190 (18%), Positives = 68/190 (35%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMA 69
           +   + F  +  F +  +  ++     K  I    +I+T+   F Q+ +     G  F+ 
Sbjct: 1   MTKKLFFLLNIFFIYLFSAGVSSADLQKDLINKLTAIKTLSFDFKQKISDKEEIGNCFIK 60

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQ 129
            P      Y +    ++IS+G  +A+   K      YP++      I    + +      
Sbjct: 61  YPLLMKCNYQNLKQKTIISNGKTVAIIKKKYKKIYYYPIKSTPLFFILKKEKIINLIRKN 120

Query: 130 RVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLD 189
                N+ +  F   D   N + + FD+ S     WK  D         I   K N  + 
Sbjct: 121 LPTEINAGLIEFEFIDQKTNKVKILFDKNSLEFKGWKTKDVYSNNVSFTINNLKINNQII 180

Query: 190 PKVFEIPYDK 199
              F+IP ++
Sbjct: 181 DDFFKIPKEE 190


>gi|114769831|ref|ZP_01447441.1| Putative outer membrane lipoprotein carrier protein [alpha
           proteobacterium HTCC2255]
 gi|114549536|gb|EAU52418.1| Putative outer membrane lipoprotein carrier protein [alpha
           proteobacterium HTCC2255]
          Length = 210

 Score = 83.4 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/203 (18%), Positives = 86/203 (42%), Gaps = 6/203 (2%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKG 64
            K ++ + ILF    I  F       +  S+    ++   ++ ++  F Q    G +  G
Sbjct: 8   IKMMLKIKILFKVLFITCFMTHPSFAEKISLSNISDYINELKMVEADFEQINSDGSIDAG 67

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNI-AVYNAKLDTWSVYPLRYMAFSVIFSNNQHV 123
           + ++ RP K   +Y +P++  +I+   N+    +   +  +++PL+    +++   + ++
Sbjct: 68  KLYIRRPGKMRLEYEAPNNALVIAGAGNVAIFDDKTKNGPTIFPLKKTPLNLLLKKDVNL 127

Query: 124 IQESI---QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
           I+  +      ++ N+FI +          I + F      L +W I + S + + I + 
Sbjct: 128 IKNKMVSEHTEKNKNTFIVVQDPKRLSQGKIKMVFSNQPILLESWTITNQSNQKTKIMLN 187

Query: 181 KYKENTVLDPKVFEI-PYDKIHN 202
             +E   +   +F I    KI N
Sbjct: 188 NLREVATIPLYLFNISAASKIKN 210


>gi|221068785|ref|ZP_03544890.1| outer membrane lipoprotein carrier protein LolA [Comamonas
           testosteroni KF-1]
 gi|220713808|gb|EED69176.1| outer membrane lipoprotein carrier protein LolA [Comamonas
           testosteroni KF-1]
          Length = 211

 Score = 83.4 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/213 (13%), Positives = 57/213 (26%), Gaps = 28/213 (13%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K ++  +++           +        +K       + Q  +  F Q          
Sbjct: 1   MKRLLTAILIV---------GSASAAMADGLKSLESFMKNAQAGKADFTQSVTSPPKSGQ 51

Query: 60  ----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----- 110
                V  G F   RP KF F Y+ P    +++DG  + +Y+A L+  +           
Sbjct: 52  EARTKVSSGSFEFQRPGKFRFNYTKPFEQLIVADGKTLWLYDADLNQVTERAQAQVLGST 111

Query: 111 --MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYR--LLNWK 166
                +             +           +       G  +       +    L    
Sbjct: 112 PAAILTSATDLKALKADFELGNQPDAEGLEWVLASPRQKGGQLKSVRIGFTPEGKLAALD 171

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           I DS  + S+++    +    L    F     K
Sbjct: 172 IEDSFGQRSLMQFKGLQTQASLPASTFHFTVPK 204


>gi|262369372|ref|ZP_06062700.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           johnsonii SH046]
 gi|262315440|gb|EEY96479.1| outer-membrane lipoproteins carrier protein [Acinetobacter
           johnsonii SH046]
          Length = 232

 Score = 83.4 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/199 (14%), Positives = 65/199 (32%), Gaps = 23/199 (11%)

Query: 24  FNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA------------------GYVMKGE 65
           F A    ++ Q+    ++    IQ++   F Q                         KG 
Sbjct: 27  FAAPVAASEQQATTSLVKQLSGIQSISSNFEQTTKVTNSSKAPKKQGLSAQHMNQTFKGV 86

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQ 121
             + RP KFY++ +SP+  ++++ G  + +Y+  L           +      ++  N +
Sbjct: 87  MKVERPGKFYWETTSPAKQTIVTSGKTVWIYDPDLQQAVRQTLDEQVANTPALLLSGNTE 146

Query: 122 HVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYR-LLNWKIMDSSRRYSIIKIL 180
            + +       + +      +     G   S+T    +        + DS  + + ++  
Sbjct: 147 QIRKSYRITQPNQSKTYYTLYPKSDDGAFQSLTISFGAKNAPTLMILEDSLGQTTYVRFN 206

Query: 181 KYKENTVLDPKVFEIPYDK 199
             K N  +    F     K
Sbjct: 207 NTKVNINIPASTFNFTPPK 225


>gi|77360655|ref|YP_340230.1| periplasmic chaperone effects translocation of lipoproteins from
           inner membrane to outer membrane [Pseudoalteromonas
           haloplanktis TAC125]
 gi|123588241|sp|Q3IH42|LOLA_PSEHT RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|76875566|emb|CAI86787.1| putative periplasmic chaperone effects translocation of
           lipoproteins from inner membrane to outer membrane
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 208

 Score = 83.4 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/204 (12%), Positives = 66/204 (32%), Gaps = 17/204 (8%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM--- 62
            K +  ++++       P             +   +   S+++ +  F Q+         
Sbjct: 1   MKKLNTLLLVLGSLVATPSF-------ADDSQALQDQLASLKSFKAQFSQKVTDKQGQAV 53

Query: 63  ---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN----AKLDTWSVYPLRYMAFSV 115
              +G   + +P    ++ ++P     +S+G     ++          +   +    F +
Sbjct: 54  MQGEGTIALQQPMMIRWQQTNPDDTLFVSNGDKTYYFDSFAEQVTIMQTSSLIDSTPFVL 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           + S +    ++      ++   +T     +     + +TF      L    + D+S + S
Sbjct: 114 LTSKDPAQWEKYSVLATNSGFSVTPNKGVESQVEQLDITFAGNEQGLAKLVVTDNSGQLS 173

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
                  K NT LD   FE    +
Sbjct: 174 SFTFNDAKVNTPLDKSTFEFTPPE 197


>gi|94499676|ref|ZP_01306213.1| outer-membrane lipoprotein carrier protein precursor [Oceanobacter
           sp. RED65]
 gi|94428430|gb|EAT13403.1| outer-membrane lipoprotein carrier protein precursor [Oceanobacter
           sp. RED65]
          Length = 211

 Score = 83.4 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/206 (16%), Positives = 77/206 (37%), Gaps = 16/206 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K V+ +    F   +F          +QS+ K       ++TM+  F Q          
Sbjct: 1   MKDVMKLFSTLFLMLLFL----QAHADEQSLSKLQNVLAPLKTMKAEFKQISEDGRGVVL 56

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSV 115
               G F +++P++FY+K   P +  L+S+G  + VY+  L+  ++  L          +
Sbjct: 57  QTQAGSFVLSKPNRFYWKSEEPFAQLLVSNGETLWVYDEDLEQVTIQKLDPSLTSTPVLL 116

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMIS--VTFDRLSYRLLNWKIMDSSRR 173
           +    + + Q+     ++ +   T        G++ S    +      +    I D   +
Sbjct: 117 LSGTIEDIQQQYKVYSDTTDGKTTFSLLPKETGSLFSRLTLYVDQGSMITGLTIKDEVGQ 176

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            + ++    ++N  +  + F+    +
Sbjct: 177 VTRVEFKNIQKNVEVASEKFQFNPPE 202


>gi|293396839|ref|ZP_06641113.1| outer membrane lipoprotein carrier protein LolA [Serratia odorifera
           DSM 4582]
 gi|291420310|gb|EFE93565.1| outer membrane lipoprotein carrier protein LolA [Serratia odorifera
           DSM 4582]
          Length = 203

 Score = 83.4 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/204 (14%), Positives = 69/204 (33%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K ++    L           A       + +        + +   +F Q   G      
Sbjct: 1   MKKLLVACCLLSGF-------ASTSVLADAAQDLQTRLAKVNSFHASFTQTVTGGDGSAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +GE ++ RP+ F +  +SP    L+SDG  +  YN  ++  +            F +
Sbjct: 54  QQGEGELWVKRPNLFNWHMTSPDESVLVSDGETLWFYNPFVEQVTATWLKSATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  N+    ++   + + ++  +T       +           S  + ++  ++   + S
Sbjct: 114 ITRNSPSDWKQYNIKQKGDDFELTPKSSSGNLKQFAISV--TNSGTIKSFAAVEQDGQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
              +   ++NT +D   F+    K
Sbjct: 172 AYALKS-QQNTTVDAGKFKFTPPK 194


>gi|319404824|emb|CBI78425.1| lipoprotein carrier protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 190

 Score = 83.4 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 48/177 (27%), Positives = 76/177 (42%), Gaps = 3/177 (1%)

Query: 25  NAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSS 83
             +    +    +  I HF +I+ M G F+Q    G + KG F++ RP K  F Y     
Sbjct: 5   AFSQSAKQFARAQNIINHFAAIKVMTGDFIQFNPKGKMTKGTFYLERPGKIRFSY-KGVP 63

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFI-TIFF 142
           + +ISDG ++ V N  L+TWS Y L       +  N  H+  E++     +   I  +  
Sbjct: 64  LQVISDGKSVGVNNRALNTWSFYQLSQTPMKFLLGNVIHLSSENLLAFREDPKTIMIVLR 123

Query: 143 KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                   I + FD  SY L  W I+D     + +KI+  + N      +F IP+  
Sbjct: 124 DKTIGKGQIKMIFDSQSYALRQWAILDQQNLETTVKIMNVRTNVRFSDDMFVIPHKN 180


>gi|119476162|ref|ZP_01616514.1| outer membrane lipoprotein carrier protein LolA [marine gamma
           proteobacterium HTCC2143]
 gi|119450789|gb|EAW32023.1| outer membrane lipoprotein carrier protein LolA [marine gamma
           proteobacterium HTCC2143]
          Length = 202

 Score = 83.4 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 61/192 (31%), Gaps = 12/192 (6%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV------MKGEFFMARPSK 73
                ++     +   V    +    + ++   F Q             +G   + RP K
Sbjct: 1   MFVACSSVTAAAEISPVALLADRLKPMTSLTAAFTQTIRDDRNELMQDAQGTLVLKRPRK 60

Query: 74  FYFKYSSPSSVSLISDGSNIAVYN----AKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQ 129
           FY+    P    +++DG  +  Y+              L      ++  + + + ++   
Sbjct: 61  FYWLTQQPYEHLVVTDGIVLWQYDIDLEQITKQAYTADLDKAPALLLSGDIEEISRQFNI 120

Query: 130 RVESNNSF--ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
            + S NS     I       G    +T       LL+  ++D+  + + I+      N  
Sbjct: 121 EMRSINSVAEQFILTPLVADGLFQKLTIAFDVSGLLSMSLLDNFDQITDIQFSDVVLNPD 180

Query: 188 LDPKVFEIPYDK 199
           +  + FE    +
Sbjct: 181 ISDQQFEFSPPR 192


>gi|283850770|ref|ZP_06368057.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio sp.
           FW1012B]
 gi|283574013|gb|EFC21986.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio sp.
           FW1012B]
          Length = 225

 Score = 83.0 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 21/215 (9%), Positives = 53/215 (24%), Gaps = 19/215 (8%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K+   +V+L    ++     A  +   +   +  + + ++ +    F Q          
Sbjct: 1   MKTFATLVVLGLILSV--AAPARAVEPAELAGRIQKKYATLNSFSAEFSQSIRNAASGDT 58

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFS 114
               G F   +P    ++   P    L+     +  +  +      Y             
Sbjct: 59  ERRSGSFLFKKPVLVRWETVKPEKELLVVGKDAVWDWFEEDREAYRYSVAEVISSKTMLR 118

Query: 115 VIFSNNQHVIQESIQRVESNN------SFITIFFKDDFMGNMISVTFDRLSYRLLNWKIM 168
            +           +   +                + +    M  V  D  +  +    I 
Sbjct: 119 FLTGKANLTEDFLVAPGKPEEAGPGQAVLQLAPREPEPGLVMAKVWVDLATDMIARIYIQ 178

Query: 169 DSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
           D     + + +     N  L   +F     K   +
Sbjct: 179 DFYANTNDLALTGVVANPKLADTLFAFTPPKDAKV 213


>gi|312961668|ref|ZP_07776166.1| Outer-membrane lipoprotein carrier protein [Pseudomonas fluorescens
           WH6]
 gi|311283927|gb|EFQ62510.1| Outer-membrane lipoprotein carrier protein [Pseudomonas fluorescens
           WH6]
          Length = 207

 Score = 83.0 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 59/183 (32%), Gaps = 11/183 (6%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSP 81
                  SV          QT+   F Q              GE  + RP  FY+     
Sbjct: 18  SAHADPASVASLKNLLDKSQTLTARFSQLTLDAGGTQLQETAGEMAVQRPGLFYWHTEGK 77

Query: 82  SSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQHVIQESIQRVESNNSF 137
           +  +++SDG  + +++  L+  +       L      ++  +   +        +  ++ 
Sbjct: 78  AEQTIVSDGQKVTLWDPDLEQATIKKLDPRLNQTPALLLSGDVSKINDSFDITSKQTSNV 137

Query: 138 ITIFFKDDFMGN-MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
           I    K         +++    +  + N +++DS  + + I     K N  +    F+  
Sbjct: 138 IEFTLKPKSKDTLFDTLSLSFGNGVINNMRLVDSVGQRTDILFSGVKANQPVPASKFKFD 197

Query: 197 YDK 199
             K
Sbjct: 198 IPK 200


>gi|294636939|ref|ZP_06715265.1| outer membrane lipoprotein carrier protein LolA [Edwardsiella tarda
           ATCC 23685]
 gi|291089857|gb|EFE22418.1| outer membrane lipoprotein carrier protein LolA [Edwardsiella tarda
           ATCC 23685]
          Length = 227

 Score = 83.0 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/205 (13%), Positives = 63/205 (30%), Gaps = 9/205 (4%)

Query: 2   AFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDA 58
              L K +I +  L     +                        + +   +F Q      
Sbjct: 13  NLFLLKVIIPMKKLLVACCVVVSGMMSASVLASPSSDLQGRLNKVNSFHASFTQAVSTAD 72

Query: 59  G---YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS- 114
           G      +GE ++ RP+ F +  +SP    L+SDG  +  YN  ++  +   L     + 
Sbjct: 73  GTAVQQGEGELWVKRPNLFNWHMTSPDESVLVSDGKTLWFYNPFVEQVTATWLNRATSNT 132

Query: 115 -VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
             +        + +   V    +   +  K +      S         +  +  ++   +
Sbjct: 133 PFMLITRNDASEWAHYNVTQQGNTFDLTPKSNKNNLKKSTITVLPDGTINGFSAVEQDGQ 192

Query: 174 YSIIKILKYKENTVLDPKVFEIPYD 198
            S+  + + ++N  +D   F     
Sbjct: 193 RSVYTLKR-QQNGAVDAAKFRFTPP 216


>gi|229591235|ref|YP_002873354.1| outer-membrane lipoprotein carrier protein [Pseudomonas fluorescens
           SBW25]
 gi|259491789|sp|C3JY57|LOLA_PSEFS RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229363101|emb|CAY50104.1| outer-membrane lipoprotein carrier protein [Pseudomonas fluorescens
           SBW25]
          Length = 207

 Score = 83.0 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 59/183 (32%), Gaps = 11/183 (6%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSP 81
                  SV          QT+   F Q              GE  + RP  FY+     
Sbjct: 18  SAHADPASVASLKNLLDKSQTLTARFSQMTLDAGGTQLQETAGEMAVQRPGLFYWHTEGK 77

Query: 82  SSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQHVIQESIQRVESNNSF 137
           +  +++SDG  + +++  L+  +       L      ++  +   +        +  ++ 
Sbjct: 78  AEQTIVSDGQKVTLWDPDLEQATINKLDPRLNQTPALLLSGDVSKINDSFDITSKQTSNV 137

Query: 138 ITIFFKDDFMGN-MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
           I    K         +++    +  + N +++DS  + + I     K N  +    F+  
Sbjct: 138 IEFTLKPKSKDTLFDTLSLSFGNGVINNMRLVDSVGQRTDILFSGVKANQPVPASKFKFD 197

Query: 197 YDK 199
             K
Sbjct: 198 IPK 200


>gi|152981724|ref|YP_001352845.1| outer-membrane lipoprotein carrier protein [Janthinobacterium sp.
           Marseille]
 gi|151281801|gb|ABR90211.1| outer membrane lipoproteins carrier protein [Janthinobacterium sp.
           Marseille]
          Length = 222

 Score = 83.0 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 32/200 (16%), Positives = 69/200 (34%), Gaps = 14/200 (7%)

Query: 14  ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---------EDAGYVMKG 64
           +L     +    A        ++++      S Q+ +G F Q                 G
Sbjct: 17  LLVSALLVGAALAVPRFAHAAALEQFKSFVASTQSARGEFTQQLVKIESGTSKVSNKSTG 76

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNN 120
            F  ARP KF + Y  P    L +DG  + +Y+  L+  ++  L         +++F +N
Sbjct: 77  TFTFARPGKFIWVYQKPYEQLLQADGDKLYIYDKDLNQVTIKKLGDALGSSPAAILFGSN 136

Query: 121 QHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
                 +++   + N    +             +     +      ++ DS  + S++  
Sbjct: 137 DLEKNFTLKEAGTKNGLEWLEATPKAKDTTFDHIGIGLRNGVPEAMELRDSFGQVSLLTF 196

Query: 180 LKYKENTVLDPKVFEIPYDK 199
            K+++N  +    F+    K
Sbjct: 197 TKFEKNPPMPANQFKFVVPK 216


>gi|117924967|ref|YP_865584.1| outer membrane lipoprotein carrier protein LolA [Magnetococcus sp.
           MC-1]
 gi|117608723|gb|ABK44178.1| outer membrane lipoprotein carrier protein LolA [Magnetococcus sp.
           MC-1]
          Length = 223

 Score = 83.0 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/179 (16%), Positives = 62/179 (34%), Gaps = 13/179 (7%)

Query: 34  QSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSPSSVSLI 87
            +V +       I TM+ TF+Q             +G F   RP KF + Y SP    ++
Sbjct: 38  AAVVRLQAFVDGITTMEATFIQRVRSNDSTEIEESRGRFLALRPGKFRWDYESPEVQHIV 97

Query: 88  SDGSNIAVYNAKLDTWSV---YPLRYMAFSVIFSN----NQHVIQESIQRVESNNSFITI 140
            DG  + ++  +L   +      L     + + S          +         ++    
Sbjct: 98  CDGKTVWLHEPELQQVTRISADRLDRAPAAFLVSKSRIAESFFTKVVHNEKLDLDTVFLS 157

Query: 141 FFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
              +      +++T D+    +  +++ D+    S  + +  + N  +D   FE    K
Sbjct: 158 PKAEAAHFKEVAITLDKSGQEIQFFQVTDTLGNRSYFQFVGMRMNQRVDESRFEFQIPK 216


>gi|260220656|emb|CBA28415.1| Outer-membrane lipoprotein carrier protein [Curvibacter putative
           symbiont of Hydra magnipapillata]
          Length = 221

 Score = 83.0 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/198 (14%), Positives = 60/198 (30%), Gaps = 18/198 (9%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA----------GYVMKGEFFM 68
            A F             +         +++ +  F Q               V  G F  
Sbjct: 16  FATFFIATCALSAGATGLNDLESFIKGVKSGKAEFSQVVTAPAKEGQVARSKVSSGTFEF 75

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVI-------FSNNQ 121
            RP +F F Y  P   ++++DG  + +Y+  L+  +         S              
Sbjct: 76  LRPGRFKFTYKKPFEQTIVADGQTLWLYDVDLNQVTARKQAQALGSTPAALIASSADIKA 135

Query: 122 HVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
                ++           +          + SV       +L   +I+D+  + S++   
Sbjct: 136 LQADFNLADSPDKEGLQWVQGAPKAKDSQLQSVRVGFRQGKLEILEIVDTFGQKSVLTFN 195

Query: 181 KYKENTVLDPKVFEIPYD 198
            ++ N V DP++F+    
Sbjct: 196 GFQSNPVTDPELFQFKPP 213


>gi|291615034|ref|YP_003525191.1| outer membrane lipoprotein carrier protein LolA [Sideroxydans
           lithotrophicus ES-1]
 gi|291585146|gb|ADE12804.1| outer membrane lipoprotein carrier protein LolA [Sideroxydans
           lithotrophicus ES-1]
          Length = 204

 Score = 83.0 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 65/186 (34%), Gaps = 12/186 (6%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------GEFFMARPSKFYFKYSSPSS 83
            +   +  K         + Q  F QE      K      G     RP KF + Y  P  
Sbjct: 16  ASHAAATGKLKSFIAGTHSAQANFTQEVLEKSGKRMQFASGTMQFVRPGKFRWVYQKPYE 75

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQESIQRVESNNSFIT 139
             ++ DG    +Y+  L+  +V  L         +++  NN+     +++ +E  + F  
Sbjct: 76  QLIVGDGKKFWMYDIDLNQVTVKKLDAALGSSPAALLSGNNEIERDFTLKDLEDRDGFEW 135

Query: 140 IF--FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
           +    K         +        L   ++ D+   +++++  + K N  L  K+F    
Sbjct: 136 LQATPKSKETTFEKILMAFNGKSELAVMELYDAFGHHTVLRFTELKNNPSLSAKLFHFVP 195

Query: 198 DKIHNI 203
            K  ++
Sbjct: 196 PKDADV 201


>gi|88812896|ref|ZP_01128140.1| outer membrane lipoprotein carrier protein LolA [Nitrococcus
           mobilis Nb-231]
 gi|88789818|gb|EAR20941.1| outer membrane lipoprotein carrier protein LolA [Nitrococcus
           mobilis Nb-231]
          Length = 199

 Score = 82.6 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/179 (15%), Positives = 65/179 (36%), Gaps = 8/179 (4%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQED---AGYV---MKGEFFMARPSKFYFKYSSPS 82
           P     +++   +++ S+ T+ G F+QE     G       G F +ARP++F + Y  P 
Sbjct: 6   PGAAIDAIQALQQYYDSVHTLTGRFVQETRAEDGSRIDASSGAFALARPNRFDWLYEKPY 65

Query: 83  SVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSF--ITI 140
              +++DG  + VY+ +L   +   L  +              +  +  E  +       
Sbjct: 66  RQRIVADGKRLWVYDVELRQATARSLDEVLGVGPALLLSGRFSDLQRSFELKDLGAGWIR 125

Query: 141 FFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                   +   +            ++ +   + + + +   + N  LDP+ F+    +
Sbjct: 126 LRPKTGQWDFQRLRLHMAQGVPDVIELDNGLDQKTRLGLRDLQRNPRLDPQRFQFTPPE 184


>gi|238026470|ref|YP_002910701.1| outer-membrane lipoprotein carrier protein [Burkholderia glumae
           BGR1]
 gi|237875664|gb|ACR27997.1| Outer membrane lipoprotein carrier protein LolA [Burkholderia
           glumae BGR1]
          Length = 233

 Score = 82.6 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/194 (13%), Positives = 49/194 (25%), Gaps = 23/194 (11%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQED------------------AGYVMKGEFFMAR 70
                    +       +++ +G F Q+                   +     G F   R
Sbjct: 33  SHAFAGGTDELKAFVAQVKSARGDFTQQIVKAPSKAASGAIATTAAKSTDDSSGSFVFLR 92

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFSVIFSNNQHVIQ 125
           P KF + Y  P    L +DG  + VY+  L+  +            A  +  SN+     
Sbjct: 93  PGKFVWSYEKPYQQLLQADGETLYVYDKDLNQVTERKLAGALGASPAAILFGSNDIEKNY 152

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
                 E                    +        L   ++ D     +++     + N
Sbjct: 153 TLRDAGEKGGIDWVEMLPKARDTQFQRIGIGFKGGALAAMELHDVFGNVTLLTFTHMQTN 212

Query: 186 TVLDPKVFEIPYDK 199
             L    F     K
Sbjct: 213 PALPAGQFRFSVPK 226


>gi|188576728|ref|YP_001913657.1| outer-membrane lipoprotein carrier protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|188576919|ref|YP_001913848.1| outer-membrane lipoprotein carrier protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|188521180|gb|ACD59125.1| outer membrane lipoprotein carrier protein LolA [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|188521371|gb|ACD59316.1| outer membrane lipoprotein carrier protein LolA [Xanthomonas oryzae
           pv. oryzae PXO99A]
          Length = 216

 Score = 82.6 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/188 (12%), Positives = 61/188 (32%), Gaps = 13/188 (6%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
           A+             + ++       ++ + G F Q              G   +A P +
Sbjct: 15  AVLATALFASTAFAAARQELDTFTRGLKGLDGQFSQRVTDANGKVKENSSGRVALATPRQ 74

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQESIQ 129
           F ++Y+ P    +++DG  + V++  L+  +V       +      + +      +  + 
Sbjct: 75  FRWEYAKPYRQLIVADGKKVWVFDPDLEQVTVRAQGSEEQNSPLVALINPALLDKKYDVS 134

Query: 130 RV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
                     ++++  K D   +    +       L   +++D+  + + I    +K N 
Sbjct: 135 EEAAPRDGLQWLSLTPKVDTDASFQMASLGFGKDGLAKMEVVDAVGQRTTISFSGWKRNP 194

Query: 187 VLDPKVFE 194
                 F 
Sbjct: 195 AFAADTFR 202


>gi|58426761|gb|AAW75798.1| outer-membrane lipoproteins carrier protein precursor [Xanthomonas
           oryzae pv. oryzae KACC10331]
          Length = 256

 Score = 82.6 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/188 (12%), Positives = 61/188 (32%), Gaps = 13/188 (6%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
           A+             + ++       ++ + G F Q              G   +A P +
Sbjct: 55  AVLATALFASTAFAAARQELDTFTRGLKGLDGQFSQRVTDANGKVKENSSGRVALATPRQ 114

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQESIQ 129
           F ++Y+ P    +++DG  + V++  L+  +V       +      + +      +  + 
Sbjct: 115 FRWEYAKPYRQLIVADGKKVWVFDPDLEQVTVRAQGSEEQNSPLVALINPALLDKKYDVS 174

Query: 130 RV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
                     ++++  K D   +    +       L   +++D+  + + I    +K N 
Sbjct: 175 EEAAPRDGLQWLSLTPKVDTDASFQMASLGFGKDGLAKMEVVDAVGQRTTISFSGWKRNP 234

Query: 187 VLDPKVFE 194
                 F 
Sbjct: 235 AFAADTFR 242


>gi|84624060|ref|YP_451432.1| outer-membrane lipoprotein carrier protein [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|161898987|ref|YP_201183.2| outer-membrane lipoprotein carrier protein [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|123521882|sp|Q2P2R9|LOLA_XANOM RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|84368000|dbj|BAE69158.1| Probable outer-membrane lipoproteins carrier protein precursor
           [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 209

 Score = 82.6 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/188 (12%), Positives = 61/188 (32%), Gaps = 13/188 (6%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
           A+             + ++       ++ + G F Q              G   +A P +
Sbjct: 8   AVLATALFASTAFAAARQELDTFTRGLKGLDGQFSQRVTDANGKVKENSSGRVALATPRQ 67

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQESIQ 129
           F ++Y+ P    +++DG  + V++  L+  +V       +      + +      +  + 
Sbjct: 68  FRWEYAKPYRQLIVADGKKVWVFDPDLEQVTVRAQGSEEQNSPLVALINPALLDKKYDVS 127

Query: 130 RV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
                     ++++  K D   +    +       L   +++D+  + + I    +K N 
Sbjct: 128 EEAAPRDGLQWLSLTPKVDTDASFQMASLGFGKDGLAKMEVVDAVGQRTTISFSGWKRNP 187

Query: 187 VLDPKVFE 194
                 F 
Sbjct: 188 AFAADTFR 195


>gi|326559966|gb|EGE10364.1| outer-membrane lipoproteins carrier protein [Moraxella catarrhalis
           46P47B1]
 gi|326561150|gb|EGE11515.1| outer-membrane lipoproteins carrier protein [Moraxella catarrhalis
           7169]
 gi|326567660|gb|EGE17768.1| outer-membrane lipoproteins carrier protein [Moraxella catarrhalis
           12P80B1]
          Length = 293

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/189 (14%), Positives = 62/189 (32%), Gaps = 8/189 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE----DAGYVMKGEFFMARPSKF 74
            A+     A   ++ Q+ K        I++M   F Q     +      G   + R ++F
Sbjct: 98  VALTTVAHAAAASQSQATKNLNSQLSGIRSMTANFSQTTQAGNKKTNFTGMMGVQRQNQF 157

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSVIFSNNQHVIQESIQR 130
            ++  SP+   ++++G+ + +Y+  L   +   +          ++  +   + +     
Sbjct: 158 RWETKSPAEQLIVANGNTMWIYDKDLQQATRQSVGSQIGEVPALLLSGDPSQIDRHFNVS 217

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
               N    I        N  S++      R +   + DS  + + I+      N  L  
Sbjct: 218 QPDANKNYFILTPKSSNANFGSLSLSFNGGRPVMMVLQDSIGQTTTIQFSNIALNKKLPA 277

Query: 191 KVFEIPYDK 199
             F      
Sbjct: 278 TQFNFTPPN 286


>gi|317153279|ref|YP_004121327.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           aespoeensis Aspo-2]
 gi|316943530|gb|ADU62581.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 230

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/219 (10%), Positives = 66/219 (30%), Gaps = 24/219 (10%)

Query: 5   LYKSVIGVV-ILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG---- 59
           + +  + +V +          +A   +  +       + + +++T +  F+QE       
Sbjct: 1   MSRQYMALVSLSVCLVFAGLAHAGKAVAPEDMPDLIQKRYETLKTFRCDFVQELTNVASG 60

Query: 60  --YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY------------NAKLDTWSV 105
                +G  +  +PS+  ++   P    L+        Y             A LD+ ++
Sbjct: 61  DVEERRGRIWFRQPSQVRWETLEPEKELLVVGPDYAWDYIEAEQLALKYGVEALLDSKTI 120

Query: 106 YPLRYMAFSVIFSNNQHVIQESIQRVESNNS-----FITIFFKDDFMGNMISVTFDRLSY 160
                   ++          +    V             +  + +    +  V  +  + 
Sbjct: 121 LRFISGRANLKEDFVIKTEWQGADEVRERWGKGFTVLQLLPKEPEPGMVLAYVGVEPDTG 180

Query: 161 RLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            L    I+D     + +++   K++  L   +F     +
Sbjct: 181 LLRQVMIVDFYGNGNEVRLSNVKQDIKLSADMFTFVPPE 219


>gi|326565209|gb|EGE15395.1| outer-membrane lipoproteins carrier protein [Moraxella catarrhalis
           103P14B1]
          Length = 293

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/189 (14%), Positives = 62/189 (32%), Gaps = 8/189 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE----DAGYVMKGEFFMARPSKF 74
            A+     A   ++ Q+ K        I++M   F Q     +      G   + R ++F
Sbjct: 98  VALTTVAHAAAASQSQATKNLNSQLSGIRSMTANFSQTTQAGNKKTNFTGMMGVQRQNQF 157

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSVIFSNNQHVIQESIQR 130
            ++  SP+   ++++G+ + +Y+  L   +   +          ++  +   + +     
Sbjct: 158 RWETKSPAEQLIVANGNTMWIYDKDLQQATRQSVGSQIGEVPALLLSGDPGQIDRHFNVS 217

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
               N    I        N  S++      R +   + DS  + + I+      N  L  
Sbjct: 218 QPDVNKNYFILTPKSSNANFGSLSLSFNGGRPVMMVLQDSIGQTTTIQFSNIALNKKLPA 277

Query: 191 KVFEIPYDK 199
             F      
Sbjct: 278 TQFNFTPPN 286


>gi|326577445|gb|EGE27329.1| outer-membrane lipoproteins carrier protein [Moraxella catarrhalis
           O35E]
          Length = 293

 Score = 82.2 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/189 (14%), Positives = 62/189 (32%), Gaps = 8/189 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE----DAGYVMKGEFFMARPSKF 74
            A+     A   ++ Q+ K        I++M   F Q     +      G   + R ++F
Sbjct: 98  VALTTVAHAAAASQSQATKNLNSQLSGIRSMTANFSQTTQAGNKKTNFTGMMGVQRQNQF 157

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSVIFSNNQHVIQESIQR 130
            ++  SP+   ++++G+ + +Y+  L   +   +          ++  +   + +     
Sbjct: 158 RWETKSPAEQLIVANGNTMWIYDKDLQQATRQSVGSQIGEVPALLLSGDPGQIDRHFNVS 217

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
               N    I        N  S++      R +   + DS  + + I+      N  L  
Sbjct: 218 QPDANKNYFILTPKSSNANFGSLSLSFNGGRPVMMVLQDSIGQTTTIQFSNIALNKKLPA 277

Query: 191 KVFEIPYDK 199
             F      
Sbjct: 278 TQFNFTPPN 286


>gi|218514561|ref|ZP_03511401.1| putative outer membrane lipoproteins carrier protein [Rhizobium
           etli 8C-3]
          Length = 179

 Score = 81.9 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 44/146 (30%), Positives = 75/146 (51%), Gaps = 3/146 (2%)

Query: 39  AIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97
             +HF  + TMQG F+Q    G    G+FF+ RP K  F Y  PS + +I+DG N+A+ N
Sbjct: 26  IADHFSGVTTMQGEFVQFGPRGEQTGGKFFIQRPGKLRFNYDDPSPMRVIADGKNVAIGN 85

Query: 98  AKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISV--TF 155
            KL TW +YPL     S++ + +  +    ++ V+  +   TI   ++ +    ++   F
Sbjct: 86  TKLKTWDLYPLSKTPLSLLLAQHIDLSAGMVKGVKEESDLTTIALGNNTVFGNSTITMMF 145

Query: 156 DRLSYRLLNWKIMDSSRRYSIIKILK 181
           D  +Y L  W I D+  + + + I +
Sbjct: 146 DPKTYDLRQWTITDNQGKDTSVMIFQ 171


>gi|302382163|ref|YP_003817986.1| outer membrane lipoprotein carrier protein LolA [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192791|gb|ADL00363.1| outer membrane lipoprotein carrier protein LolA [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 211

 Score = 81.9 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 35/179 (19%), Positives = 72/179 (40%), Gaps = 5/179 (2%)

Query: 25  NAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSS 83
            +        ++  A  +  ++ + QGTF +    G    G F++ RP +  F+Y+ P+ 
Sbjct: 26  QSGLSAEDRATLATAQTYLQNLTSAQGTFTETGAGGQRRSGRFWLQRPGRMRFEYTDPAG 85

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRV----ESNNSFIT 139
           + ++SDGSN+  Y+ +L+ +   PL     S   + N  + Q          +S    +T
Sbjct: 86  LLVVSDGSNVKRYDPRLNVFRQVPLGATPLSTFLARNVRLDQGVRIDRVTRMQSGAFALT 145

Query: 140 IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           +          + + F     RL  W I ++S   +  ++      + L   +F +   
Sbjct: 146 VRDSSRPNDGSVILAFAGNPMRLQEWTITEASGARTRTQLTSLTPASGLSASLFRLTDP 204


>gi|319407784|emb|CBI81435.1| lipoprotein carrier protein [Bartonella sp. 1-1C]
          Length = 190

 Score = 81.9 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 46/181 (25%), Positives = 78/181 (43%), Gaps = 3/181 (1%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYS 79
           +     +    +    +  I HF +I+ M G F+Q    G + KG F++ RP K  F Y 
Sbjct: 1   MSSSAFSQSAKQFARAQNIINHFAAIKVMTGDFIQFNPKGKMTKGTFYLERPGKIRFSY- 59

Query: 80  SPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFI- 138
               + +ISDG ++ + N  L+TWS Y L       +  N  H+  E++     + + I 
Sbjct: 60  KGVPLQIISDGKSVGINNRALNTWSFYQLSQTPMKFLLGNVIHLSSENLLAFREDPTTIM 119

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
            +          I + FD  +Y L  W I+D     + +KI+  + N      +F IP+ 
Sbjct: 120 IVLRDKTIGKGQIKMIFDSQNYALRQWAILDQQNLETTVKIMNVRTNVRFSDDMFVIPHK 179

Query: 199 K 199
            
Sbjct: 180 N 180


>gi|225023898|ref|ZP_03713090.1| hypothetical protein EIKCOROL_00764 [Eikenella corrodens ATCC
           23834]
 gi|224943372|gb|EEG24581.1| hypothetical protein EIKCOROL_00764 [Eikenella corrodens ATCC
           23834]
          Length = 205

 Score = 81.9 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 24/179 (13%), Positives = 51/179 (28%), Gaps = 9/179 (5%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV----MKGEFFMARPSKFYFKYSSPSSVS 85
             +   ++   +       + G+F Q           +G F + RP  F ++Y+SP   +
Sbjct: 20  SAQAGGIEALQKFNADTDGISGSFSQSVQSRNKTRNAQGRFSILRPGLFKWEYTSPYKQT 79

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFSNNQHVIQESIQRVESNNSFITI 140
           ++ DGS+I +Y+  L   +               +             +   +      +
Sbjct: 80  IVGDGSHIWLYDIDLAQITKTAQNQAIGDSPAAILSNKEALSASYTLKEDGSAGGIDYVL 139

Query: 141 FFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                       +        L   ++ DS    + IK         L    F     +
Sbjct: 140 ATPKRSNAGYQYIRLGFKGDDLAEMRLKDSFGNQTTIKFNNLNTRPNLSRSQFRFTPPQ 198


>gi|270261176|ref|ZP_06189449.1| outer-membrane lipoprotein carrier protein, precursor [Serratia
           odorifera 4Rx13]
 gi|270044660|gb|EFA17751.1| outer-membrane lipoprotein carrier protein, precursor [Serratia
           odorifera 4Rx13]
          Length = 203

 Score = 81.5 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 28/202 (13%), Positives = 62/202 (30%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----- 60
            K ++    L           A       + +        + +   +F Q          
Sbjct: 1   MKKLLVACCLLSGF-------ASTSVLADAAQDLQSRLAKVNSFHASFSQTVTSSDGAAV 53

Query: 61  -VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +GE ++ RP+ F +  +SP    L+SDG  +  YN  ++  +   L+    +   + 
Sbjct: 54  QQGEGELWVKRPNLFNWHMTSPDESVLVSDGQTLWFYNPFVEQVTATWLKNATGNTPFML 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                        V+       +  K               S  + ++  ++   + S  
Sbjct: 114 ITRNDANDWKQYNVKQKGDDFELTPKSSSGNLKQFAITVTNSGTIRSFAAVEQDGQRSSY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +   ++NT +D   F+    K
Sbjct: 174 ALKS-QQNTTVDAAKFKFTPPK 194


>gi|325915379|ref|ZP_08177696.1| periplasmic chaperone LolA [Xanthomonas vesicatoria ATCC 35937]
 gi|325538426|gb|EGD10105.1| periplasmic chaperone LolA [Xanthomonas vesicatoria ATCC 35937]
          Length = 223

 Score = 81.1 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 24/188 (12%), Positives = 64/188 (34%), Gaps = 13/188 (6%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
           A+             + ++       ++ + G F Q+             G   +++P +
Sbjct: 22  AVLATALFAGTAFAGARQELDTFTRGLKGLDGQFNQQVTDANGRIKERSSGRVAVSQPRQ 81

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSV----YPLRYMAFSVIFSNNQHVIQESIQ 129
           F ++Y+ P    +++DG  + V++  L+  +V       +      +    +   Q  + 
Sbjct: 82  FRWEYAKPYKQLIVADGKKVWVFDPDLEQVTVRAQGNEEQNSPLVALIDPARLDKQYDVS 141

Query: 130 RV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
                     ++++  K D   +    +       L   +++D+  + + I    +K N 
Sbjct: 142 EEAAPRDGLQWLSLTPKVDTEASFQMASLGFGKDGLTKMEVVDAVGQRTAISFSGWKRNP 201

Query: 187 VLDPKVFE 194
              P  F 
Sbjct: 202 AFAPDTFR 209


>gi|302035919|ref|YP_003796241.1| putative outer membrane lipoprotein carrier protein LolA
           [Candidatus Nitrospira defluvii]
 gi|300603983|emb|CBK40315.1| putative Outer membrane lipoprotein carrier protein LolA
           [Candidatus Nitrospira defluvii]
          Length = 240

 Score = 81.1 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 23/226 (10%), Positives = 66/226 (29%), Gaps = 32/226 (14%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKD----------QSVKKAIEHFLSIQTMQGTFL 54
           + +  + V +L             P              + VK     +   + +Q +F 
Sbjct: 1   MMRIFLLVAVLLMSGIPAVAQPVKPDEPAVDLQILKEVQEVVKNIQARYEKTKDLQASFT 60

Query: 55  QEDAGY------VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW----- 103
           Q+          +  G F++ +P +  + Y  P++  +  +  ++ +Y  +         
Sbjct: 61  QKTRIEGFSTPVISTGHFYIKKPGRLRWDYIEPATEEIYVNKDDVKMYVPEHKQVLVGKL 120

Query: 104 SVYPLRYMAFSVIFSNNQHVIQESIQ----RVESNNSFITIFFKDDFMG-------NMIS 152
           +          ++    +   +  I+    +       + +                 I 
Sbjct: 121 TYMAASQAPLQLLQGVAKLDEEFDIEPTAAKDRGAGGILLVSLTPKQGRAEPERAIQKIV 180

Query: 153 VTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           +     +Y L    + + S   +  +  + K N+ L   +F+    
Sbjct: 181 IEVQPKTYFLKTIALHEVSGNIATFEFSELKPNSGLKDDLFDFKAP 226


>gi|299138877|ref|ZP_07032054.1| outer membrane lipoprotein carrier protein LolA [Acidobacterium sp.
           MP5ACTX8]
 gi|298599031|gb|EFI55192.1| outer membrane lipoprotein carrier protein LolA [Acidobacterium sp.
           MP5ACTX8]
          Length = 210

 Score = 81.1 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 29/202 (14%), Positives = 57/202 (28%), Gaps = 12/202 (5%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFL---QEDA-GYVMKGEFFMAR 70
           L     +    AA   T      +   H+  +Q++Q  +    Q         G   + +
Sbjct: 4   LLLLFVLASPLAAQSPTAASLAHQVDAHYNHLQSLQARYTERYQGMGLDRTETGSLTLRK 63

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY-----MAFSVIFSNNQHVIQ 125
           P +  + Y SP+    I DG N   Y          P +           +  + +   +
Sbjct: 64  PGRMRWSYDSPAGKLFILDGKNAISYTPGDAQAQRIPEKQLDDLRSPLRFLLGHTELAKE 123

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMIS--VTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
                + + N   T+      M   +         +  +   +I ++    +        
Sbjct: 124 LDGLSLTAVNGGYTLSGTPKGMQQRVRSLALTVDSTGTIHTMRIEETDGATTTFTFTDMH 183

Query: 184 ENTVLDPKVFEI-PYDKIHNIN 204
           EN       F   P   +  IN
Sbjct: 184 ENIPTKDSDFIFTPPQGVAIIN 205


>gi|124266313|ref|YP_001020317.1| outer membrane lipoprotein carrier protein LolA [Methylibium
           petroleiphilum PM1]
 gi|189028554|sp|A2SEU3|LOLA_METPP RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|124259088|gb|ABM94082.1| outer membrane lipoprotein carrier protein LolA [Methylibium
           petroleiphilum PM1]
          Length = 203

 Score = 81.1 bits (198), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 26/173 (15%), Positives = 60/173 (34%), Gaps = 10/173 (5%)

Query: 36  VKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSPSSVSLISD 89
           +         ++T +  F Q              G F  +RP++F F Y+ P    ++SD
Sbjct: 23  IDTLKGFVAEVKTGRAAFTQTVTSPDGAKKKSSSGSFEFSRPNRFRFAYTKPYEQLIVSD 82

Query: 90  GSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD 145
           G  + +++  L+  +V P+         +++   +     E     +             
Sbjct: 83  GQKVWLHDPDLNQVTVRPVGQALGATPAALLAGASLEKDFELKALPDDGGLQWAQALPRV 142

Query: 146 FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
             G+  S+        L   +I+D+  + S ++  +++ +  L    F     
Sbjct: 143 KEGSFQSLKVGFRGKTLAAVEIVDAFGQRSRLEFSQFEADAKLPADRFGFTPP 195


>gi|332526023|ref|ZP_08402161.1| outer membrane lipoprotein carrier protein LolA [Rubrivivax
           benzoatilyticus JA2]
 gi|332109866|gb|EGJ10494.1| outer membrane lipoprotein carrier protein LolA [Rubrivivax
           benzoatilyticus JA2]
          Length = 202

 Score = 81.1 bits (198), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 28/191 (14%), Positives = 56/191 (29%), Gaps = 10/191 (5%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARP 71
                   A     +  +V+        ++T +  F Q              G F  ARP
Sbjct: 4   LLIAAALAATTVAAQADAVQTLRAFVRDVKTGRAEFTQTVTSPDGARKKTSSGRFEFARP 63

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQES 127
            +F F Y  P   ++++DG  + +++  L+  S   L         +++   +       
Sbjct: 64  DRFRFGYEKPFQQTIVADGQKVWIHDPDLNQVSSRRLSQALGATPAALLAGGSLESDFVL 123

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
                               G   S+        L   +I+DS  + S +    ++    
Sbjct: 124 SNGGSLGGLEWAQATPRTPDGPFKSMKVGFRGAELAAVEIVDSFGQRSRLDFKGFEAGVA 183

Query: 188 LDPKVFEIPYD 198
           L  + F     
Sbjct: 184 LPAERFRFTVP 194


>gi|238757606|ref|ZP_04618790.1| Outer-membrane lipoprotein carrier protein [Yersinia aldovae ATCC
           35236]
 gi|238704111|gb|EEP96644.1| Outer-membrane lipoprotein carrier protein [Yersinia aldovae ATCC
           35236]
          Length = 203

 Score = 81.1 bits (198), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 30/204 (14%), Positives = 66/204 (32%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K ++    L                   + K        + +   +F Q          
Sbjct: 1   MKKLLVACCLLSGLI-------SASALADASKDLQSRLSKVNSFHASFSQNVTSADGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +GE ++ RP+ F +  +SP    LISDG  +  YN  ++  +            F +
Sbjct: 54  QEGEGELWVKRPNLFNWHMTSPDESVLISDGETLWFYNPFVEQATATWLKNATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  NN    ++   + + ++  +T       +           S  + ++  ++   + S
Sbjct: 114 ITRNNPDDWKQYNVKQKGDDFELTPKTATGNLKQFAITV--TPSGTIKSFTAVEQDGQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
              +   ++N+  D   F+    K
Sbjct: 172 AYTLKG-QQNSSADASKFKFTPPK 194


>gi|303257769|ref|ZP_07343781.1| outer membrane lipoprotein carrier protein LolA [Burkholderiales
           bacterium 1_1_47]
 gi|302859739|gb|EFL82818.1| outer membrane lipoprotein carrier protein LolA [Burkholderiales
           bacterium 1_1_47]
          Length = 211

 Score = 80.7 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 41/208 (19%), Positives = 78/208 (37%), Gaps = 17/208 (8%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-------E 56
           +  K  +    L   + +FPF         Q +          +   G F Q       +
Sbjct: 1   MRKKRFMKKTALLTITGLFPFVVFS-----QPLDLLNNFLNETKQASGAFEQQTFQKDGK 55

Query: 57  DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMA 112
            A  + KG F  +RP KF + Y+SP    ++ DGS I +++  L+  +V      +    
Sbjct: 56  PAEELQKGTFSFSRPGKFVWTYTSPYPQKMVCDGSRIYIWDEDLNQVTVRSAKGAIPKSP 115

Query: 113 FSVIFSNNQHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDRLSYRLLNWKIMDSS 171
            S++F    +    +  + +  + +  I         ++ SV+F   S +L     + S 
Sbjct: 116 ASILFGTQSYKKDWNATQPKQEDGYTWITLTPKAKDASVNSVSFGFKSEKLEKLIFVGSM 175

Query: 172 RRYSIIKILKYKENTVLDPKVFEIPYDK 199
              + + I   K +  L P+ F+    K
Sbjct: 176 GEKTNLTISDLKTDVQLSPETFKFTAPK 203


>gi|285018236|ref|YP_003375947.1| outer-membrane lipoprotein carrier protein precursor [Xanthomonas
           albilineans GPE PC73]
 gi|283473454|emb|CBA15959.1| probable outer-membrane lipoprotein carrier protein precursor
           [Xanthomonas albilineans]
          Length = 208

 Score = 80.7 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/192 (13%), Positives = 59/192 (30%), Gaps = 13/192 (6%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKF 74
           +             + +        ++ + G F Q+             G   ++ P  F
Sbjct: 9   VLATALLASTAYAGAREDLTAFTHGLKGLDGQFAQKVYDGKGTLKESSSGRLALSAPRLF 68

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQESIQR 130
            ++Y  P S  +++DGS + VY+  L   +V       +    + +    +   Q  +  
Sbjct: 69  RWEYRKPYSQLIVADGSKVWVYDPDLKQATVRTQGAEEQNSPLTALIDPGKLDRQYDVSE 128

Query: 131 V---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
                    ++T+  K     N            L   +++D   + + I    ++ N  
Sbjct: 129 EAVARDGLQWLTMTPKVGTEANFQLAKLGFDGKGLARMEVVDPVGQRTEISFSGWERNPR 188

Query: 188 LDPKVFEIPYDK 199
                F    +K
Sbjct: 189 FTAGTFRYVPEK 200


>gi|242279369|ref|YP_002991498.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           salexigens DSM 2638]
 gi|242122263|gb|ACS79959.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           salexigens DSM 2638]
          Length = 214

 Score = 80.7 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/208 (12%), Positives = 63/208 (30%), Gaps = 17/208 (8%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMK 63
             ++IL   + I   + A     D+   +  + + SI+T +  F Q           +  
Sbjct: 3   FRILILVISALISFSSIALA---DELTTEIQKTYDSIKTFKADFTQTLTNAASKEQDIRS 59

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL-----DTWSVYPLRYMAFSVIFS 118
           G+    +PS   ++   P    LI   S +  Y  +                     I  
Sbjct: 60  GKITFKQPSLLRWESIKPEPELLIVGESTVWDYFPEDELALKYRTQQLFNSKTMIKFISG 119

Query: 119 NNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTF---DRLSYRLLNWKIMDSSRRYS 175
             +      ++    +N  I +          + + F   D     +    ++D     +
Sbjct: 120 QAKLEEDFVVENQGEDNGLIKLKLLPLEPETGMVLAFAWIDPEKKMMRKVLVVDFYGNGN 179

Query: 176 IIKILKYKENTVLDPKVFEIPYDKIHNI 203
            + +   + +  +D   F+    +  N+
Sbjct: 180 EVFMDNIEIDPEVDDAQFQFTPPQGVNV 207


>gi|325578147|ref|ZP_08148282.1| outer membrane lipoprotein carrier protein LolA [Haemophilus
           parainfluenzae ATCC 33392]
 gi|301156049|emb|CBW15520.1| chaperone for lipoproteins [Haemophilus parainfluenzae T3T1]
 gi|325159883|gb|EGC72012.1| outer membrane lipoprotein carrier protein LolA [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 208

 Score = 80.7 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/193 (12%), Positives = 56/193 (29%), Gaps = 9/193 (4%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFM 68
           L   +A+    +A       +  +       +  +   F Q              G+  +
Sbjct: 5   LLKMTALTALLSASNFAFADAADELQNRLNQVTVLSADFSQTVTSAGGKNVQQGSGKLQI 64

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQE 126
            RP+ F     SP    +I+DG  +  Y+  +   +   ++    +   +   +      
Sbjct: 65  KRPNLFRMDTKSPQETQIIADGKTLWYYDPFVQQVTAQWVKDAVNNTPFVLLTSNDKSHW 124

Query: 127 SIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
           +   V  N     +  K               +  L N+   +   + ++  +     N 
Sbjct: 125 NQYSVTQNVDTFVLKPKAKNSNIKQFDIRVDANGVLKNFSTTEKDGQTNLYVLRNI-TNQ 183

Query: 187 VLDPKVFEIPYDK 199
            L   +F+    K
Sbjct: 184 TLADSLFQFSVPK 196


>gi|21231422|ref|NP_637339.1| outer-membrane lipoprotein carrier protein [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66768524|ref|YP_243286.1| outer-membrane lipoprotein carrier protein [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|188991667|ref|YP_001903677.1| outer-membrane lipoprotein carrier protein [Xanthomonas campestris
           pv. campestris str. B100]
 gi|23821822|sp|Q8P991|LOLA_XANCP RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|81305504|sp|Q4UUK7|LOLA_XANC8 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229485844|sp|B0RT42|LOLA_XANCB RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|21113091|gb|AAM41263.1| outer-membrane lipoproteins carrier protein precursor [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66573856|gb|AAY49266.1| outer-membrane lipoproteins carrier protein precursor [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|167733427|emb|CAP51628.1| Outer membrane lipoprotein-sorting protein LolA [Xanthomonas
           campestris pv. campestris]
          Length = 209

 Score = 80.7 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/188 (12%), Positives = 61/188 (32%), Gaps = 13/188 (6%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
           A+             + ++       ++ + G F Q              G   +A P +
Sbjct: 8   AVLATALFASTAFAGARQELDTFTRGLKGLDGQFSQRVTDANGRVKENSSGRVALATPRQ 67

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQESIQ 129
           F ++Y+ P    +++DG  + V++  L+  +V       +      +    +   Q  + 
Sbjct: 68  FRWEYAKPYKQLIVADGKKVWVFDPDLEQVTVRAQGSEEQNSPLVALIDPTRLDKQYDVS 127

Query: 130 RV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
                     ++++  K D   +    +       L   +++D+  + + I    +K N 
Sbjct: 128 EEAAPRDGLQWLSLTPKVDTDASFQMASLGFGKDGLAKMEVVDAVGQRTAISFSGWKRNP 187

Query: 187 VLDPKVFE 194
                 F 
Sbjct: 188 AFAADTFR 195


>gi|289549309|ref|YP_003474297.1| outer membrane lipoprotein carrier protein LolA [Thermocrinis albus
           DSM 14484]
 gi|289182926|gb|ADC90170.1| outer membrane lipoprotein carrier protein LolA [Thermocrinis albus
           DSM 14484]
          Length = 201

 Score = 80.7 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/194 (15%), Positives = 70/194 (36%), Gaps = 12/194 (6%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARP 71
              I        +    S     +    I+T++ +F+Q+          V KG F+  + 
Sbjct: 1   MVYILLVILTPLLALADSFTLLEKKLEEIRTLRASFIQKVQYSWYPKPEVSKGFFYAQKG 60

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM-----AFSVIFSNNQHVIQE 126
            KF  +Y  P  + ++SDG  I +Y+ + +T  +  +            + S     + +
Sbjct: 61  GKFRIEYEQPQRMLIVSDGKRILIYDPEENTAILDRVERNRSAVVEALFLLSRPLRDVFD 120

Query: 127 SIQRVESNNSFITIFFKDDFMGNMISVTFDRLSY-RLLNWKIMDSSRRYSIIKILKYKEN 185
            +  +  NN  + +            V  +   +  + + K+ +    ++ ++++  K N
Sbjct: 121 KVGEISRNNGHVIVLKPKVQDPYFSRVYVEVDGWRNIKSIKVEEKDGSFTTVELVDVKYN 180

Query: 186 TVLDPKVFEIPYDK 199
                 +F I   K
Sbjct: 181 FTPSEDLFRITVPK 194


>gi|152997261|ref|YP_001342096.1| outer membrane lipoprotein carrier protein LolA [Marinomonas sp.
           MWYL1]
 gi|150838185|gb|ABR72161.1| outer membrane lipoprotein carrier protein LolA [Marinomonas sp.
           MWYL1]
          Length = 215

 Score = 80.3 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/207 (14%), Positives = 76/207 (36%), Gaps = 12/207 (5%)

Query: 2   AFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY- 60
            FL   +++  ++      I        +    +           + ++G F Q      
Sbjct: 1   MFLWRYNLLNKLVTMAMFTIVTVFQTAMVQAADATSSIESLLELNRNIEGEFRQVTYDEK 60

Query: 61  -----VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YM 111
                V +G F +A+P++F +   +P +  +ISDG  I V++  L+  +  PL       
Sbjct: 61  GKQLQVSEGVFLLAKPNQFVWDSVTPFAQRIISDGKYITVWDVDLEQATKKPLSGAVGNS 120

Query: 112 AFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS 171
             +++      V+         +  F     +D  +   ++++F      +    I+D+ 
Sbjct: 121 PAALLGQPAAEVLPHYNVTKLGDEKFRLAPKEDQDLFQTLTLSFRNK--VISAMSILDAL 178

Query: 172 RRYSIIKILKYKENTVLDPKVFEIPYD 198
            + ++I+    + +  +  + F +   
Sbjct: 179 GQTTVIEFKNVETHEGVAKENFVLDLP 205


>gi|166712094|ref|ZP_02243301.1| outer-membrane lipoprotein carrier protein [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 209

 Score = 80.3 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/188 (12%), Positives = 61/188 (32%), Gaps = 13/188 (6%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
           A+             + ++       ++ + G F Q              G   +A P +
Sbjct: 8   AVLATALFASTAFAGARQELDTFTRGLKGLDGQFSQRVTDANGKVKENSSGRVALATPRQ 67

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQESIQ 129
           F ++Y+ P    +++DG  + V++  L+  +V       +      + +      +  + 
Sbjct: 68  FRWEYAKPYRQLIVADGKKVWVFDPDLEQVTVRAQGSEEQNSPLVPLINPALLDKKYDVS 127

Query: 130 RV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
                     ++++  K D   +    +       L   +++D+  + + I    +K N 
Sbjct: 128 EEAAPRDGLQWLSLTPKVDTDASFQMASLGFGKDGLAKMEVVDAVGQRTAISFSGWKRNP 187

Query: 187 VLDPKVFE 194
                 F 
Sbjct: 188 TFAADTFR 195


>gi|94968602|ref|YP_590650.1| outer membrane lipoprotein carrier protein LolA [Candidatus
           Koribacter versatilis Ellin345]
 gi|94550652|gb|ABF40576.1| outer membrane lipoprotein carrier protein LolA [Candidatus
           Koribacter versatilis Ellin345]
          Length = 219

 Score = 80.3 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 21/209 (10%), Positives = 60/209 (28%), Gaps = 20/209 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----V 61
            KS+   ++    +++            +  +     +  +++M   F +  +G      
Sbjct: 1   MKSLFKSLVFLLLASLAFAQTDI----KKLAEGVDHRYNDLRSMSAQFSERYSGNGMERE 56

Query: 62  MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY-----MAFSVI 116
             G   + +P K  ++Y SP     +SDG     Y           ++           +
Sbjct: 57  ETGTLSLKKPGKMRWEYQSPREKLFVSDGKLAWFYVPGEKQVRQAQVKKLDDLRSPLRYL 116

Query: 117 FSNNQHVIQESIQRVESN-------NSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMD 169
             + +   + +   +  +       N+ +              +      +R+    + +
Sbjct: 117 LGHTKLEKEFTGLSLAPDVKPAVAGNTVLRGIPVSMADRVSQVLLEITPEHRIARIVVSE 176

Query: 170 SSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                +     + ++N  L    FE    
Sbjct: 177 LDGSTTEFTFSQEQDNPSLADSSFEFKPP 205


>gi|117620952|ref|YP_856397.1| outer membrane lipoprotein carrier protein LolA [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|189028546|sp|A0KJE6|LOLA_AERHH RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|117562359|gb|ABK39307.1| outer membrane lipoprotein carrier protein LolA [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 202

 Score = 80.3 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/203 (11%), Positives = 61/203 (30%), Gaps = 17/203 (8%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK- 63
           + K ++   +L           A       +     +    +      F Q       K 
Sbjct: 1   MKKQLLMGTVLLV---------ASSQVWADAASDLKQKLAGVSLFSAKFAQTVYDSKGKE 51

Query: 64  -----GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VI 116
                G+  + RP++F +  +SP    +++DG ++ VY+  ++  +   ++    +   +
Sbjct: 52  LQRAGGDLLVQRPNRFNWHTTSPDESLIVADGKDVWVYDPFVEQVTALKMKDAVLNTPFV 111

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
                         V       T+  ++                 +  + + ++  ++S 
Sbjct: 112 LIAGNDNSLWKNYDVTQEGDVYTVTSRNQDELIASFRITFDRQNNISRFDVKEAQGQWSE 171

Query: 177 IKILKYKENTVLDPKVFEIPYDK 199
             +  +    VL    F     K
Sbjct: 172 FTLSNFNRKPVLKGNEFVFKIPK 194


>gi|319787146|ref|YP_004146621.1| outer membrane lipoprotein carrier protein LolA [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465658|gb|ADV27390.1| outer membrane lipoprotein carrier protein LolA [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 210

 Score = 80.3 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/185 (14%), Positives = 58/185 (31%), Gaps = 13/185 (7%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSP 81
                  +  + +     ++ ++G F Q+             G   ++ P  F ++Y  P
Sbjct: 19  SSTAFAGARDELVRFTSGLKGLEGRFEQQVFDANGRSKERSSGSVAVSAPRLFRWEYQKP 78

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQESIQRV---ESN 134
            +  +++DG  + VY   L   +V       R      +F   +   Q  +         
Sbjct: 79  FAQLIVADGQKVWVYEPDLKQATVKSQGEEERNSPLVALFEPARLDRQFDVSEEATASEG 138

Query: 135 NSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
             ++T+  K D   +            L   ++ D   + + I+   +K N       F 
Sbjct: 139 LQWLTLTPKIDTEASFQVARLGFGPQGLARMQVTDLVGQKTEIRFDAWKRNPSFGAGTFV 198

Query: 195 IPYDK 199
               K
Sbjct: 199 FKPGK 203


>gi|91789642|ref|YP_550594.1| outer membrane lipoprotein carrier protein LolA [Polaromonas sp.
           JS666]
 gi|91698867|gb|ABE45696.1| outer membrane lipoprotein carrier protein LolA [Polaromonas sp.
           JS666]
          Length = 238

 Score = 80.3 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/210 (15%), Positives = 65/210 (30%), Gaps = 22/210 (10%)

Query: 11  GVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----------Y 60
             V L    A+    A+   T    +        + ++ + +F Q               
Sbjct: 21  ASVTLATLVAMISMAASAQTTGVTGLDSLENFIKTTKSGRASFTQVVTSPAKEGQTAKTK 80

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVI---- 116
              G F   RP++F F Y  P   S+++DG  + +++  L+  +   L  +         
Sbjct: 81  TSSGSFEFLRPNRFKFIYKKPFEQSIVADGQTLWLHDVDLNQVTSRKLAQVLNGTPAAVV 140

Query: 117 ------FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTF--DRLSYRLLNWKIM 168
                            +           +    +     I V F        L   +I+
Sbjct: 141 AAAADLKGLEADFRLTPLPDKGGLQWVQAVPKTREGQLQSIQVGFRSTDKGSELAALEIL 200

Query: 169 DSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           DS  + S++   +++ N VL P  F+    
Sbjct: 201 DSFGQKSVMTFSQFEINPVLSPASFQFKPP 230


>gi|89901946|ref|YP_524417.1| outer membrane lipoprotein carrier protein LolA [Rhodoferax
           ferrireducens T118]
 gi|123091162|sp|Q21TL7|LOLA_RHOFD RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|89346683|gb|ABD70886.1| outer membrane lipoprotein carrier protein LolA [Rhodoferax
           ferrireducens T118]
          Length = 213

 Score = 80.3 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/203 (13%), Positives = 60/203 (29%), Gaps = 22/203 (10%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----------YVMKGEFF 67
           Y A     A   +     +K       ++ T +  F Q                  G F 
Sbjct: 3   YFATICIAAYAGLAGAGGLKSLEVFVKTVNTGRADFTQVVTAPAKAGQAPRVKTSSGTFE 62

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIF-------SNN 120
            +RP++F F Y  P   ++++DG  + +Y+  L+  +      +  S             
Sbjct: 63  FSRPNRFKFVYKKPFEQNIVADGQTLWLYDVDLNQVTARQQSKVLGSTPAALIAAAPDLR 122

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTF-----DRLSYRLLNWKIMDSSRRYS 175
                 ++      +               +            +  L   +I+DS  + S
Sbjct: 123 ALQADFTLADAPDKDGLQWAAATPKSKDGQLQSVRVGFRAGEQAAELAALEILDSFGQRS 182

Query: 176 IIKILKYKENTVLDPKVFEIPYD 198
           ++   +++ N  L    F+    
Sbjct: 183 VLSFSRFEVNPALPGNSFQFKPP 205


>gi|238021913|ref|ZP_04602339.1| hypothetical protein GCWU000324_01817 [Kingella oralis ATCC 51147]
 gi|237866527|gb|EEP67569.1| hypothetical protein GCWU000324_01817 [Kingella oralis ATCC 51147]
          Length = 205

 Score = 80.3 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/170 (15%), Positives = 52/170 (30%), Gaps = 9/170 (5%)

Query: 39  AIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIA 94
             +       + G+F Q         +  G F + RP  F ++Y+ P   +++ DG  I 
Sbjct: 29  LKKFNDDADGISGSFTQTVRSKKKTQISSGSFKILRPGLFRWEYTKPYQQTIVGDGKTIW 88

Query: 95  VYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSF-ITIFFKDDFMGN 149
           +Y+ +L   +             +++ +        S++   S N     +         
Sbjct: 89  LYDIELKQVTKSDQNQAIGDSPAAILSNKTALDASYSLKEDGSKNGVDYVLATPKKNNAG 148

Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
              +        L   ++ DS    + I       N  L    F     K
Sbjct: 149 YQFIRIGFKGDTLAAMELKDSFGNQTSISFGGVNTNAHLSRGAFTFTPPK 198


>gi|162138537|ref|YP_363789.2| outer-membrane lipoprotein carrier protein [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
          Length = 209

 Score = 79.9 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/188 (12%), Positives = 59/188 (31%), Gaps = 13/188 (6%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
           A+             + ++       ++ + G F Q              G   +A P +
Sbjct: 8   AVLATALFASTAFAGARQELDTFTRGLKGLDGQFSQRVTDAKGRVKETSSGRVALATPRQ 67

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQESIQ 129
           F ++Y+ P    +++DG  + V +  L+  +V       +      +        +  + 
Sbjct: 68  FRWEYAKPYKQLIVADGKKVWVLDPDLEQVTVRAQGSEEQNSPLVALIDPALLDKKYDVS 127

Query: 130 RV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
                     ++++  K D   +    +       L   +++D+  + + I    +K N 
Sbjct: 128 EEAAPRDGLQWLSLTPKVDTDASFQIASLGFSKDGLARMEVVDAVGQRTAISFSGWKRNP 187

Query: 187 VLDPKVFE 194
                 F 
Sbjct: 188 AFAADTFR 195


>gi|78036044|emb|CAJ23735.1| outer membrane lipoprotein-sorting protein LolA [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
          Length = 223

 Score = 79.9 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/188 (12%), Positives = 59/188 (31%), Gaps = 13/188 (6%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
           A+             + ++       ++ + G F Q              G   +A P +
Sbjct: 22  AVLATALFASTAFAGARQELDTFTRGLKGLDGQFSQRVTDAKGRVKETSSGRVALATPRQ 81

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQESIQ 129
           F ++Y+ P    +++DG  + V +  L+  +V       +      +        +  + 
Sbjct: 82  FRWEYAKPYKQLIVADGKKVWVLDPDLEQVTVRAQGSEEQNSPLVALIDPALLDKKYDVS 141

Query: 130 RV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
                     ++++  K D   +    +       L   +++D+  + + I    +K N 
Sbjct: 142 EEAAPRDGLQWLSLTPKVDTDASFQIASLGFSKDGLARMEVVDAVGQRTAISFSGWKRNP 201

Query: 187 VLDPKVFE 194
                 F 
Sbjct: 202 AFAADTFR 209


>gi|83645243|ref|YP_433678.1| outer-membrane lipoprotein carrier protein [Hahella chejuensis KCTC
           2396]
 gi|123533542|sp|Q2SJC1|LOLA_HAHCH RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|83633286|gb|ABC29253.1| outer membrane lipoprotein carrier protein LolA [Hahella chejuensis
           KCTC 2396]
          Length = 209

 Score = 79.9 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/197 (13%), Positives = 61/197 (30%), Gaps = 13/197 (6%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM------KGEFFM 68
           L    ++   +AA  +     V        +++T    F Q              G    
Sbjct: 3   LLKLLSVAALSAASMMANAAGVDALSGLLKNVETFTANFTQTMRSQSGQVLQEVTGTLKA 62

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVI-------FSNNQ 121
            RP  F++K  +P   ++++DG  + +Y+  L+  ++  L     +              
Sbjct: 63  KRPGLFFWKTRAPLEQTIVTDGQQVWIYDPDLEQVTIQHLSQQLSNTPALLLSGEVGKID 122

Query: 122 HVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
              Q   Q          +           ++    ++ +L++ K+ DS  + + +    
Sbjct: 123 EQYQVEQQPESQPGQVDFLLRPKGVDSLFDTLQLSFVNDQLVSMKLKDSLGQQTSLFFTA 182

Query: 182 YKENTVLDPKVFEIPYD 198
              N  +  K F     
Sbjct: 183 VSVNQTISEKAFHFEIP 199


>gi|226951586|ref|ZP_03822050.1| outer-membrane lipoprotein carrier protein [Acinetobacter sp. ATCC
           27244]
 gi|294651245|ref|ZP_06728573.1| outer-membrane lipoprotein carrier [Acinetobacter haemolyticus ATCC
           19194]
 gi|226837667|gb|EEH70050.1| outer-membrane lipoprotein carrier protein [Acinetobacter sp. ATCC
           27244]
 gi|292822898|gb|EFF81773.1| outer-membrane lipoprotein carrier [Acinetobacter haemolyticus ATCC
           19194]
          Length = 231

 Score = 79.9 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 36/226 (15%), Positives = 73/226 (32%), Gaps = 29/226 (12%)

Query: 1   MAFLLYKSV-----IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ 55
           M F   K +     +  + L    +I    A    +  Q+    ++   S+Q     F Q
Sbjct: 1   MNF--MKKIAYATTLSAITLAPVVSIQVSAAPVAASAQQATTSLVQQLSSLQRFTADFEQ 58

Query: 56  EDA-----------------GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNA 98
                                   KG   + RP KFY++ +SP+  ++++ G  + +Y+ 
Sbjct: 59  TTKVSNNKAAPKRGLTAQHMNQTFKGVMKVERPGKFYWEITSPAKQTIVTSGKTVWIYDP 118

Query: 99  KLDTW-----SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISV 153
            L                A  +  + NQ +    + + +    + T++ K D        
Sbjct: 119 DLQQAIRQNLDDQVANTPALLLSGNTNQIMQSYRVTQPDRTKLYYTLYPKQDDSTFQSLT 178

Query: 154 TFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                +       + DS  + + ++    K N  +   VF     K
Sbjct: 179 ISFGANRAPNLMILQDSLGQTTYVRFSNVKVNQAIPASVFNFEPPK 224


>gi|160872671|ref|ZP_02062803.1| outer membrane lipoprotein carrier protein LolA [Rickettsiella
           grylli]
 gi|159121470|gb|EDP46808.1| outer membrane lipoprotein carrier protein LolA [Rickettsiella
           grylli]
          Length = 207

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 36/212 (16%), Positives = 69/212 (32%), Gaps = 19/212 (8%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG- 59
           M F     V  +++L  +           + +  + +   +   +IQT +  F Q     
Sbjct: 1   MNFFNPLKVFFIIVLLCF----------GVERALADEPLSQLLNNIQTYRAHFTQTVFDP 50

Query: 60  -----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS 114
                    GE  + RP  F ++   P+   LI+DG +I  Y+  L   +V         
Sbjct: 51  RGQILQTANGEMTLQRPGHFRWEIYQPTKQLLIADGQHIWFYDINLQQITVQKQTKADPD 110

Query: 115 VIFSNNQHVIQESIQRVESNNSFIT---IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS 171
              +      +   QR              F  +      ++T    +  L    ++D  
Sbjct: 111 SPQALLSESSKNLSQRFIIQPLKTIQGFTLFPKNKNALFQNITLIFKNNLLYEMHLIDKL 170

Query: 172 RRYSIIKILKYKENTVLDPKVFEIPYDKIHNI 203
            + ++I     + N +L  + F     K  NI
Sbjct: 171 DQQTVINFSHIELNPILPKQTFRFVIPKDKNI 202


>gi|289666016|ref|ZP_06487597.1| outer-membrane lipoprotein carrier protein [Xanthomonas campestris
           pv. vasculorum NCPPB702]
 gi|289670477|ref|ZP_06491552.1| outer-membrane lipoprotein carrier protein [Xanthomonas campestris
           pv. musacearum NCPPB4381]
          Length = 209

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/188 (12%), Positives = 61/188 (32%), Gaps = 13/188 (6%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
           A+             + ++       ++ + G F Q              G   +A P +
Sbjct: 8   AVLATALLASTAIAGARQELDTFTRGLKGLDGQFSQRVTDANGKVKENSSGRVALATPRQ 67

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQESIQ 129
           F ++Y+ P    +++DG  + V++  L+  +V       +      + +      +  + 
Sbjct: 68  FRWEYAKPYKQLIVADGKKVWVFDPDLEQVTVRAQGSEEQNSPLVALINPALLDKKYDVS 127

Query: 130 RV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
                     ++++  K D   +    +       L   +++D+  + + I    +K N 
Sbjct: 128 EEAAPRDGLQWLSLTPKVDTDASFQMASLGFGKDGLAKMEVVDAVGQRTAISFSGWKRNP 187

Query: 187 VLDPKVFE 194
                 F 
Sbjct: 188 AFAADTFR 195


>gi|331001207|ref|ZP_08324834.1| outer membrane lipoprotein carrier protein LolA [Parasutterella
           excrementihominis YIT 11859]
 gi|329569139|gb|EGG50931.1| outer membrane lipoprotein carrier protein LolA [Parasutterella
           excrementihominis YIT 11859]
          Length = 221

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 41/206 (19%), Positives = 77/206 (37%), Gaps = 17/206 (8%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-------EDA 58
            K  +    L   + +FPF         Q +          +   G F Q       + A
Sbjct: 13  KKRFMKKTALLTITGLFPFVVFS-----QPLDLLNNFLNETKQASGAFEQQTFQKDGKPA 67

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFS 114
             + KG F  +RP KF + Y+SP    ++ DGS I +++  L+  +V      +     S
Sbjct: 68  EELQKGTFSFSRPGKFVWTYTSPYPQKMVCDGSRIYIWDEDLNQVTVRSAKGAIPKSPAS 127

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
           ++F    +    +  + +  + +  I         ++ SV+F   S +L     + S   
Sbjct: 128 ILFGTQSYKKDWNATQPKQEDGYTWITLTPKAKDASVNSVSFGFKSEKLEKLIFVGSMGE 187

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            + + I   K +  L P+ F+    K
Sbjct: 188 KTNLTISDLKTDVQLSPETFKFTAPK 213


>gi|227112003|ref|ZP_03825659.1| outer-membrane lipoprotein carrier protein [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 203

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/202 (14%), Positives = 59/202 (29%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K  + +  L                   + K        + +    F Q+         
Sbjct: 1   MKKWLAISCLI-------AGVTSTAVYADAAKDLQGRLNKVNSFHANFSQKVTSADGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +GE ++ RP+ F +K +SP   +LISDG  +  YN  ++  +   L+    +   I 
Sbjct: 54  QEGEGELWLKRPNLFNWKTTSPDESTLISDGKTLWFYNPFVEQVTATWLKDATGNTPFIL 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                    +   V        +  K               S  +  +   +   + S  
Sbjct: 114 ITRNDASDWNKYDVRQKGDDFELTPKSASGNLKQFAINVTTSGTIKQFTATEQDGQRSTY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +   ++N  +D   F     K
Sbjct: 174 VLKN-QQNGAVDAAQFTFTPPK 194


>gi|123441838|ref|YP_001005821.1| outer-membrane lipoprotein carrier protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|166230504|sp|A1JMF6|LOLA_YERE8 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|122088799|emb|CAL11605.1| putative outer-membrane lipoproteins carrier protein [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 203

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 65/204 (31%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM--- 62
            K ++    L                   +          + +    F Q+         
Sbjct: 1   MKKLLVACCLLSGLI-------SAHALADASSDLQARLGKVNSFHANFSQKVTSSEGTAV 53

Query: 63  ---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +GE ++ RP+ F +  +SP    LISDG  +  YN  ++  +            F +
Sbjct: 54  QEGEGELWVKRPNLFNWHMTSPDESVLISDGETLWFYNPFVEQATATWLKNATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  NN    ++   + + ++  +T       +           +  + ++  ++   + S
Sbjct: 114 ITRNNPDDWKQYNVKQKGDDFELTPKSASGNLKQFAITV--TPTGTIKSFTAVEQDGQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
              +   ++N+  D   F+    K
Sbjct: 172 AYTLKG-QQNSSADASKFKFTLPK 194


>gi|325927612|ref|ZP_08188841.1| Outer membrane lipoprotein-sorting protein LolA [Xanthomonas
           perforans 91-118]
 gi|325541979|gb|EGD13492.1| Outer membrane lipoprotein-sorting protein LolA [Xanthomonas
           perforans 91-118]
          Length = 223

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/188 (12%), Positives = 59/188 (31%), Gaps = 13/188 (6%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
           A+             + ++       ++ + G F Q              G   +A P +
Sbjct: 22  AVLATALFASTAFAGARQELDTFTRGLKGLDGQFSQRVTDANGRVKETSSGRVALATPRQ 81

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQESIQ 129
           F ++Y+ P    +++DG  + V +  L+  +V       +      +        +  + 
Sbjct: 82  FRWEYAKPYKQLIVADGKKVWVLDPDLEQVTVRAQGSEEQNSPLVALIDPALLDKKYDVS 141

Query: 130 RV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
                     ++++  K D   +    +       L   +++D+  + + I    +K N 
Sbjct: 142 EEAAPRDGLQWLSLTPKVDTDASFQIASLGFGKEGLARMEVVDAVGQRTAISFSGWKRNP 201

Query: 187 VLDPKVFE 194
                 F 
Sbjct: 202 AFAADTFR 209


>gi|227328171|ref|ZP_03832195.1| outer-membrane lipoprotein carrier protein [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 203

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/202 (14%), Positives = 59/202 (29%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K  + +  L                   + K        + +    F Q+         
Sbjct: 1   MKKWLAISCLI-------AGVTSTAVYADAAKDLQGRLNKVNSFHANFSQKVTSADGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +GE ++ RP+ F +K +SP   +LISDG  +  YN  ++  +   L+    +   I 
Sbjct: 54  QEGEGELWLKRPNLFNWKTTSPDESTLISDGKTLWFYNPFVEQVTATWLKDATGNTPFIL 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                    +   V        +  K               +  +  +   +   + S  
Sbjct: 114 ITRNDASDWNKYDVRQKGDDFELTPKSASGNLKQFAINVTTNGTIKQFTATEQDGQRSTY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +   ++N  +D   F     K
Sbjct: 174 VLKN-QQNGAVDAAQFTFTPPK 194


>gi|318606282|emb|CBY27780.1| outer membrane lipoprotein carrier protein LolA [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 203

 Score = 79.5 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 65/204 (31%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM--- 62
            K ++    L                   +          + +    F Q+         
Sbjct: 1   MKKLLVACCLLSGLI-------SAHALADASSDLQARLSKVNSFHANFSQKVTSSEGTAV 53

Query: 63  ---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +GE ++ RP+ F +  +SP    LISDG  +  YN  ++  +            F +
Sbjct: 54  QEGEGELWVKRPNLFNWHMTSPDESILISDGETLWFYNPFVEQATATWLKNATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  NN    ++   + + ++  +T       +           +  + ++  ++   + S
Sbjct: 114 ITRNNPDDWKQYNVKQKGDDFELTPKSASGNLKQFAITV--TPTGTIKSFTAVEQDGQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
              +   ++N+  D   F+    K
Sbjct: 172 AYTLKG-QQNSSADASKFKFTLPK 194


>gi|303326802|ref|ZP_07357244.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio sp.
           3_1_syn3]
 gi|302862790|gb|EFL85722.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio sp.
           3_1_syn3]
          Length = 226

 Score = 79.5 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 18/206 (8%), Positives = 50/206 (24%), Gaps = 14/206 (6%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM----- 62
            + G+ I    +                     + + ++ +    F Q            
Sbjct: 2   RISGMFIAAGTALCALLWLTPAANAADLAAVIQQRYETLNSFSADFEQTLTHKESGSVER 61

Query: 63  -KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL--------RYMAF 113
            +G     +P    ++ + P   +L+     I  Y    +    YP              
Sbjct: 62  RQGSLLFQKPLLIRWQTAKPHEETLVVTAKEIWDYLPDEEVAYRYPPGLVRDSRSIIQVI 121

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRR 173
           +   +  +    +     +          +         +  +  +  +    I+D    
Sbjct: 122 TGQAALTKDFDVKPEGSEQGLAKLRLYPKEPAPQMVEALIWVEPDNGYIRRASIVDFYGN 181

Query: 174 YSIIKILKYKENTVLDPKVFEIPYDK 199
            + ++   +K +  L    F     K
Sbjct: 182 TNEVRFTSFKPDMRLKASDFSFTPPK 207


>gi|83945068|ref|ZP_00957434.1| Outer-membrane lipoprotein carrier protein [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851850|gb|EAP89705.1| Outer-membrane lipoprotein carrier protein [Oceanicaulis alexandrii
           HTCC2633]
          Length = 236

 Score = 79.5 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/187 (16%), Positives = 72/187 (38%), Gaps = 11/187 (5%)

Query: 25  NAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK-GEFFMARPSKFYFKYSSPSS 83
            A   IT +    +A      + T++  F Q  A      G   + RP +  F Y  P+ 
Sbjct: 40  TAPGQITPEAGADRAQAWLEGLDTLRARFEQIAADNSETAGVLEIDRPGRARFDYDDPNP 99

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNS---FITI 140
           V +++DGS +A+ +  L+T    P+       +  ++  +                F+T+
Sbjct: 100 VLVVADGSTVAIADFDLETIDRAPIGATPLRFLLEDDLDLAGSGAVVDAGRYDGRLFVTL 159

Query: 141 FFKDDFMGNMISVTFDRLSYR-------LLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
              +  +   +++ F+  +         L  W  +D+    + +K+ + +    + P+ F
Sbjct: 160 EDPEGEVQGRLTLVFEDATPDAGPETMALAGWYAVDAMGGLTEVKLTEIETGVRISPRQF 219

Query: 194 EIPYDKI 200
            +  + +
Sbjct: 220 ILDDEDV 226


>gi|194365712|ref|YP_002028322.1| outer-membrane lipoprotein carrier protein [Stenotrophomonas
           maltophilia R551-3]
 gi|194348516|gb|ACF51639.1| outer membrane lipoprotein carrier protein LolA [Stenotrophomonas
           maltophilia R551-3]
          Length = 212

 Score = 79.5 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/212 (13%), Positives = 65/212 (30%), Gaps = 20/212 (9%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG- 59
           M F L +           + +    AA       +          ++ + G F Q+    
Sbjct: 1   MNFRLRR-------FLATTTLAVACAAAGSAWAGARDDLKTFTSGLKGLDGQFSQQVFDS 53

Query: 60  -----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RY 110
                    G   ++ P  F ++Y  P    +++DG  + +Y   L+  +V       + 
Sbjct: 54  RGKVKESTSGRVALSAPRLFRWEYVRPHEQLIVADGKKVWMYEPDLEQATVREQGKEEQN 113

Query: 111 MAFSVIFSNNQHVIQESIQRV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKI 167
              + + +      Q  +           ++++  K D   +         +  L   +I
Sbjct: 114 SPLTALINPALLEQQYDLSEEAAQRDGLQWLSLSPKRDTEASFQYAALGFNAQGLAKMEI 173

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            D+  + ++I    +K N       F     K
Sbjct: 174 TDAVGQRTVISFSGWKRNPGFAAGTFSFTPPK 205


>gi|330829976|ref|YP_004392928.1| outer-membrane lipoprotein carrier protein [Aeromonas veronii B565]
 gi|328805112|gb|AEB50311.1| Outer-membrane lipoprotein carrier protein [Aeromonas veronii B565]
          Length = 206

 Score = 79.2 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/207 (12%), Positives = 63/207 (30%), Gaps = 17/207 (8%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY 60
           M  ++ K ++   +L           A       +     +    +      F Q     
Sbjct: 1   MKSVMKKQLLMGTVLL---------MASSQVWADAASDLKQKLAGVSLFSAKFAQTVYDS 51

Query: 61  VMK------GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS 114
             K      G+  + RP++F +  +SP    +++DG ++ VY+  ++  +   L+    +
Sbjct: 52  KGKELQKASGDLLVQRPNRFNWHTTSPDESLIVADGQDVWVYDPFVEQVTALKLKDAVLN 111

Query: 115 --VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSR 172
              I              V       T+  ++                 +  + + ++  
Sbjct: 112 TPFILIAGNDDKFWKNYDVTKEGDVYTVTSRNKDELIASFRVTFDRQDNISRFDVKEAQG 171

Query: 173 RYSIIKILKYKENTVLDPKVFEIPYDK 199
           ++S   +  +    VL    F     K
Sbjct: 172 QWSEFTLSSFNRKPVLKGNEFVFKIPK 198


>gi|109898774|ref|YP_662029.1| outer membrane lipoprotein carrier protein LolA [Pseudoalteromonas
           atlantica T6c]
 gi|109701055|gb|ABG40975.1| outer membrane lipoprotein carrier protein LolA [Pseudoalteromonas
           atlantica T6c]
          Length = 213

 Score = 79.2 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/189 (13%), Positives = 60/189 (31%), Gaps = 9/189 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPS 72
             +          +     K      ++     +F Q+             G   + +P+
Sbjct: 17  LLLMLGAIFSVNAQQTDEDKLKARLQTLHNFSASFTQKVTDANHEVLQEATGVIKLKQPN 76

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQR 130
           K Y++ + P+   LI+DGS +   +  ++  +         +  +I     +        
Sbjct: 77  KLYWELNPPNENILIADGSTLWNVDPFVEQVTAISQDQAVANNPLILLTQPNSDAWENFS 136

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
           V   N    I  K        S+       +L +  + DS ++ S +     ++N  +  
Sbjct: 137 VSHTNDTFRIDAKKPDSAV-HSLVLVFDGAQLTSMSMQDSQQQISDLYFNDIQQNKTVSD 195

Query: 191 KVFEIPYDK 199
           +VF     +
Sbjct: 196 EVFTFSLPE 204


>gi|238763312|ref|ZP_04624276.1| Outer-membrane lipoprotein carrier protein [Yersinia kristensenii
           ATCC 33638]
 gi|238698411|gb|EEP91164.1| Outer-membrane lipoprotein carrier protein [Yersinia kristensenii
           ATCC 33638]
          Length = 213

 Score = 79.2 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/202 (13%), Positives = 65/202 (32%), Gaps = 13/202 (6%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM----- 62
            V  ++     +               +          + +    F Q+           
Sbjct: 6   KVFRIMKKLLVACCLLSGLISAHALADASSDLQGRLSKVNSFHANFSQKVTSSEGTAIQE 65

Query: 63  -KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIF 117
            +GE ++ RP+ F +  +SP    LISDG  +  YN  ++  +            F +I 
Sbjct: 66  GEGELWVKRPNLFNWHMTSPDESVLISDGETLWFYNPFVEQATATWLKNATGNTPFMLIT 125

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
            NN    ++   + + ++  +T       +           +  + ++  ++   + S  
Sbjct: 126 RNNPDDWKQYNVKQKGDDFELTPKSASGNLKQFAITV--TPTGTIKSFTAVEQDGQRSAY 183

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +   ++N+  D   F+    K
Sbjct: 184 TLKG-QQNSSADASKFKFTLPK 204


>gi|332162219|ref|YP_004298796.1| outer-membrane lipoprotein carrier protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|325666449|gb|ADZ43093.1| outer-membrane lipoprotein carrier protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
          Length = 203

 Score = 79.2 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/204 (13%), Positives = 65/204 (31%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM--- 62
            K ++    L                   +          + +    F Q+         
Sbjct: 1   MKKLLVACCLLSGLI-------SAHALADASSDLQARLSKVNSFHANFSQKVTSSEGTAV 53

Query: 63  ---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +GE ++ RP+ F +  ++P    LISDG  +  YN  ++  +            F +
Sbjct: 54  QEGEGELWVKRPNLFNWHMTTPDESILISDGETLWFYNPFVEQATATWLKNATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  NN    ++   + + ++  +T       +           +  + ++  ++   + S
Sbjct: 114 ITRNNPDDWKQYNVKQKGDDFELTPKSASGNLKQFAITV--TPTGTIKSFTAVEQDGQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
              +   ++N+  D   F+    K
Sbjct: 172 AYTLKG-QQNSSADASKFKFTLPK 194


>gi|157369927|ref|YP_001477916.1| outer-membrane lipoprotein carrier protein [Serratia proteamaculans
           568]
 gi|166990717|sp|A8GCE8|LOLA_SERP5 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|157321691|gb|ABV40788.1| outer membrane lipoprotein carrier protein LolA [Serratia
           proteamaculans 568]
          Length = 203

 Score = 79.2 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/204 (15%), Positives = 67/204 (32%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----- 60
            K ++    L           A       + +        + +   +F Q          
Sbjct: 1   MKKLLVACCLLSGF-------ASTSVLADAAQDLQSRLAKVNSFHASFSQTVTSSDGAAV 53

Query: 61  -VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +GE ++ RP+ F +  +SP    L+SDG  +  YN  ++  +            F +
Sbjct: 54  QQGEGELWVKRPNLFNWHMTSPDESVLVSDGQTLWFYNPFVEQVTATWLKNATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  NN +  ++   + + N+  +T       +           S  + N+  ++   + S
Sbjct: 114 ITRNNANDWKQYNVKQKGNDFELTPKSSSGNLKQFAISV--DNSGTIRNFAAVEQDGQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
              +   ++N   D   F+    K
Sbjct: 172 SYTLKS-QQNVAADASKFKFTPPK 194


>gi|253688107|ref|YP_003017297.1| outer membrane lipoprotein carrier protein LolA [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|259491788|sp|C6DF52|LOLA_PECCP RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|251754685|gb|ACT12761.1| outer membrane lipoprotein carrier protein LolA [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 203

 Score = 79.2 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/202 (14%), Positives = 59/202 (29%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K  + +  L                   + K        + +    F Q+         
Sbjct: 1   MKKWLAISCLI-------AGMTSTAVYADAAKDLQGRLNKVNSFHANFSQKVTSADGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +GE ++ RP+ F +K +SP   +LISDG  +  YN  ++  +   L+    +   I 
Sbjct: 54  QEGEGELWLKRPNLFNWKTTSPDESTLISDGKTLWFYNPFVEQVTATWLKDATGNTPFIL 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                    +   V        +  K               +  +  +   +   + S  
Sbjct: 114 ITRNDASDWNKYDVRQKGDDFELTPKSASGNLKQFAINVTTNGTIKQFTATEQDGQRSTY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +   ++N  +D   F     K
Sbjct: 174 VLKN-QQNAAVDAAQFTFTPPK 194


>gi|294625251|ref|ZP_06703890.1| outer-membrane lipoprotein carrier protein precursor [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|292600425|gb|EFF44523.1| outer-membrane lipoprotein carrier protein precursor [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
          Length = 223

 Score = 79.2 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/188 (12%), Positives = 60/188 (31%), Gaps = 13/188 (6%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
           A+             + ++       ++ + G F Q              G   +A P +
Sbjct: 22  AVLATALFASTAFAGARQELDTFTRGLKGLDGQFSQRVTDANGRVKETSSGRVALATPRQ 81

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQESIQ 129
           F ++Y+ P    +++DG  + V++  L+  +V       +      +        +  + 
Sbjct: 82  FRWEYAKPYKQLIVADGKKVWVFDPDLEQVTVRAQGSEEQNSPLVALIDPALLDKKYDVS 141

Query: 130 RV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
                     ++++  K D   +    +       L   +++D+  + + I    +K N 
Sbjct: 142 EEAAPRDGLQWLSLTPKVDTDASFQIASLGFGREGLARMEVVDAVGQRTAIGFSGWKRNP 201

Query: 187 VLDPKVFE 194
                 F 
Sbjct: 202 AFAADTFR 209


>gi|21242752|ref|NP_642334.1| outer-membrane lipoprotein carrier protein [Xanthomonas axonopodis
           pv. citri str. 306]
 gi|23821825|sp|Q8PKZ8|LOLA_XANAC RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|21108231|gb|AAM36870.1| outer-membrane lipoproteins carrier protein precursor [Xanthomonas
           axonopodis pv. citri str. 306]
          Length = 209

 Score = 79.2 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/188 (12%), Positives = 60/188 (31%), Gaps = 13/188 (6%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
           A+             + ++       ++ + G F Q              G   +A P +
Sbjct: 8   AVLATALFASTAFAGARQELDTFTRGLKGLDGQFSQRVTDANGRVKETSSGRVALATPRQ 67

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQESIQ 129
           F ++Y+ P    +++DG  + V++  L+  +V       +      +        +  + 
Sbjct: 68  FRWEYAKPYKQLIVADGKKVWVFDPDLEQVTVRAQGSEEQNSPLVALIDPALLDKKYDVS 127

Query: 130 RV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
                     ++++  K D   +    +       L   +++D+  + + I    +K N 
Sbjct: 128 EEAAPRDGLQWLSLTPKVDTDASFQIASLGFGREGLARMEVVDAVGQRTAIGFSGWKRNP 187

Query: 187 VLDPKVFE 194
                 F 
Sbjct: 188 AFAADTFR 195


>gi|254797060|ref|YP_003081898.1| outer membrane lipoprotein carrier protein LolA [Neorickettsia
           risticii str. Illinois]
 gi|254590307|gb|ACT69669.1| outer membrane lipoprotein carrier protein LolA [Neorickettsia
           risticii str. Illinois]
          Length = 183

 Score = 78.8 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/193 (13%), Positives = 61/193 (31%), Gaps = 13/193 (6%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVM 62
           +  K      +LF   A     A+  +   +     + +  S++T+  TF+Q    G + 
Sbjct: 1   MSVKR---FAVLFCVLAFCCVRASCALDNAE----LVSYLASLRTLCATFVQYNPDGTLS 53

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQH 122
            G  F++ P KF   Y        ++    +  Y       S       +  ++ + +  
Sbjct: 54  TGSLFLSVPHKFRVDYHEEGVS--VAMNKGMITYRDATLKESRSFFVGKSDPLLLAISDL 111

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
                 ++      F     +         +        +      D S++ + + +   
Sbjct: 112 GALHRYKQSIRGGLFYL---ERSSKNRKYVLVLSHSPAEIREILFEDDSKQITRMILSDV 168

Query: 183 KENTVLDPKVFEI 195
             N  LD  +F+I
Sbjct: 169 CYNASLDRSIFDI 181


>gi|212635391|ref|YP_002311916.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           piezotolerans WP3]
 gi|226737656|sp|B8CP85|LOLA_SHEPW RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|212556875|gb|ACJ29329.1| Outer membrane lipoprotein carrier protein LolA [Shewanella
           piezotolerans WP3]
          Length = 208

 Score = 78.8 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/206 (13%), Positives = 69/206 (33%), Gaps = 13/206 (6%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
              +I + I+                +  + ++       I  ++  F Q          
Sbjct: 1   MNKLIAIAIVSLPLLTHF------SAQADASEQLKVKLAEIDNLKANFSQTVTDINDKVI 54

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
              +G F +A+P++FY+  ++P    +++DG+++ +YN   +  SV  +     +   + 
Sbjct: 55  QTGEGVFALAQPNQFYWHLTAPDESLIVADGTDVWIYNPFNEEVSVMDVNQAISASPIAL 114

Query: 120 NQHVIQESIQRVESNN-SFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
             H   ++  + +  N          D    +  V        L    + D     S   
Sbjct: 115 LVHDDAKTWAQYQVTNTDQCFAISPIDKDAGVSEVEVCFNETTLTEMVLKDQQGNTSSFL 174

Query: 179 ILKYKENTVLDPKVFEIPYDKIHNIN 204
           + +       +  +F+    +  +I+
Sbjct: 175 LSEQTTLDKSEKNLFKFVVPEDVDID 200


>gi|315633926|ref|ZP_07889215.1| outer membrane lipoprotein carrier protein LolA [Aggregatibacter
           segnis ATCC 33393]
 gi|315477176|gb|EFU67919.1| outer membrane lipoprotein carrier protein LolA [Aggregatibacter
           segnis ATCC 33393]
          Length = 223

 Score = 78.8 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 26/203 (12%), Positives = 61/203 (30%), Gaps = 9/203 (4%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           L K +  +   F         A   +    +  +       + T+   F Q  +      
Sbjct: 12  LNKELNNMKKTFQKLTALSLLAMATLAWANADIELQNRLNKVDTLSADFAQTVSSANGKN 71

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VI 116
                G+  + RP+ F     SP    +I+DG  +  Y+  ++  +   ++    +   +
Sbjct: 72  VQQGNGKLQIKRPNLFRMDTKSPQETQIIADGQTLWFYDPFVEQVTANWVKEAVNNTPFV 131

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
              +      +   VE  +    +  K               +  L  +  ++   + + 
Sbjct: 132 LLTSNDKSHWAQYSVEQKDDTFVLKPKAKNSNIKQFDIRIDQNGVLKGFSTIEKDGQSNQ 191

Query: 177 IKILKYKENTVLDPKVFEIPYDK 199
             +     N  LD  +F+    K
Sbjct: 192 YILRNI-TNQHLDGGLFKFSIPK 213


>gi|237809055|ref|YP_002893495.1| outer membrane lipoprotein carrier protein LolA [Tolumonas auensis
           DSM 9187]
 gi|237501316|gb|ACQ93909.1| outer membrane lipoprotein carrier protein LolA [Tolumonas auensis
           DSM 9187]
          Length = 207

 Score = 78.8 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 24/188 (12%), Positives = 56/188 (29%), Gaps = 8/188 (4%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
                 +              +   S +     F QE             GE  + RP  
Sbjct: 12  LTACVWSLSFNALADDSAALKKKLASFRQFSAHFEQEVLDAQGKPLQKGSGEMVLQRPDH 71

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRV 131
           F ++   P    ++SDG  + +Y+  ++  +V  L     +   +  ++      +   +
Sbjct: 72  FRWEAKQPDDNLILSDGKAVWLYDPFVEQVTVMSLSKAVINTPFLLISSTDDKIWNNYLI 131

Query: 132 ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPK 191
           + + S  TI  K                 R+   ++ ++  + S   +  +    V+   
Sbjct: 132 DQDGSAFTITSKKKDQRIESLRMVFDSQNRISRMEVNEAQGQRSEFTLSSFNTKPVIKSD 191

Query: 192 VFEIPYDK 199
            F     +
Sbjct: 192 TFNFKAPE 199


>gi|220904476|ref|YP_002479788.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
 gi|219868775|gb|ACL49110.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
          Length = 225

 Score = 78.8 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 20/208 (9%), Positives = 52/208 (25%), Gaps = 16/208 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM--- 62
            + +   +       I    A    T           +  + +    F Q          
Sbjct: 1   MRMLRAAIAAMALCLIMTSFATAQNT--DMAAAIQARYEKLGSFAADFDQTLTHKESGAV 58

Query: 63  ---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAFS 114
              +G+    +P    ++  +P   +L+  G  I  Y  + +    YP            
Sbjct: 59  EKRQGKLLFKKPLLIRWQTVTPHEETLVVTGKEIWNYIPEEEVAYRYPPSLVQDSRSIIQ 118

Query: 115 VIFSNNQHVIQESIQRVESNN---SFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS 171
           VI           ++     +          +         +  +  +  +    I+D  
Sbjct: 119 VITGQAALTKDFDVKAEGREDGLSKLRLFPKEPAPQMVEAVIWVEPDTGYIRRASILDFY 178

Query: 172 RRYSIIKILKYKENTVLDPKVFEIPYDK 199
              + ++  ++  +  +    F     K
Sbjct: 179 GNSNEVRFNRFSPDVSIKASEFSFTPPK 206


>gi|127512951|ref|YP_001094148.1| outer membrane lipoprotein carrier protein LolA [Shewanella loihica
           PV-4]
 gi|166230499|sp|A3QEJ1|LOLA_SHELP RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|126638246|gb|ABO23889.1| outer membrane lipoprotein carrier protein LolA [Shewanella loihica
           PV-4]
          Length = 208

 Score = 78.8 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 24/182 (13%), Positives = 59/182 (32%), Gaps = 13/182 (7%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSP 81
              +         +    +  ++  F Q+             G F +A P++FY+  + P
Sbjct: 17  AASSYADDSAALKDKLAKLDNLKANFSQQVTDVNNKVIQQGTGTFALAVPNQFYWHLTQP 76

Query: 82  SSVSLISDGSNIAVYNAKLDT----WSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSF 137
               +++DG ++ +YN   +          +     +++   +    Q    + + +   
Sbjct: 77  DESLIVADGRDVWIYNPFAEEVSVLDFNQAINASPIALLVHRDDATWQAYQVKRQDDCYQ 136

Query: 138 ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
           IT    D  +  +     D    +L   K+ D     S+  +         D  +F+   
Sbjct: 137 ITPKAVDASVTGVEVCFKDE---QLEVMKLTDQQGNLSVFNLSAQAPLKDADASLFQFTV 193

Query: 198 DK 199
            +
Sbjct: 194 PE 195


>gi|238792412|ref|ZP_04636046.1| Outer-membrane lipoprotein carrier protein [Yersinia intermedia
           ATCC 29909]
 gi|238728338|gb|EEQ19858.1| Outer-membrane lipoprotein carrier protein [Yersinia intermedia
           ATCC 29909]
          Length = 203

 Score = 78.8 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 65/204 (31%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----- 60
            K ++    L                   +          + +    F Q+         
Sbjct: 1   MKKLLVACCLLSGLI-------SASVLADASTDLQGRLSKVNSFHANFSQKVTSSDGAAV 53

Query: 61  -VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +GE ++ RP+ F +  +SP    LISDG  +  YN  ++  +            F +
Sbjct: 54  QEGEGELWVKRPNLFNWHMTSPDESVLISDGETLWFYNPFVEQATATWLKNATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  NN    ++   + + ++  +T       +           +  + ++  ++   + S
Sbjct: 114 ITRNNPDDWKQYNVKQKGDDFELTPKSASGNLKQFAITV--TPTGTIKSFTAVEQDGQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
              +   ++N+  D   F+    K
Sbjct: 172 AYTLKG-QQNSSADASKFKFTLPK 194


>gi|154706276|ref|YP_001424635.1| outer-membrane lipoproteins carrier protein [Coxiella burnetii
           Dugway 5J108-111]
 gi|212212419|ref|YP_002303355.1| outer-membrane lipoproteins carrier protein [Coxiella burnetii
           CbuG_Q212]
 gi|189028548|sp|A9KFP6|LOLA_COXBN RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229485825|sp|B6IZT2|LOLA_COXB2 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|154355562|gb|ABS77024.1| outer-membrane lipoproteins carrier protein [Coxiella burnetii
           Dugway 5J108-111]
 gi|212010829|gb|ACJ18210.1| outer-membrane lipoproteins carrier protein [Coxiella burnetii
           CbuG_Q212]
          Length = 211

 Score = 78.8 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 29/196 (14%), Positives = 64/196 (32%), Gaps = 12/196 (6%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEF 66
           +++          +     +  +  +  +   + +T Q  F Q              G  
Sbjct: 6   ILIGLLGIFLFSLSGIVSAQSDATTQLSQLLSNFRTYQAKFNQITFDGQDRVIQQSHGRV 65

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE 126
            + RP +F ++  SP+   +I++G  + VY+  L   +  PL         S     +++
Sbjct: 66  MIMRPGRFRWETDSPTKQIIITNGKTLWVYDVDLSQATQQPLAQKTNINPASLLSGSVKD 125

Query: 127 SIQRVESNNS------FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
             Q+     S         +        N   +       +L    ++++    SI +  
Sbjct: 126 LKQKFTITISPTPDAATFQLVPHLGKSLNFNWIRLKFSKKQLTEMTVLNNLDERSIFQFS 185

Query: 181 KYKENTVLDPKVFEIP 196
           + K N  L   +FE  
Sbjct: 186 QIKVNAPLSSTLFEFK 201


>gi|50121570|ref|YP_050737.1| outer-membrane lipoprotein carrier protein [Pectobacterium
           atrosepticum SCRI1043]
 gi|81644761|sp|Q6D3U8|LOLA_ERWCT RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|49612096|emb|CAG75546.1| outer-membrane lipoproteins carrier protein [Pectobacterium
           atrosepticum SCRI1043]
          Length = 203

 Score = 78.8 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 30/202 (14%), Positives = 60/202 (29%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K  + +  L                   + K        + +    F Q+         
Sbjct: 1   MKKWLAISCLI-------AGVTSTAVYADAAKDLQGRLNKVNSFHANFSQKVTSTDGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +GE ++ RP+ F +K +SP   +LISDG  +  YN  ++  +   L+    +   I 
Sbjct: 54  QEGEGELWLKRPNLFNWKTTSPDESALISDGKTLWFYNPFVEQVTATWLKDATGNTPFIL 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                    +   V        +  K               +  +  +   +   + S  
Sbjct: 114 ITRNDTSDWNKYDVRQKGDDFELTPKSASGNLKQFAINVTTNGTIKQFTATEQDGQRSTY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +   ++N V+D   F     K
Sbjct: 174 VLRN-QQNGVVDAAQFTFTPPK 194


>gi|256829458|ref|YP_003158186.1| outer membrane lipoprotein carrier protein LolA [Desulfomicrobium
           baculatum DSM 4028]
 gi|256578634|gb|ACU89770.1| outer membrane lipoprotein carrier protein LolA [Desulfomicrobium
           baculatum DSM 4028]
          Length = 212

 Score = 78.4 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 26/198 (13%), Positives = 60/198 (30%), Gaps = 14/198 (7%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------GEFFMA 69
           FF   +F   + +         +  + + ++Q+ +G FLQ+             G     
Sbjct: 4   FFMGLLFVLTSVWCAQAADLSDQIQKRYDTLQSFRGFFLQKLTNASSHEVQERLGSITFK 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQ 129
           RP    ++ +SP +  LI     +  Y    +T   Y +  +  S               
Sbjct: 64  RPRFIRWETTSPENELLIIGQDTVWEYFPAEETVYRYSVEQVLSSKTMIRFLSGEANLKD 123

Query: 130 RVESNNS--------FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
                +            I  + +       +        L   K++D     + +++  
Sbjct: 124 DFIVQDLGADGDFRHLKIIPKEPEPNLVEGELWVRPGQDMLEKIKLVDFFGNINELELTG 183

Query: 182 YKENTVLDPKVFEIPYDK 199
            + +  ++ K F +   K
Sbjct: 184 IEIDVPVEDKEFTLVPPK 201


>gi|115372369|ref|ZP_01459678.1| outer membrane lipoprotein carrier protein LolA, putative
           [Stigmatella aurantiaca DW4/3-1]
 gi|310819548|ref|YP_003951906.1| outer membrane lipoprotein carrier protein lola [Stigmatella
           aurantiaca DW4/3-1]
 gi|115370582|gb|EAU69508.1| outer membrane lipoprotein carrier protein LolA, putative
           [Stigmatella aurantiaca DW4/3-1]
 gi|309392620|gb|ADO70079.1| Outer membrane lipoprotein carrier protein LolA [Stigmatella
           aurantiaca DW4/3-1]
          Length = 239

 Score = 78.4 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 25/191 (13%), Positives = 61/191 (31%), Gaps = 14/191 (7%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA------GYVMKGEFFMARPSKFYF 76
               +        V++    +   +  Q  F Q+             G     +P    +
Sbjct: 37  AAKGSVAPEVKTLVERMQSFYEKTEDFQSGFKQDYKYKTFRRTQTSTGTVTYKKPGLMRW 96

Query: 77  KYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS----VIFSNNQHVIQESIQRVE 132
           +Y  PS  + +  GS +  Y+    + +V  +     S     +F   +   + +I +  
Sbjct: 97  EYEKPSPRTFVLAGSKVYAYDPGAQSLTVGNVDTNTLSASVTFLFGQGRLADEFNITKGT 156

Query: 133 SNN----SFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
             +      +    + D     + +  D  + ++L   ++D     + I  L  K N  +
Sbjct: 157 CADCKGTLLVLNPAQADPRFKQVRLEVDSKTAQVLKSTVIDPDGSENTIAFLDLKTNVGI 216

Query: 189 DPKVFEIPYDK 199
               F++   +
Sbjct: 217 SKDSFKLDPPE 227


>gi|259908929|ref|YP_002649285.1| outer-membrane lipoprotein carrier protein [Erwinia pyrifoliae
           Ep1/96]
 gi|224964551|emb|CAX56063.1| Outer membrane lipoproteins carrier protein [Erwinia pyrifoliae
           Ep1/96]
 gi|283478931|emb|CAY74847.1| Outer-membrane lipoprotein carrier protein precursor [Erwinia
           pyrifoliae DSM 12163]
 gi|310767169|gb|ADP12119.1| outer-membrane lipoprotein carrier protein [Erwinia sp. Ejp617]
          Length = 203

 Score = 78.4 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 26/194 (13%), Positives = 62/194 (31%), Gaps = 13/194 (6%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMA 69
              S               +     +    +++   TF Q+            +GE ++ 
Sbjct: 4   LIISCCLLATFTAAGAWADATSDLQQRLDKVKSFHATFDQKVTDGSGASVQDGEGEMWVQ 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQHVIQ 125
           RP+ F +  ++P    LI+DG  +  YN  ++  S            F +I  N     +
Sbjct: 64  RPNLFNWHMTAPDESILIADGKTLWFYNPFVEQVSASLLKDATSNTPFMLIARNQASDWK 123

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +     + ++  +T    D  +           +  +  +  ++   + S   +   ++N
Sbjct: 124 QYHVTQKGDDFSLTPKSADGNLKQFTINV--AQNGTINQFSAIEQDGQRSSYALKS-QKN 180

Query: 186 TVLDPKVFEIPYDK 199
             +    F+    K
Sbjct: 181 GPISADKFKFTPPK 194


>gi|294666601|ref|ZP_06731840.1| outer-membrane lipoprotein carrier protein precursor [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
 gi|292603621|gb|EFF47033.1| outer-membrane lipoprotein carrier protein precursor [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
          Length = 223

 Score = 78.4 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 23/188 (12%), Positives = 62/188 (32%), Gaps = 13/188 (6%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
           A+   +         + ++       ++ + G F Q              G   +A P +
Sbjct: 22  AVLATSLFASTAFAGARQELDTFTRGLKGLDGQFSQRVTDANGRVKETSSGRVALATPRQ 81

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQESIQ 129
           F ++Y+ P    +++DG  + V+++ L+  +V       +      +        +  + 
Sbjct: 82  FRWEYAKPYKQLIVADGKKVWVFDSDLEQVTVRAQGSEEQNSPLVALIDPALLDKKYDVS 141

Query: 130 RV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
                     ++++  K D   +    +       L   +++D+  + + I    +K N 
Sbjct: 142 EEAAPRDGLQWLSLTPKVDTDASFQIASLGFGREGLARMEVVDAVGQRTAIGFSGWKRNP 201

Query: 187 VLDPKVFE 194
                 F 
Sbjct: 202 AFAADTFR 209


>gi|254523386|ref|ZP_05135441.1| outer membrane lipoprotein carrier protein LolA [Stenotrophomonas
           sp. SKA14]
 gi|219720977|gb|EED39502.1| outer membrane lipoprotein carrier protein LolA [Stenotrophomonas
           sp. SKA14]
          Length = 212

 Score = 78.4 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/203 (12%), Positives = 61/203 (30%), Gaps = 13/203 (6%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMK 63
                    + +    AA       +          ++ + G F Q+             
Sbjct: 3   FRFRRFLATTTLAVACAAAGSAWAGARDDLKSFTSGLKGLDGQFSQQVFDSRGKVKESTS 62

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSN 119
           G   ++ P  F ++Y  P    +++DG  + +Y   L+  +V       +    + + + 
Sbjct: 63  GRVALSAPRLFRWEYVRPHEQLIVADGKKVWMYEPDLEQATVREQGKEEQNSPLTALINP 122

Query: 120 NQHVIQESIQRV---ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
                Q  +           ++++  K +   +         +  L   +I D+  + ++
Sbjct: 123 ALLEQQYDVSEEAAQRDGLQWLSLSPKRETEASFQYAALGFNAQGLAKMEITDAVGQRTV 182

Query: 177 IKILKYKENTVLDPKVFEIPYDK 199
           I    +K N       F     K
Sbjct: 183 ISFTGWKRNPGFAAGTFSFTPPK 205


>gi|165919036|ref|ZP_02219122.1| outer membrane lipoprotein carrier protein LolA [Coxiella burnetii
           RSA 334]
 gi|165917291|gb|EDR35895.1| outer membrane lipoprotein carrier protein LolA [Coxiella burnetii
           RSA 334]
          Length = 211

 Score = 78.4 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 29/196 (14%), Positives = 64/196 (32%), Gaps = 12/196 (6%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEF 66
           +++          +     +  +  +  +   + +T Q  F Q              G  
Sbjct: 6   ILIGLLGIFLFSLSGIVSAQSDATTQLSQLLSNFRTYQAKFNQITFDGQDRVIQQSHGRV 65

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE 126
            + RP +F ++  SP+   +I++G  + VY+  L   +  PL         S     +++
Sbjct: 66  MIMRPGRFRWETDSPTKQIIITNGKTLWVYDVDLSQATQQPLAQKTNINPASLLSGSVKD 125

Query: 127 SIQRVESNNS------FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
             Q+     S         +        N   +       +L    ++++    SI +  
Sbjct: 126 LKQKFTITISPTSDAATFQLVPHLGKSLNFNWIRLKFSKKQLTEMTVLNNLDERSIFQFS 185

Query: 181 KYKENTVLDPKVFEIP 196
           + K N  L   +FE  
Sbjct: 186 QIKVNAPLSSTLFEFK 201


>gi|153208619|ref|ZP_01946876.1| outer membrane lipoprotein carrier protein LolA [Coxiella burnetii
           'MSU Goat Q177']
 gi|212218616|ref|YP_002305403.1| outer-membrane lipoproteins carrier protein [Coxiella burnetii
           CbuK_Q154]
 gi|229485824|sp|B6J7K9|LOLA_COXB1 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|120575880|gb|EAX32504.1| outer membrane lipoprotein carrier protein LolA [Coxiella burnetii
           'MSU Goat Q177']
 gi|212012878|gb|ACJ20258.1| outer-membrane lipoproteins carrier protein [Coxiella burnetii
           CbuK_Q154]
          Length = 211

 Score = 78.0 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 29/196 (14%), Positives = 65/196 (33%), Gaps = 12/196 (6%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEF 66
           +++          +     +  +  +  +   + +T Q  F Q              G  
Sbjct: 6   ILIGLLGIFLFSLSGIVSAQSDATTQLSQLLSNFRTYQAKFNQITFDGQDRVIQQSHGRV 65

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE 126
            + RP +F ++  SP+   +I++G  + VY+  L   +  PL         S     +++
Sbjct: 66  MIMRPGRFRWETDSPTKQIIITNGKTLWVYDVDLSQATQQPLAQKTNINPASLLSGSVKD 125

Query: 127 SIQRVESNNS------FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
             Q+     S         +  +     N   +       +L    ++++    SI +  
Sbjct: 126 LKQKFTITISPTSDAATFQLVPRLGKSLNFNWIRLKFSKKQLTEMTVLNNLDERSIFQFS 185

Query: 181 KYKENTVLDPKVFEIP 196
           + K N  L   +FE  
Sbjct: 186 QIKVNAPLSSTLFEFK 201


>gi|145299387|ref|YP_001142228.1| outer membrane lipoprotein carrier protein LolA [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|189028547|sp|A4SNK8|LOLA_AERS4 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|142852159|gb|ABO90480.1| outer membrane lipoprotein carrier protein LolA [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 202

 Score = 78.0 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 32/192 (16%), Positives = 68/192 (35%), Gaps = 12/192 (6%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------GEFFMARP 71
                    A       +     +    +      F Q       K      G+  + RP
Sbjct: 5   LLIGSVLLVASSQVWADAASSLKQKLADVSLFSAKFAQTVYDSKGKELQKAGGDLLVQRP 64

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQHVIQES 127
           ++F +  +SP    +++DG ++ VY+  ++  +       +    F +I  N+    +  
Sbjct: 65  NRFNWHTTSPDESLIVADGKDVWVYDPFVEQVTALKLKDAVLNTPFILIAGNDDKFWKHY 124

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
               E N   +T   KD+ + +   VTFDR +  +  + + ++  ++S   +  +    V
Sbjct: 125 DVTQEGNVYTVTSRNKDELIASF-RVTFDRQN-NISRFDVKEAQGQWSEFTLSSFNRKPV 182

Query: 188 LDPKVFEIPYDK 199
           L    F     K
Sbjct: 183 LKGNEFVFKIPK 194


>gi|294141066|ref|YP_003557044.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           violacea DSS12]
 gi|293327535|dbj|BAJ02266.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           violacea DSS12]
          Length = 208

 Score = 78.0 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 30/207 (14%), Positives = 67/207 (32%), Gaps = 15/207 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            +  + ++ +           A  +               + T++  F Q          
Sbjct: 1   MRKTLTLLAMALPFM------ASNLAIADESSALKAKLEEVATLKANFSQVVTDINNKEI 54

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA--FSVIF 117
               G F +A P++FY+  + P    +++DG+++ +YN   +  SV  L        +  
Sbjct: 55  QRGSGVFALAYPNQFYWHLTEPDESLIVADGTDVWIYNPFAEQVSVMDLNQAITASPIAL 114

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             ++     +   V S +    I  K      + SV        L    + D     S  
Sbjct: 115 LVHRDKETWAQYTVTSKDGCFDINPKSVDA-GVESVKVCFKGKTLTQMVLEDQQGNVSSF 173

Query: 178 KILKYKENTVLDPKVFEIPYDKIHNIN 204
           ++      T  +  +F+    +  +I+
Sbjct: 174 ELTGQTAITDAEKSLFKFTVPEDVDID 200


>gi|145631002|ref|ZP_01786778.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae R3021]
 gi|260582199|ref|ZP_05849993.1| outer membrane lipoprotein carrier protein LolA [Haemophilus
           influenzae NT127]
 gi|144983469|gb|EDJ90945.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae R3021]
 gi|260094831|gb|EEW78725.1| outer membrane lipoprotein carrier protein LolA [Haemophilus
           influenzae NT127]
          Length = 205

 Score = 78.0 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 20/189 (10%), Positives = 52/189 (27%), Gaps = 9/189 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPS 72
            A         +    +  +       +  +   F+Q              G+  + RP+
Sbjct: 8   FAALTLLGLSNLALADAASELQMRLAKVDVLSAEFVQTVTSGSGKNVQQGSGKLQIKRPN 67

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQR 130
            F  +  +P    +ISDG  +  Y+  +   +   ++    +   +   +          
Sbjct: 68  LFRMETKTPQETQIISDGKTLWFYDPFVQQVTAQWVKNAVNNTPFVLLTSNDHSHWHQYT 127

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
           V        +                  +  L N+   +   + ++  +     N  L  
Sbjct: 128 VTQQADTFVLKPTLSTSNIKQFDIRVDANGILRNFSTTEKDGQTNLYVLRNI-TNQTLSD 186

Query: 191 KVFEIPYDK 199
            +F+   +K
Sbjct: 187 SLFQFKPEK 195


>gi|258546041|ref|ZP_05706275.1| outer membrane lipoprotein carrier protein LolA [Cardiobacterium
           hominis ATCC 15826]
 gi|258518698|gb|EEV87557.1| outer membrane lipoprotein carrier protein LolA [Cardiobacterium
           hominis ATCC 15826]
          Length = 286

 Score = 78.0 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 30/195 (15%), Positives = 60/195 (30%), Gaps = 19/195 (9%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----VMKGEFFMARPSKFYFKYSSPSS 83
                              + +Q  F Q           +G+ ++A+P KFY+ Y  P+ 
Sbjct: 90  TAAPAAPEGNALDAFMRGTKDLQANFTQTIYNKRGTETSEGKMWVAKPGKFYWDYQRPNP 149

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRY---MAFSVIFSNNQHVIQESIQRVESNNSF--- 137
             +IS+G  +  Y+  L+  SV             + +   +V +         N     
Sbjct: 150 QKIISNGKKVYHYDIDLEQISVRSRSELVGDVAVELLNGEDNVSRNYKVERTVKNLAPAR 209

Query: 138 --------ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLD 189
                   ++   K           +  L    +   ++D     +I+     K N+ + 
Sbjct: 210 LQKYIGSGVSYRLKPKTHQEEYDALWVVLDGNAITAVMIDGGGTQTILTFSDMKRNSGIP 269

Query: 190 PKVFEI-PYDKIHNI 203
            K FE  P   +  +
Sbjct: 270 AKQFEFTPPPGVDIV 284


>gi|29654493|ref|NP_820185.1| outer-membrane lipoproteins carrier protein [Coxiella burnetii RSA
           493]
 gi|161830784|ref|YP_001597053.1| outer membrane lipoprotein carrier protein LolA [Coxiella burnetii
           RSA 331]
 gi|732273|sp|P39917|LOLA_COXBU RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|189028549|sp|A9NDR3|LOLA_COXBR RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|468530|emb|CAA53290.1| unnamed protein product [Coxiella burnetii]
 gi|29541760|gb|AAO90699.1| outer-membrane lipoproteins carrier protein [Coxiella burnetii RSA
           493]
 gi|161762651|gb|ABX78293.1| outer membrane lipoprotein carrier protein LolA [Coxiella burnetii
           RSA 331]
          Length = 211

 Score = 78.0 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 29/196 (14%), Positives = 64/196 (32%), Gaps = 12/196 (6%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEF 66
           +++          +     +  +  +  +   + +T Q  F Q              G  
Sbjct: 6   ILIGLLGIFLFSLSGIVSAQSDATTQLSQLLSNFRTYQAKFNQITFDGQDRVIQQSHGRV 65

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE 126
            + RP +F ++  SP+   +I++G  + VY+  L   +  PL         S     +++
Sbjct: 66  MIMRPGRFRWETDSPTKQIIITNGKTLWVYDVDLSQATQQPLAQKTNINPASLLSGSVKD 125

Query: 127 SIQRVESNNS------FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
             Q+     S         +        N   +       +L    ++++    SI +  
Sbjct: 126 LKQKFTITISPTPDAATFQLVPNLGKSLNFNWIRLKFSKKQLTEMTVLNNLDERSIFQFS 185

Query: 181 KYKENTVLDPKVFEIP 196
           + K N  L   +FE  
Sbjct: 186 QIKVNAPLSSTLFEFK 201


>gi|90579110|ref|ZP_01234920.1| hypothetical outer membrane lipoproteins carrier protein [Vibrio
           angustum S14]
 gi|90439943|gb|EAS65124.1| hypothetical outer membrane lipoproteins carrier protein [Vibrio
           angustum S14]
          Length = 205

 Score = 77.6 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 28/203 (13%), Positives = 65/203 (32%), Gaps = 15/203 (7%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV 61
           + K +   +++           A         +        +      F Q      G +
Sbjct: 1   MMKKLWLSMLVAVPML------ATTSAWATPQQTLSSRLDKVNAFSANFTQKVISPDGEI 54

Query: 62  ---MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VI 116
                G+  + RP+ F +   +P +  L+SDG  +  Y+  ++  +   L+        +
Sbjct: 55  LVDGTGDLSIKRPNLFRWDTKTPDASLLVSDGKTVWYYSPFVEQVTAMWLKDATEQTPFV 114

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
                +    S   V+      T+  KD        +       ++ N+ +++S  + S 
Sbjct: 115 LLTRNNEKDWSRYNVKQLADTFTLTPKDKTSSMDEFIVTVSKDGQVRNFSVVESDGQRSN 174

Query: 177 IKILKYKENTVLDPKVFEIPYDK 199
             + K+   T     +F+    K
Sbjct: 175 YTLSKFTR-TTPAADLFKFTPPK 196


>gi|16273485|ref|NP_439736.1| outer-membrane lipoprotein carrier protein [Haemophilus influenzae
           Rd KW20]
 gi|260580370|ref|ZP_05848199.1| outer membrane lipoprotein carrier protein LolA [Haemophilus
           influenzae RdAW]
 gi|1170807|sp|P45263|LOLA_HAEIN RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|1574436|gb|AAC23239.1| outer membrane lipoproteins carrier protein (lolA) [Haemophilus
           influenzae Rd KW20]
 gi|260093047|gb|EEW76981.1| outer membrane lipoprotein carrier protein LolA [Haemophilus
           influenzae RdAW]
          Length = 205

 Score = 77.6 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 20/189 (10%), Positives = 53/189 (28%), Gaps = 9/189 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPS 72
            A         +    +  +       +  +   F+Q              G+  + RP+
Sbjct: 8   FAALTLLGLSNLALADAASELQMRLAKVDVLSAEFVQTVTSGSGKNVQQGSGKLQIKRPN 67

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQR 130
            F  +  +P    +ISDG  +  Y+  +   +   ++    +   +   +          
Sbjct: 68  LFRMETKTPQETQIISDGKTLWFYDPFVQQVTAQWVKNAVNNTPFVLLTSNDKSHWHQYT 127

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
           V   +    +                  +  L N+   +   + ++  +     N  L  
Sbjct: 128 VTQQSDTFVLKPTLSTSNIKQFDIRVDANGILRNFSTTEKDGQTNLYVLRNI-TNQTLSD 186

Query: 191 KVFEIPYDK 199
            +F+   +K
Sbjct: 187 SLFQFKPEK 195


>gi|237748654|ref|ZP_04579134.1| outer-membrane lipoprotein carrier protein [Oxalobacter formigenes
           OXCC13]
 gi|229380016|gb|EEO30107.1| outer-membrane lipoprotein carrier protein [Oxalobacter formigenes
           OXCC13]
          Length = 209

 Score = 77.6 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 67/207 (32%), Gaps = 18/207 (8%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAG----- 59
            +      I      + P  A+       ++ +      + ++ +G F Q +  G     
Sbjct: 1   MRPFFSKAIAMALFVLIPAFAS-----ATALDQLKSFSTNARSAKGEFSQGQVKGGDKAR 55

Query: 60  --YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA----- 112
              +  G F  +RP KF + Y  P    L +DG N+ +Y+  L+  +V  L         
Sbjct: 56  ITNLASGTFIFSRPGKFIWTYKKPYEQVLQADGVNLYIYDKDLNQVTVKKLGNALGSSPA 115

Query: 113 FSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSR 172
             +  SN+     +                          +     +      ++ DS  
Sbjct: 116 AILFGSNDLEKSFKLRNAGAHGGYEWVEAIPKTKDTPFEKINIGMKNGMPEAMELYDSLG 175

Query: 173 RYSIIKILKYKENTVLDPKVFEIPYDK 199
           + S+IK  K+ +N  +    F+    K
Sbjct: 176 QLSLIKFTKFTKNPPVSASTFKFVTPK 202


>gi|68249822|ref|YP_248934.1| outer-membrane lipoprotein carrier protein [Haemophilus influenzae
           86-028NP]
 gi|145635700|ref|ZP_01791395.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae PittAA]
 gi|148826112|ref|YP_001290865.1| outer-membrane lipoprotein carrier protein [Haemophilus influenzae
           PittEE]
 gi|81335753|sp|Q4QL23|LOLA_HAEI8 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|166230491|sp|A5UCI1|LOLA_HAEIE RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|68058021|gb|AAX88274.1| outer-membrane lipoproteins carrier protein precursor [Haemophilus
           influenzae 86-028NP]
 gi|145267023|gb|EDK07032.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae PittAA]
 gi|148716272|gb|ABQ98482.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae PittEE]
          Length = 205

 Score = 77.6 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 20/189 (10%), Positives = 53/189 (28%), Gaps = 9/189 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPS 72
            A         +    +  +       +  +   F+Q              G+  + RP+
Sbjct: 8   FAALTLLGLSNLALADAASELQMRLAKVDVLSAEFVQTVTSGSGKNVQQGSGKLQIKRPN 67

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQR 130
            F  +  +P    +ISDG  +  Y+  +   +   ++    +   +   +          
Sbjct: 68  LFRMETKTPQETQIISDGKTLWFYDPFVQQVTAQWVKNAVNNTPFVLLTSNDNSHWHQYT 127

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
           V   +    +                  +  L N+   +   + ++  +     N  L  
Sbjct: 128 VTQQSDTFVLKPTLSTSNIKQFDIRVDANGILRNFSTTEKDGQTNLYVLRNI-TNQTLSD 186

Query: 191 KVFEIPYDK 199
            +F+   +K
Sbjct: 187 SLFQFKPEK 195


>gi|161510974|ref|YP_088644.2| outer-membrane lipoprotein carrier protein [Mannheimia
           succiniciproducens MBEL55E]
          Length = 208

 Score = 77.2 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/203 (11%), Positives = 57/203 (28%), Gaps = 16/203 (7%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K  + +  LF  +               +  +  +    +      F Q  +      
Sbjct: 1   MKKIALKMTALFALAL-------SSTAWADAAGELQQRLAQVNYFSADFNQNVSSANGKN 53

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VI 116
                G+  + RP+ F     +P    +ISDG  +  Y+  ++  +   +     +   +
Sbjct: 54  VQTGSGKLQIKRPNLFRMDNKAPQETQIISDGKTLWFYDPFVEQVTANWVENAVNNTPFV 113

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
              +      +   V  N     +  K                  L  +  ++   + ++
Sbjct: 114 LLTSNDSANWNQYTVVQNGDTFVLKPKAKNSNIKQFDIRIDNQGVLKGFSTIEKDGQTNL 173

Query: 177 IKILKYKENTVLDPKVFEIPYDK 199
             +     N  L   +F+    K
Sbjct: 174 YILRNI-TNQPLADSLFKFTVPK 195


>gi|332969576|gb|EGK08594.1| outer membrane lipoprotein carrier protein LolA [Kingella kingae
           ATCC 23330]
          Length = 243

 Score = 77.2 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 49/173 (28%), Gaps = 9/173 (5%)

Query: 36  VKKAIEHFLSIQTMQGTFLQED----AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGS 91
           +    +       + G F Q            G F + RP  F ++Y+ P    ++ DG 
Sbjct: 64  IDALRQFNNDADGISGAFTQTVQTRNKKQTTSGSFQILRPGLFKWEYTKPYRQMIVGDGK 123

Query: 92  NIAVYNAKLDTWSVYPLRYMA-----FSVIFSNNQHVIQESIQRVESNNSFITIFFKDDF 146
           +I +Y+  L   +               +   +         +    N     +      
Sbjct: 124 HIWLYDVDLKQVTQSNQDQTIGDSPAAILSNKSALDTSYTLKEDGSQNGVDYVLATPRKN 183

Query: 147 MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                 +     + +L   ++ DS    + I+  +      L    F+    K
Sbjct: 184 NVGYQFIRIGFKNNQLAAMELKDSFGNQTSIQFGQLNTKPNLSRSAFQFTPPK 236


>gi|238749784|ref|ZP_04611289.1| Outer-membrane lipoprotein carrier protein [Yersinia rohdei ATCC
           43380]
 gi|238712439|gb|EEQ04652.1| Outer-membrane lipoprotein carrier protein [Yersinia rohdei ATCC
           43380]
          Length = 203

 Score = 77.2 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/202 (13%), Positives = 61/202 (30%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K ++    L                   +          + +    F Q+         
Sbjct: 1   MKKLLVACCLLSSFI-------SGSVLADASTDLQGRLSKVNSFHANFSQKVTSADGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +GE ++ RP+ F +  +SP    LISDG  +  YN  ++  +   L+    +   + 
Sbjct: 54  QEGEGELWVKRPNLFNWHMTSPDESVLISDGETLWFYNPFVEQATATWLKNATGNTPFML 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
               +        V+       +  K         V     +  + ++  ++   + S  
Sbjct: 114 ITRNNPDDWKQYNVKQKGDDFELTPKSASGNLKQFVITVTPTGTIKSFTAVEQDGQRSAY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +   ++N+  D   F+    K
Sbjct: 174 MLKG-QQNSSADASKFKFTLPK 194


>gi|238753491|ref|ZP_04614854.1| Outer-membrane lipoprotein carrier protein [Yersinia ruckeri ATCC
           29473]
 gi|238708444|gb|EEQ00799.1| Outer-membrane lipoprotein carrier protein [Yersinia ruckeri ATCC
           29473]
          Length = 203

 Score = 77.2 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/202 (12%), Positives = 60/202 (29%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----- 60
            K ++    L         +         + +        + +    F Q          
Sbjct: 1   MKKLLVACCLL-------SSMISASALADANQDLQGRLSKVNSFHAKFSQSVTSSDGAAV 53

Query: 61  -VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +GE ++ RP+ F +  +SP    LISDG  +  YN  ++  +   L+    +   + 
Sbjct: 54  QEGEGELWVKRPNLFNWHMTSPDESILISDGETLWFYNPFVEQATATWLKNATGNTPFML 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
               +        V+       +  K               S  +  +  ++   + S  
Sbjct: 114 ITRNNPEDWKQYNVKQKGDDFELTPKAASGNLKQFAISVTPSGTIKGFTAIEQDGQRSAY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +   ++N+  D   F+    +
Sbjct: 174 VLKG-QQNSSADASKFKFTPPQ 194


>gi|53728834|ref|ZP_00134877.2| COG2834: Outer membrane lipoprotein-sorting protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126207958|ref|YP_001053183.1| outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae L20]
 gi|190149821|ref|YP_001968346.1| outer-membrane lipoprotein carrier protein precursor
           [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|303250268|ref|ZP_07336468.1| outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303252144|ref|ZP_07338312.1| outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307247480|ref|ZP_07529525.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307249713|ref|ZP_07531692.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|307252033|ref|ZP_07533933.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307256529|ref|ZP_07538310.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307260959|ref|ZP_07542641.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|307263142|ref|ZP_07544763.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|166230489|sp|A3MZJ2|LOLA_ACTP2 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229485821|sp|B3GX52|LOLA_ACTP7 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|126096750|gb|ABN73578.1| outer-membrane lipoprotein carrier protein precursor
           [Actinobacillus pleuropneumoniae serovar 5b str. L20]
 gi|189914952|gb|ACE61204.1| Outer-membrane lipoprotein carrier protein precursor
           [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|302648927|gb|EFL79115.1| outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302650884|gb|EFL81040.1| outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306855983|gb|EFM88141.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306858221|gb|EFM90298.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306860502|gb|EFM92515.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306864939|gb|EFM96841.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306869261|gb|EFN01056.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306871504|gb|EFN03227.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 213

 Score = 77.2 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/202 (14%), Positives = 60/202 (29%), Gaps = 12/202 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK-- 63
            K ++   +L F                QSV +       +      F Q       K  
Sbjct: 1   MKKLLKQSLLGFALV---SMTGAAFADAQSVAELQRRLEQVSQYSADFDQTVRSSKGKQI 57

Query: 64  ----GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G+F + RP+ F     SP    ++SDG+N+  Y+  +   +V  ++    +   + 
Sbjct: 58  QSGKGKFQVKRPNLFRMDTKSPQENLIVSDGANLWFYDPFVSQVTVNTVQDAVNNTPFVL 117

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             +          V  N     +  K               S  L  +  ++   + ++ 
Sbjct: 118 LTSSDKSHWDQYDVTQNADTFVLKPKSKKSNLKQFDVRIDQSGMLKGFSTIERDGQSNLY 177

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +        +   +F+    K
Sbjct: 178 VLRNI-TGGGVSSDLFKFSVPK 198


>gi|330860579|emb|CBX70878.1| outer-membrane lipoprotein carrier protein [Yersinia enterocolitica
           W22703]
          Length = 195

 Score = 77.2 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/204 (12%), Positives = 64/204 (31%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM--- 62
            K ++    L                   +          + +    F Q+         
Sbjct: 1   MKKLLVACCLLSGLI-------SAHALADASSDLQARLSKVNSFHANFSQKVTSSEGTAV 53

Query: 63  ---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +GE ++ RP+ F +  ++P    LISDG  +  YN  ++  +            F +
Sbjct: 54  QEGEGELWVKRPNLFNWHMTTPDESILISDGETLWFYNPFVEQATATWLKNATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  NN    ++   + + ++  +T       +           +  + ++  ++   + S
Sbjct: 114 ITRNNPDDWKQYNVKQKGDDFELTPKSASGNLKQFAITV--TPTGTIKSFTAVEQDGQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
              +   +    +   +  +PY K
Sbjct: 172 AYTLKGQQIAQQMPANL-SLPYQK 194


>gi|145627718|ref|ZP_01783519.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae 22.1-21]
 gi|145639903|ref|ZP_01795503.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae PittII]
 gi|144979493|gb|EDJ89152.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae 22.1-21]
 gi|145270994|gb|EDK10911.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae PittII]
 gi|309751082|gb|ADO81066.1| Outer membrane lipoprotein carrier protein [Haemophilus influenzae
           R2866]
          Length = 205

 Score = 77.2 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 20/189 (10%), Positives = 51/189 (26%), Gaps = 9/189 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPS 72
            A              +  +       +  +   F+Q              G+  + RP+
Sbjct: 8   FAALTLLGLSNFALADAASELQMRLAKVDVLSAEFVQTVTSGSGKNVQQGSGKLQIKRPN 67

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQR 130
            F  +  +P    +ISDG  +  Y+  +   +   ++    +   +   +          
Sbjct: 68  LFRMETKTPQETQIISDGKTLWFYDPFVQQVTAQWVKDAVNNTPFVLLTSDDKTHWHQYT 127

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
           V        +                  +  L N+   +   + ++  +     N  L  
Sbjct: 128 VTQQADTFVLKPTLSTSNIKQFDIRVDANGILRNFSTTEKDGQTNLYVLRNI-TNQALSD 186

Query: 191 KVFEIPYDK 199
            +F+   +K
Sbjct: 187 SLFQFKSEK 195


>gi|229845597|ref|ZP_04465723.1| outer-membrane lipoprotein carrier protein [Haemophilus influenzae
           6P18H1]
 gi|229811464|gb|EEP47167.1| outer-membrane lipoprotein carrier protein [Haemophilus influenzae
           6P18H1]
          Length = 205

 Score = 77.2 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 20/189 (10%), Positives = 53/189 (28%), Gaps = 9/189 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPS 72
            A         +    +  +       +  +   F+Q              G+  + RP+
Sbjct: 8   FAALTLLGLSNLALADAASELQMRLAKVDVLSAEFVQTVTSGSGKNVQQGSGKLQIKRPN 67

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQR 130
            F  +  +P    +ISDG  +  Y+  +   +   ++    +   +   +          
Sbjct: 68  LFRMETKTPQETQIISDGKTLWFYDPFVQQVTAQWVKDAVNNTPFVLLTSNDKSHWHQYT 127

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
           V   +    +                  +  L N+   +   + ++  +     N  L  
Sbjct: 128 VTQQSDTFVLKPTLSTSNIKQFDIRVDANGILRNFSTTEKDGQTNLYVLRNI-TNQTLSD 186

Query: 191 KVFEIPYDK 199
            +F+   +K
Sbjct: 187 SLFQFKPEK 195


>gi|307254264|ref|ZP_07536105.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306862811|gb|EFM94764.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
          Length = 207

 Score = 77.2 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/202 (14%), Positives = 60/202 (29%), Gaps = 12/202 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK-- 63
            K ++   +L F                QSV +       +      F Q       K  
Sbjct: 1   MKKLLKQSLLGFALV---SMTGAAFADAQSVAELQRRLEQVSQYSADFDQTVRSSKGKQI 57

Query: 64  ----GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G+F + RP+ F     SP    ++SDG+N+  Y+  +   +V  ++    +   + 
Sbjct: 58  QSGKGKFQVKRPNLFRMDTKSPQENLIVSDGANLWFYDPFVSQVTVNTVQDAVNNTPFVL 117

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             +          V  N     +  K               S  L  +  ++   + ++ 
Sbjct: 118 LTSSDKSHWDQYDVTQNADTFVLKPKSKKSNLKQFDVRIDQSGMLKGFSTIERDGQSNLY 177

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +        +   +F+    K
Sbjct: 178 VLRNI-TGGGVSSDLFKFSVPK 198


>gi|319942657|ref|ZP_08016964.1| hypothetical protein HMPREF9464_02183 [Sutterella wadsworthensis
           3_1_45B]
 gi|319803740|gb|EFW00675.1| hypothetical protein HMPREF9464_02183 [Sutterella wadsworthensis
           3_1_45B]
          Length = 219

 Score = 77.2 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/210 (16%), Positives = 67/210 (31%), Gaps = 17/210 (8%)

Query: 4   LLYKSVIGVV-ILFFYSAIFPFNAAYPITKDQSVK---KAIEHFLSIQTMQGTFLQEDAG 59
              +    ++       A  P   +    K  SV    +       +   +G F Q    
Sbjct: 5   FPRRRFFVLMGAALCACAFSPLGVSAEAVKTVSVDGSAQLEAFLSHVSAAEGAFRQRVVD 64

Query: 60  ------YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY--- 110
                    +G F   RP  F + Y  P    ++SDG  + +Y+  L   +V  +     
Sbjct: 65  RSGKLVNEAEGIFAFRRPGAFLWNYEKPWKQQVVSDGQTLWLYDEDLMQVTVKKVSDALG 124

Query: 111 -MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMD 169
               +V+F +                  +T+  K+   G      F   S    +  + D
Sbjct: 125 ATPAAVLFGSGTLPKDWQTSSEA---GAVTLTPKEPQAGFESVKVFFDASGNPDSMSLRD 181

Query: 170 SSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           +  + + +K L++K    ++P  F     K
Sbjct: 182 TFGQTTEVKFLRFKALEQMNPDRFRFVIPK 211


>gi|326794637|ref|YP_004312457.1| Outer-membrane lipoprotein carrier protein [Marinomonas
           mediterranea MMB-1]
 gi|326545401|gb|ADZ90621.1| Outer-membrane lipoprotein carrier protein [Marinomonas
           mediterranea MMB-1]
          Length = 206

 Score = 77.2 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/201 (12%), Positives = 79/201 (39%), Gaps = 13/201 (6%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV------M 62
           +   V + F        ++  + ++   +  ++     + ++G F Q             
Sbjct: 1   MFKKVAVVFCLWSLSCFSSLVLAQETH-QALVDLLEKNRNVEGEFRQITYTEEGKELQNS 59

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFS 118
           +G F +A+P++F +   SP    ++S+G  + +++  L+  +  P    +     +++  
Sbjct: 60  EGVFLLAQPNRFVWDSISPFPQRIVSNGETVTIWDVDLEQATQRPLAKTVGNSPAALLSQ 119

Query: 119 NNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
               V+        + N +  I   +D +   ++++F      +    + D+  + ++I+
Sbjct: 120 PAVDVLPHYKVLTLAGNKYRLIPKDEDDLFQTLTLSF--KGDLISAMSLKDALGQTTVIE 177

Query: 179 ILKYKENTVLDPKVFEIPYDK 199
               + +  +  + F+I   +
Sbjct: 178 FTNLEHHEGVSAENFKIDLPE 198


>gi|46580078|ref|YP_010886.1| outer membrane lipoprotein carrier protein [Desulfovibrio vulgaris
           str. Hildenborough]
 gi|120602464|ref|YP_966864.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           vulgaris DP4]
 gi|46449494|gb|AAS96145.1| outer membrane lipoprotein carrier protein, putative [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|120562693|gb|ABM28437.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           vulgaris DP4]
 gi|311233923|gb|ADP86777.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           vulgaris RCH1]
          Length = 225

 Score = 77.2 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 20/187 (10%), Positives = 52/187 (27%), Gaps = 14/187 (7%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQED----AGYVMK--GEFFMARPSKFYFKYSS 80
                   + +   + + ++ T++  F Q+     +G      G     +P    ++   
Sbjct: 20  TASALAGTAAQDIQKRYDTVTTLKAAFTQKLLHRESGSTETRNGTLLFRKPLLVRWETGG 79

Query: 81  PSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAFSVIFSNNQHVIQESIQRVESNN 135
            +   L+    +I  +    +    YPL           VI    +     ++       
Sbjct: 80  KNPEVLVISSQDIWNFLPDEELAYRYPLDLVQDSKSIIKVITGQAKLDQDFNVVEEGQEE 139

Query: 136 SFITIFFKDDFMGNMIS---VTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
               +          ++   +  D   + +   ++ D     + I     + N  +  K 
Sbjct: 140 GLTRLHLYPKEPVQQLTEAILWVDPQEHLIRRVRVYDFYGNENEIDFTSLEANATVADKA 199

Query: 193 FEIPYDK 199
           F     K
Sbjct: 200 FTFTPPK 206


>gi|330446444|ref|ZP_08310096.1| outer membrane lipocarrier protein LolA [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328490635|dbj|GAA04593.1| outer membrane lipocarrier protein LolA [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 205

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/203 (12%), Positives = 63/203 (31%), Gaps = 15/203 (7%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK- 63
           + K +   +++           A         +        +      F Q+      + 
Sbjct: 1   MMKKLWLSMLVAVPML------ATANAWATPEQALSSRLDKVNAFSANFTQKVISPEGET 54

Query: 64  -----GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VI 116
                G+  + RP+ F +   +P    L+SDG  +  Y+  ++  +   L+        +
Sbjct: 55  LVDGTGDLSIKRPNLFRWDTKTPDESLLVSDGKTVWYYSPFVEQVTAMWLKDATEQTPFV 114

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
                     +   V+      T+  K+        +       ++ N+ +++S  + S 
Sbjct: 115 LLTRNSPKDWARYNVQQLADTFTLTPKEKTSSMDKFIVTVAKDGQVRNFSVIESDGQRSN 174

Query: 177 IKILKYKENTVLDPKVFEIPYDK 199
             + K+   T     +F+    K
Sbjct: 175 YTLSKFTR-TTPAASLFKFTPPK 196


>gi|307258726|ref|ZP_07540458.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306867077|gb|EFM98933.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 213

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/202 (14%), Positives = 60/202 (29%), Gaps = 12/202 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK-- 63
            K ++   +L F                QSV +       +      F Q       K  
Sbjct: 1   MKKLLKQSLLGFALV---SMTGAAFADAQSVAELQRRLEQVSQYSADFDQTVRSSKGKQI 57

Query: 64  ----GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G+F + RP+ F     SP    ++SDG+N+  Y+  +   +V  ++    +   + 
Sbjct: 58  QSGKGKFQVKRPNLFRMDTKSPQENLIVSDGANLWFYDPFVSQVTVNTVQDAVNNTPFVL 117

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             +          V  N     +  K               S  L  +  ++   + ++ 
Sbjct: 118 LTSSDKSHWDQYDVTQNADTFVLKPKSKKSNLKQFDVRIDQSGMLKGFSTIERDGQSNLY 177

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +        +   +F+    K
Sbjct: 178 VLRNI-TGGGVSSDLFKFSVPK 198


>gi|149377436|ref|ZP_01895179.1| outer membrane lipoprotein carrier protein LolA [Marinobacter
           algicola DG893]
 gi|149358277|gb|EDM46756.1| outer membrane lipoprotein carrier protein LolA [Marinobacter
           algicola DG893]
          Length = 218

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/203 (12%), Positives = 67/203 (33%), Gaps = 12/203 (5%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------V 61
             + ++  F         A       ++         + ++ Q  F+Q            
Sbjct: 6   KALWLITAFSALISVITPAMAEDASAKAAADLSALLKNYESFQSDFIQIVVNENGNRVQE 65

Query: 62  MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIF 117
            +G     RP  FY++   P S  ++S+G  + VY+  L+  +++     ++     ++ 
Sbjct: 66  SRGSLKAKRPGLFYWETREPHSQFVVSNGDTVEVYDPDLEQVTIHNLDERVQTTPALLLS 125

Query: 118 SNNQHVIQESIQRVE--SNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
               ++ +           N+              +S+     +  L   ++ DS  + S
Sbjct: 126 GEVDNLNETYRVSSRSPGENTREFTLEPRSEDSLFVSLRLTFYNGELQEMRMRDSLAQLS 185

Query: 176 IIKILKYKENTVLDPKVFEIPYD 198
           ++     + N  ++   F + Y 
Sbjct: 186 VLSFEDIRLNAPVEDNAFTLNYP 208


>gi|301170353|emb|CBW29959.1| chaperone for lipoproteins [Haemophilus influenzae 10810]
          Length = 205

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/189 (10%), Positives = 53/189 (28%), Gaps = 9/189 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPS 72
            A         +    +  +       +  +   F+Q              G+  + RP+
Sbjct: 8   FAALTLLGLSNLALADAASELQMRLAKVDVLSAEFVQTVTSRSGKNVQQGSGKLQIKRPN 67

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQR 130
            F  +  +P    +ISDG  +  Y+  +   +   ++    +   +   +          
Sbjct: 68  LFRMETKTPQETQIISDGKTLWFYDPFVQQVTAQWVKNAVNNTPFVLLTSNDKSHWHQYT 127

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
           V   +    +                  +  L N+   +   + ++  +     N  L  
Sbjct: 128 VTQQSDTFVLKPTLSTSNIKQFDIRVDANGILRNFSTTEKDGQTNLYVLRNI-TNQTLSD 186

Query: 191 KVFEIPYDK 199
            +F+   +K
Sbjct: 187 SLFQFKPEK 195


>gi|157375265|ref|YP_001473865.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           sediminis HAW-EB3]
 gi|189028562|sp|A8FV64|LOLA_SHESH RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|157317639|gb|ABV36737.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           sediminis HAW-EB3]
          Length = 208

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/200 (13%), Positives = 60/200 (30%), Gaps = 13/200 (6%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            +  + ++ +     +          +             I T++  F Q          
Sbjct: 1   MRKTLSILAISLPLLV------SGYAQASESGVLKAKLAEISTLKANFTQTVTDVNKKEI 54

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
               G F +A P++FY+  + P    +++DG ++ +YN   +  SV  L     +   + 
Sbjct: 55  QKGSGVFALAYPNQFYWHLTEPDESLIVADGRDVWIYNPFAEEVSVMDLNQAINASPIAL 114

Query: 120 NQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
             H  +E+  +    N               + SV        L    + D     S   
Sbjct: 115 LVHRDEETWSKYTVTNEEGCFSIAPKSVDAGVESVDVCFDGNTLTQMVLQDQQGNVSQFM 174

Query: 179 ILKYKENTVLDPKVFEIPYD 198
           +      +  +  +F+    
Sbjct: 175 LSDQTAISDDELSMFKFTVP 194


>gi|157962053|ref|YP_001502087.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           pealeana ATCC 700345]
 gi|189028561|sp|A8H4R5|LOLA_SHEPA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|157847053|gb|ABV87552.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           pealeana ATCC 700345]
          Length = 208

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/197 (14%), Positives = 62/197 (31%), Gaps = 13/197 (6%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +  +  L            +               + I T++  F Q          
Sbjct: 1   MKKIFTIAALSLPLF------CHLPAMAGGQDDLKVKLMEINTLKANFNQTVTDINQKVI 54

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
              +G F ++ P++FY+  ++P    +++DG+++ +YN   +  SV  +     +   + 
Sbjct: 55  QTGEGVFALSHPNQFYWHLTAPDESLIVADGTDVWIYNPFAEEVSVMDINQAINASPIAL 114

Query: 120 NQHVIQESIQRVES-NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
             H    +  + +  NN         D    +  V       +L    + D     S   
Sbjct: 115 LVHSDDATWSQYDVVNNGDCFDISPRDKDSGVSEVEVCFNQQQLTKMVLKDQQGNTSDFT 174

Query: 179 ILKYKENTVLDPKVFEI 195
           +         D  +F+ 
Sbjct: 175 LTNQTPIAENDKDLFKF 191


>gi|271500828|ref|YP_003333853.1| outer membrane lipoprotein carrier protein LolA [Dickeya dadantii
           Ech586]
 gi|270344383|gb|ACZ77148.1| outer membrane lipoprotein carrier protein LolA [Dickeya dadantii
           Ech586]
          Length = 204

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/196 (12%), Positives = 58/196 (29%), Gaps = 9/196 (4%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGY---VMKGE 65
           ++ +   +     +         +          + +   +F Q    D G       GE
Sbjct: 1   MIKIGLITGCLLTSLVSSAVYADAASDLQSRLSKVNSFHASFAQKVTTDDGEAVQEGAGE 60

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHV 123
            ++ RP+ F +K +SP   +L+SDG  +  YN  ++  +   ++    +   I       
Sbjct: 61  LWVKRPNLFNWKTTSPDESTLVSDGKTLWFYNPFVEQVTATWVKDATGNTPFILITRNDP 120

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
                  V        +  +                  +  +   +   + S   +   +
Sbjct: 121 KDWGKYNVSQKGDEFDLTPRVASGNLKRFSINVSSDGTIHGFTATEQDGQRSAYTLKN-Q 179

Query: 184 ENTVLDPKVFEIPYDK 199
           +N  +D   F     K
Sbjct: 180 QNGDVDAAKFRFTPPK 195


>gi|229847090|ref|ZP_04467195.1| outer-membrane lipoprotein carrier protein [Haemophilus influenzae
           7P49H1]
 gi|229809919|gb|EEP45640.1| outer-membrane lipoprotein carrier protein [Haemophilus influenzae
           7P49H1]
          Length = 205

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/189 (10%), Positives = 52/189 (27%), Gaps = 9/189 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPS 72
            A         +    +  +       +  +   F+Q              G+  + RP+
Sbjct: 8   FAALTLLGLSNLALADAASELQMRLAKVDVLSAEFVQTVTSGSGKNVQQGSGKLQIKRPN 67

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQR 130
            F  +  +P    +ISDG  +  Y+  +   +   ++    +   +   +          
Sbjct: 68  LFRMETKTPQETQIISDGKTLWFYDPFVQQVTAQWVKNAVNNTPFVLLTSNDNSHWHQYT 127

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
           V        +                  +  L N+   +   + ++  +     N  L  
Sbjct: 128 VTQQADTFVLKPTLSTSNIKQFDIRVDANGILRNFSTTEKDGQTNLYVLRNI-TNQTLSD 186

Query: 191 KVFEIPYDK 199
            +F+   +K
Sbjct: 187 SLFQFKPEK 195


>gi|269102236|ref|ZP_06154933.1| outer membrane lipoprotein carrier protein LolA [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268162134|gb|EEZ40630.1| outer membrane lipoprotein carrier protein LolA [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 203

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/203 (15%), Positives = 61/203 (30%), Gaps = 17/203 (8%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV 61
           + K+V+G+++     A              + +        +      F Q      G  
Sbjct: 1   MKKAVLGLLVAPLLFA--------SNVWADAQQDLSARLDKVNAFTADFQQKVVSPDGET 52

Query: 62  ---MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VI 116
                G   + RP+ F +    P    L+SDG  +  YN  ++  +   L+        +
Sbjct: 53  LVNGSGTVAVKRPNLFRWDTQKPDENLLVSDGKTVWYYNPFVEQVTAMWLKNATEQTPFV 112

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
                     S   V       T+  KD        V     + ++ N+ +++   + S 
Sbjct: 113 LLTRNSASDWSQYNVHQTADTFTLTPKDKTSSMGKFVLTVNKNGQVRNFTVVEQDGQKSS 172

Query: 177 IKILKYKENTVLDPKVFEIPYDK 199
                +K       K+F     K
Sbjct: 173 FTFNDFKT-ATPAAKLFTFVPPK 194


>gi|307245313|ref|ZP_07527401.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306853654|gb|EFM85871.1| Outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 213

 Score = 76.5 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/202 (14%), Positives = 60/202 (29%), Gaps = 12/202 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK-- 63
            K +I   +L F                QSV +       +      F Q       K  
Sbjct: 1   MKKLIKQSLLGFALV---SMTGAAFADAQSVAELQRRLEQVSQYSADFDQTVRSSKGKQI 57

Query: 64  ----GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G+F + RP+ F     SP    ++SDG+N+  Y+  +   +V  ++    +   + 
Sbjct: 58  QSGKGKFQVKRPNLFRMDTKSPQENLIVSDGANLWFYDPFVSQVTVNTVQDAVNNTPFVL 117

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             +          V  N     +  K               S  L  +  ++   + ++ 
Sbjct: 118 LTSSDKSHWDQYDVTQNADTFVLKPKSKKSNLKQFDVRIDQSGMLKGFSTIERDGQSNLY 177

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +        +   +F+    K
Sbjct: 178 VLRNI-TGGGVSSDLFKFSVPK 198


>gi|145637469|ref|ZP_01793127.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae PittHH]
 gi|145269275|gb|EDK09220.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae PittHH]
          Length = 205

 Score = 76.5 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/189 (10%), Positives = 53/189 (28%), Gaps = 9/189 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPS 72
            A         +    +  +       +  +   F+Q              G+  + RP+
Sbjct: 8   FAALTLLGLSNLALADAASELQMRLAKVDVLSAEFVQTVTSGSGKNVQQGSGKLQIKRPN 67

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQR 130
            F  +  +P    +ISDG  +  Y+  +   +   ++    +   +   +          
Sbjct: 68  LFRMETKTPQETQIISDGKTLWFYDPFVQQVTAQWVKDAVNNTPFVLLTSNDNSHWHQYT 127

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
           V        +                 ++  L N+   +   + ++  +     N  L  
Sbjct: 128 VTQQADTFVLKPTLSTSNIKQFDIRVDVNGILRNFSTTEKDGQTNLYVLRNI-TNQTLSD 186

Query: 191 KVFEIPYDK 199
            +F+   +K
Sbjct: 187 SLFQFKPEK 195


>gi|145641741|ref|ZP_01797317.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae R3021]
 gi|145273555|gb|EDK13425.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae 22.4-21]
          Length = 205

 Score = 76.5 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/189 (10%), Positives = 52/189 (27%), Gaps = 9/189 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPS 72
            A         +    +  +       +  +   F+Q              G+  + RP+
Sbjct: 8   FAALTLLGLSNLALADAASELQMRLAKVDVLSAEFVQTVTSGSGKNVQQGSGKLQIKRPN 67

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQR 130
            F  +  +P    +ISDG  +  Y+  +   +   ++    +   +   +          
Sbjct: 68  LFRMETKTPQETQIISDGKTLWFYDPFVQQVTAQWVKNAVNNTPFVLLTSNDNSHWHQYT 127

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
           V        +                  +  L N+   +   + ++  +     N  L  
Sbjct: 128 VTQQADTFVLKPTLSTSNIKQFDIRVDANGILRNFSTTEKDGQTNLYVLRNI-TNQTLSD 186

Query: 191 KVFEIPYDK 199
            +F+   +K
Sbjct: 187 SLFQFKLEK 195


>gi|88860146|ref|ZP_01134785.1| putative periplasmic chaperone [Pseudoalteromonas tunicata D2]
 gi|88818140|gb|EAR27956.1| putative periplasmic chaperone [Pseudoalteromonas tunicata D2]
          Length = 203

 Score = 76.5 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/202 (13%), Positives = 65/202 (32%), Gaps = 18/202 (8%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV---- 61
            K ++   +LFF   +             +     +    + +    F Q          
Sbjct: 1   MKKILLSSMLFFSPFLL----------ADAKLDLQKELSKLTSFDAHFKQTVFDEQKQPL 50

Query: 62  --MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
              KG+  + +P++  ++      VS          +  ++   +   L      V+ ++
Sbjct: 51  QHAKGQLQLQQPNQMRWQQEDTLLVSHGEKTYFFDAFAEQVTIMNTESLIDSTPFVLLTH 110

Query: 120 NQHVIQESIQRVESNNSFITIFFK--DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
           +Q +   +   V + N    +            +++ FD          I+DS+ + +  
Sbjct: 111 HQDMSLWNNYNVTAVNGSYELTPALGQQSQVEKLTLVFDGNGLGFKTILILDSTGQQTQF 170

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
              + K NT LD  +F+    +
Sbjct: 171 DFEQNKVNTPLDASLFQFTIPE 192


>gi|329910975|ref|ZP_08275422.1| Outer membrane lipoprotein carrier protein LolA [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327546034|gb|EGF31111.1| Outer membrane lipoprotein carrier protein LolA [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 222

 Score = 76.5 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 32/218 (14%), Positives = 68/218 (31%), Gaps = 23/218 (10%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM------- 62
                      I    AA  +    ++ +        Q+ +G F Q              
Sbjct: 3   FSFSRFSRLVLIAGMFAAPLVLHAAALDQFKSFVAGTQSAKGEFSQRLVRSESAAKPGAT 62

Query: 63  -----------KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY- 110
                       G F  ARP KF + Y  P    L +DG  + +Y+  L+  +   L   
Sbjct: 63  ATPAVKVSTPSTGTFLFARPGKFIWTYLKPYEQVLQADGDKLFIYDKDLNQVTSRKLGNA 122

Query: 111 ---MAFSVIFSNNQHVIQESIQRVESNNSFITI-FFKDDFMGNMISVTFDRLSYRLLNWK 166
                 +++F +N      +++   +      +             +         +  +
Sbjct: 123 IGSSPAAILFGSNDLEKNFTLKEAGTREGVEWLDAIPKSKDTTFEHIGIGLRDGVPVAME 182

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN 204
           + D+  + S++   +++ N VL    F+    K  ++N
Sbjct: 183 LRDTFGQTSVLTFTRFERNPVLAADQFKFVIPKGADVN 220


>gi|145632981|ref|ZP_01788714.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae 3655]
 gi|144986637|gb|EDJ93203.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae 3655]
          Length = 205

 Score = 76.5 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/189 (10%), Positives = 52/189 (27%), Gaps = 9/189 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPS 72
            A         +    +  +       +  +   F+Q              G+  + RP+
Sbjct: 8   FAALTLLGLSNLALADAASELQMRLAKVDVLSAEFVQTVTSGSGKNVQQGSGKLQIKRPN 67

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQR 130
            F  +  +P    +ISDG  +  Y+  +   +   ++    +   +   +          
Sbjct: 68  LFRMETKTPQETQIISDGKTLWFYDPFVQQVTAQWVKDAVNNTPFVLLTSNDKSHWDQYS 127

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
           V        +                  +  L N+   +   + ++  +     N  L  
Sbjct: 128 VTQQADIFVLKPTLSTSNIKQFDIRVDANGILRNFSTTEKDGQTNLYVLRNI-TNQTLSD 186

Query: 191 KVFEIPYDK 199
            +F+   +K
Sbjct: 187 SLFQFKPEK 195


>gi|116749034|ref|YP_845721.1| outer membrane lipoprotein carrier protein LolA [Syntrophobacter
           fumaroxidans MPOB]
 gi|116698098|gb|ABK17286.1| outer membrane lipoprotein carrier protein LolA [Syntrophobacter
           fumaroxidans MPOB]
          Length = 247

 Score = 76.5 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/216 (13%), Positives = 68/216 (31%), Gaps = 23/216 (10%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKD-----QSVKKAIEHFLSIQTMQGTFLQEDAGY 60
            K+      LF +  +                 + +KK   ++  IQ     F Q     
Sbjct: 4   MKNFHISCGLFLFLILASMWCGTARANQAALLSEILKKTEANYQKIQAFTANFHQSTTSS 63

Query: 61  --------VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY---NAKLDTWSVYPLR 109
                      G+ F  +P +  ++Y  P     +++     +Y   + ++  +    L 
Sbjct: 64  AASTMTTTQASGKLFYEKPRQMRWEYEKPEPQVFVANRDLAWLYVPADKQISLFDAKTLF 123

Query: 110 YMAF-------SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRL 162
                       V    +  V  +  Q  ++      +  ++D     + +  D  +Y++
Sbjct: 124 ASPLAQTFFDGMVELKKHFQVSLDPKQSSKATAVLRLVPKQEDPNIKALFLRIDLQTYKI 183

Query: 163 LNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           +  +  D+    + I +        LD K+FE+   
Sbjct: 184 ITIESHDALGNANRIMLDSQNSVPQLDRKLFELDTP 219


>gi|322832174|ref|YP_004212201.1| outer membrane lipoprotein carrier protein LolA [Rahnella sp.
           Y9602]
 gi|321167375|gb|ADW73074.1| outer membrane lipoprotein carrier protein LolA [Rahnella sp.
           Y9602]
          Length = 203

 Score = 76.1 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/202 (12%), Positives = 61/202 (30%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K ++ V  L                   +          + T   +F Q          
Sbjct: 1   MKKLLMVGCLLTAF-------TSASVLADASSDLKSRLGKLNTFHASFTQTVTSDDGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +G+ ++ RP+ F +  ++P    L+SDG  +  YN  ++  +   L+    +   + 
Sbjct: 54  QQGEGQLWVKRPNLFNWHMTTPDESILVSDGKTLWFYNPFVEQVTATWLKNATGNTPFML 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                    +   V+       +  K               S  + ++  ++   + S  
Sbjct: 114 ITRNDSSDWAKYNVKQKGDDFELTPKAATGNLKQFAINVTPSGTIKSFTAVEQDGQKSAY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +   ++N  +D   F+    +
Sbjct: 174 TLKG-EQNASVDDAKFKFTPPQ 194


>gi|261821268|ref|YP_003259374.1| outer-membrane lipoprotein carrier protein [Pectobacterium wasabiae
           WPP163]
 gi|261605281|gb|ACX87767.1| outer membrane lipoprotein carrier protein LolA [Pectobacterium
           wasabiae WPP163]
          Length = 203

 Score = 76.1 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/202 (13%), Positives = 56/202 (27%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K  + +  L                   + K        + +    F Q          
Sbjct: 1   MKKWLAISCLI-------TGMTSTAVYADAAKDLQGRLNKVNSFHANFSQTVTSADGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +GE ++ RP+ F +K  SP   +LISDG  +  YN  ++  +   L+    +   I 
Sbjct: 54  QEGEGELWLKRPNLFNWKTISPDESALISDGKTLWFYNPFVEQVTATWLKDATGNTPFIL 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                        V        +  K               +  +  +   +   + S  
Sbjct: 114 ITRNDTGDWDKYDVRQKGDDFELTPKSASGNLKQFAINVTTNGTIKQFTATEQDGQRSTY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +   ++N  ++   F     K
Sbjct: 174 VLKN-QQNGAVNAARFTFTPPK 194


>gi|238784517|ref|ZP_04628525.1| Outer-membrane lipoprotein carrier protein [Yersinia bercovieri
           ATCC 43970]
 gi|238714580|gb|EEQ06584.1| Outer-membrane lipoprotein carrier protein [Yersinia bercovieri
           ATCC 43970]
          Length = 203

 Score = 76.1 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 65/204 (31%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM--- 62
            K ++    L                   +          + +    F Q+         
Sbjct: 1   MKKLLVACCLLSGLI-------STSVLADASTDLQGRLSKVNSFHANFSQKVTSSEGAAV 53

Query: 63  ---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +GE ++ RP+ F +  +SP    LISDG  +  YN  ++  +            F +
Sbjct: 54  QEGEGELWVKRPNLFNWHMTSPDESVLISDGETLWFYNPFVEQATATWLKNATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  NN    ++   + + ++  +T       +           +  + ++  ++   + S
Sbjct: 114 ITRNNPDDWKQYNVKQKGDDFELTPKNASGNLKQFTITV--TPTGTIKSFAAVEQDGQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
              +   ++N+  D   F+    K
Sbjct: 172 AYTLKG-QQNSSADASKFKFTLPK 194


>gi|22126675|ref|NP_670098.1| outer-membrane lipoprotein carrier protein [Yersinia pestis KIM 10]
 gi|51595742|ref|YP_069933.1| outer-membrane lipoprotein carrier protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|108806664|ref|YP_650580.1| outer-membrane lipoprotein carrier protein [Yersinia pestis
           Antiqua]
 gi|108812764|ref|YP_648531.1| outer-membrane lipoprotein carrier protein [Yersinia pestis
           Nepal516]
 gi|145599590|ref|YP_001163666.1| outer-membrane lipoprotein carrier protein [Yersinia pestis
           Pestoides F]
 gi|149366634|ref|ZP_01888668.1| putative outer-membrane lipoproteins carrier protein [Yersinia
           pestis CA88-4125]
 gi|153949091|ref|YP_001401560.1| outer-membrane lipoprotein carrier protein [Yersinia
           pseudotuberculosis IP 31758]
 gi|161511412|ref|NP_992582.2| outer-membrane lipoprotein carrier protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|162419671|ref|YP_001606118.1| outer-membrane lipoprotein carrier protein [Yersinia pestis Angola]
 gi|165924426|ref|ZP_02220258.1| outer membrane lipoprotein carrier protein LolA [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165938956|ref|ZP_02227509.1| outer membrane lipoprotein carrier protein LolA [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166009812|ref|ZP_02230710.1| outer membrane lipoprotein carrier protein LolA [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166211569|ref|ZP_02237604.1| outer membrane lipoprotein carrier protein LolA [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167399883|ref|ZP_02305401.1| outer membrane lipoprotein carrier protein LolA [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167419434|ref|ZP_02311187.1| outer membrane lipoprotein carrier protein LolA [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167423910|ref|ZP_02315663.1| outer membrane lipoprotein carrier protein LolA [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|167470161|ref|ZP_02334865.1| outer membrane lipoprotein carrier protein LolA [Yersinia pestis
           FV-1]
 gi|170024909|ref|YP_001721414.1| outer-membrane lipoprotein carrier protein [Yersinia
           pseudotuberculosis YPIII]
 gi|186894819|ref|YP_001871931.1| outer-membrane lipoprotein carrier protein [Yersinia
           pseudotuberculosis PB1/+]
 gi|218928525|ref|YP_002346400.1| outer-membrane lipoprotein carrier protein [Yersinia pestis CO92]
 gi|229841346|ref|ZP_04461505.1| chaperone for lipoproteins [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229843451|ref|ZP_04463597.1| chaperone for lipoproteins [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229895823|ref|ZP_04510993.1| chaperone for lipoproteins [Yersinia pestis Pestoides A]
 gi|229903173|ref|ZP_04518286.1| chaperone for lipoproteins [Yersinia pestis Nepal516]
 gi|270486968|ref|ZP_06204042.1| outer membrane lipoprotein carrier protein LolA [Yersinia pestis
           KIM D27]
 gi|294503367|ref|YP_003567429.1| outer-membrane lipoprotein carrier protein precursor [Yersinia
           pestis Z176003]
 gi|21759260|sp|Q8ZGC6|LOLA_YERPE RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|81639908|sp|Q66CK1|LOLA_YERPS RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|123246326|sp|Q1CGE9|LOLA_YERPN RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|123372660|sp|Q1CA87|LOLA_YERPA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|166230505|sp|A4TN31|LOLA_YERPP RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|166990718|sp|A7FJY2|LOLA_YERP3 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229485845|sp|B2KA09|LOLA_YERPB RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229485846|sp|A9R5V0|LOLA_YERPG RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229485847|sp|B1JRF3|LOLA_YERPY RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|21959691|gb|AAM86349.1|AE013883_3 periplasmic protein [Yersinia pestis KIM 10]
 gi|51589024|emb|CAH20642.1| putative outer-membrane lipoproteins carrier protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|108776412|gb|ABG18931.1| outer-membrane lipoproteins carrier protein [Yersinia pestis
           Nepal516]
 gi|108778577|gb|ABG12635.1| putative outer-membrane lipoproteins carrier protein [Yersinia
           pestis Antiqua]
 gi|115347136|emb|CAL20029.1| putative outer-membrane lipoproteins carrier protein [Yersinia
           pestis CO92]
 gi|145211286|gb|ABP40693.1| outer-membrane lipoproteins carrier protein [Yersinia pestis
           Pestoides F]
 gi|149291008|gb|EDM41083.1| putative outer-membrane lipoproteins carrier protein [Yersinia
           pestis CA88-4125]
 gi|152960586|gb|ABS48047.1| outer membrane lipoprotein carrier protein LolA [Yersinia
           pseudotuberculosis IP 31758]
 gi|162352486|gb|ABX86434.1| outer membrane lipoprotein carrier protein LolA [Yersinia pestis
           Angola]
 gi|165913103|gb|EDR31727.1| outer membrane lipoprotein carrier protein LolA [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165923486|gb|EDR40618.1| outer membrane lipoprotein carrier protein LolA [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165991208|gb|EDR43509.1| outer membrane lipoprotein carrier protein LolA [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166207340|gb|EDR51820.1| outer membrane lipoprotein carrier protein LolA [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166962175|gb|EDR58196.1| outer membrane lipoprotein carrier protein LolA [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167050591|gb|EDR61999.1| outer membrane lipoprotein carrier protein LolA [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167056759|gb|EDR66522.1| outer membrane lipoprotein carrier protein LolA [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|169751443|gb|ACA68961.1| outer membrane lipoprotein carrier protein LolA [Yersinia
           pseudotuberculosis YPIII]
 gi|186697845|gb|ACC88474.1| outer membrane lipoprotein carrier protein LolA [Yersinia
           pseudotuberculosis PB1/+]
 gi|229678943|gb|EEO75046.1| chaperone for lipoproteins [Yersinia pestis Nepal516]
 gi|229689798|gb|EEO81859.1| chaperone for lipoproteins [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229697712|gb|EEO87759.1| chaperone for lipoproteins [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229700746|gb|EEO88775.1| chaperone for lipoproteins [Yersinia pestis Pestoides A]
 gi|262361407|gb|ACY58128.1| outer-membrane lipoprotein carrier protein precursor [Yersinia
           pestis D106004]
 gi|262365056|gb|ACY61613.1| outer-membrane lipoprotein carrier protein precursor [Yersinia
           pestis D182038]
 gi|270335472|gb|EFA46249.1| outer membrane lipoprotein carrier protein LolA [Yersinia pestis
           KIM D27]
 gi|294353826|gb|ADE64167.1| outer-membrane lipoprotein carrier protein precursor [Yersinia
           pestis Z176003]
 gi|320015766|gb|ADV99337.1| outer-membrane lipoprotein carrier protein [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 202

 Score = 76.1 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 63/204 (30%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----- 60
            K ++                        +          + +   +F Q          
Sbjct: 1   MKRLLVACCFLSGLI-------SASALADASTDLQNRLSKVNSFHASFSQAVTSSDGAVV 53

Query: 61  -VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +GE ++ RP+ F +  +SP    LISDG  +  YN  ++  +            F +
Sbjct: 54  QEGEGELWVKRPNLFNWHMTSPDESVLISDGETLWFYNPFVEQATATWLKNATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  NN    ++   + + ++  +T       +           S  + ++  ++   + S
Sbjct: 114 ITRNNPDDWKQYNVKQKGDDFELTPKSASGNLKQFAISV--TPSGTIKSFTAVEQDGQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
              +   +  +V+D   F     K
Sbjct: 172 AYTLKSQQS-SVVDASKFTFTPPK 194


>gi|322514150|ref|ZP_08067217.1| outer membrane lipoprotein carrier protein LolA [Actinobacillus
           ureae ATCC 25976]
 gi|322119990|gb|EFX91988.1| outer membrane lipoprotein carrier protein LolA [Actinobacillus
           ureae ATCC 25976]
          Length = 213

 Score = 76.1 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 30/202 (14%), Positives = 59/202 (29%), Gaps = 12/202 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK-- 63
            K +I   +L F                QSV +       +      F Q       K  
Sbjct: 1   MKKLIKQSLLGFALV---SMTGAAFADAQSVAELQRRLEQVSQYSADFDQTVRSSKGKQI 57

Query: 64  ----GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G+F   RP+ F     SP    ++SDG+N+  Y+  +   +V  ++    +   + 
Sbjct: 58  QSGKGKFQAKRPNLFRMDTKSPQENLIVSDGANLWFYDPFVSQVTVNTVQDAVNNTPFVL 117

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             +          V  N     +  K               S  L  +  ++   + ++ 
Sbjct: 118 LTSSDKSHWDQYDVTQNADTFVLKPKSKKSNLKQFDVRIDQSGMLKGFSTIERDGQSNLY 177

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +        +   +F+    K
Sbjct: 178 VLRNI-TGGGVSSDLFKFSVPK 198


>gi|299532558|ref|ZP_07045948.1| outer membrane lipoprotein carrier protein LolA [Comamonas
           testosteroni S44]
 gi|298719505|gb|EFI60472.1| outer membrane lipoprotein carrier protein LolA [Comamonas
           testosteroni S44]
          Length = 194

 Score = 76.1 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/186 (15%), Positives = 51/186 (27%), Gaps = 19/186 (10%)

Query: 33  DQSVKKAIEHFLSIQTMQGTFLQEDAG----------YVMKGEFFMARPSKFYFKYSSPS 82
              +K       + Q  +  F Q               V  G F   RP KF F Y+ P 
Sbjct: 2   ADGLKSLESFMKNAQAGKADFTQSVTSPPKSGQEARTKVSSGSFEFQRPGKFRFNYTKPF 61

Query: 83  SVSLISDGSNIAVYNAKLDTWSVYPLRY-------MAFSVIFSNNQHVIQESIQRVESNN 135
              +++DG  + +Y+A L+  +                +             +      +
Sbjct: 62  EQLIVADGKTLWLYDADLNQVTERAQAQVLGSTPAAILTSATDLKALKADFELGNQPDAD 121

Query: 136 SFITIFFKDDFMGNMISVTFDRLSYR--LLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
               +       G  +       +    L    I DS  + S+++    +    L    F
Sbjct: 122 GLEWVLASPRQKGGQLKSVRIGFTPEGKLAALDIEDSFGQRSLMQFKGLQTQASLPASTF 181

Query: 194 EIPYDK 199
                K
Sbjct: 182 HFTVPK 187


>gi|309973264|gb|ADO96465.1| Outer membrane lipoprotein carrier protein [Haemophilus influenzae
           R2846]
          Length = 205

 Score = 76.1 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 19/189 (10%), Positives = 50/189 (26%), Gaps = 9/189 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPS 72
                           +  +       +  +   F+Q              G+  + RP+
Sbjct: 8   FTALALLGLSNFALADAASELQMRLAKVDVLSAEFVQTVTSGSGKNVQQGSGKLQIKRPN 67

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQR 130
            F  +  +P    +ISDG  +  Y+  +   +   ++    +   +   +          
Sbjct: 68  LFRMETKTPQETQIISDGKTLWFYDPFVQQVTAQWVKDAVNNTPFVLLTSNDNSHWHQYT 127

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
           V        +                  +  L N+   +   + ++  +     N  L  
Sbjct: 128 VTQQADTFVLKPTLSTSNIKQFDIRVDANGILRNFSTTEKDGQTNLYVLRNI-TNQTLSD 186

Query: 191 KVFEIPYDK 199
            +F+   +K
Sbjct: 187 SLFQFKPEK 195


>gi|209542305|ref|YP_002274534.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209529982|gb|ACI49919.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 202

 Score = 76.1 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/192 (12%), Positives = 63/192 (32%), Gaps = 7/192 (3%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARP 71
           ++L    A+    AA      + V +   +  + + +     Q    G V +G      P
Sbjct: 11  LVLTAPLALAACQAAPGPVGGRDVARIERYLNTTRGLSAHVAQTWPDGGVGEGTLSYD-P 69

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRV 131
                 Y +P  + L++ G ++   +A   + +   L      ++ +   H+  E     
Sbjct: 70  GYLRLDYDTPHRMRLVAAGGHLVFRDAVRQSVTRMNLSRQPLGLLLATPVHLGGEVTVTA 129

Query: 132 ESNNSFIT---IFFKDDFMGNMISVTFDR--LSYRLLNWKIMDSSRRYSIIKILKYKENT 186
             +   +    +    +    ++++ F        L+   I+D     + + +   +  T
Sbjct: 130 IQHGDHVLQVSLARTANPSQGLLTLGFSDFAGQLSLVAIDILDERHNRTRLHLTDQRTGT 189

Query: 187 VLDPKVFEIPYD 198
                 F +  +
Sbjct: 190 AFPADFFSLTAE 201


>gi|261492277|ref|ZP_05988840.1| outer membrane lipoprotein-sorting protein [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261494498|ref|ZP_05990984.1| outer membrane lipoprotein-sorting protein [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261309882|gb|EEY11099.1| outer membrane lipoprotein-sorting protein [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261312056|gb|EEY13196.1| outer membrane lipoprotein-sorting protein [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 213

 Score = 76.1 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 26/202 (12%), Positives = 59/202 (29%), Gaps = 12/202 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----- 60
            K++    +           A   +   QSV +       +      F Q          
Sbjct: 1   MKTLFKKSVFGLALFGL---ANVALADAQSVAELQRRLEQVSQYSADFDQTVRSSKGKQI 57

Query: 61  -VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              KG+F + RP+ F     SP    ++SDG ++  Y+  +   +V  ++    +   + 
Sbjct: 58  QQGKGKFQVKRPNLFRMDTKSPQENLIVSDGKDLWFYDPFVSQVTVNTVQDAVNNTPFVL 117

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             +          V  +     +  K               S  L  +  ++   + ++ 
Sbjct: 118 LTSSDKSHWDQYDVSQSADTFVLKPKSKKSNLKQFDVRIDQSGLLKGFSTIERDGQSNLY 177

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +        +   +F+    K
Sbjct: 178 VLRNITTG-GVSSDLFKFSVPK 198


>gi|254360484|ref|ZP_04976633.1| outer membrane lipoprotein-sorting protein [Mannheimia haemolytica
           PHL213]
 gi|153091024|gb|EDN73029.1| outer membrane lipoprotein-sorting protein [Mannheimia haemolytica
           PHL213]
          Length = 213

 Score = 76.1 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 26/202 (12%), Positives = 59/202 (29%), Gaps = 12/202 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----- 60
            K++    +           A   +   QSV +       +      F Q          
Sbjct: 1   MKTLFKKSVFGLALFGL---ANVALADAQSVAELQRRLEQVSQYSADFDQTVRSSKGKQI 57

Query: 61  -VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              KG+F + RP+ F     SP    ++SDG ++  Y+  +   +V  ++    +   + 
Sbjct: 58  QQGKGKFQVKRPNLFRMDTKSPQENLIVSDGKDLWFYDPFVSQVTVNTVQDAVNNTPFVL 117

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             +          V  +     +  K               S  L  +  ++   + ++ 
Sbjct: 118 LTSGDKSHWDQYDVSQSADTFVLKPKSKKSNLKQFDVRIDQSGLLKGFSTIERDGQSNLY 177

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +        +   +F+    K
Sbjct: 178 VLRNITTG-GVSSDLFKFSVPK 198


>gi|238789331|ref|ZP_04633118.1| Outer-membrane lipoprotein carrier protein [Yersinia frederiksenii
           ATCC 33641]
 gi|238722663|gb|EEQ14316.1| Outer-membrane lipoprotein carrier protein [Yersinia frederiksenii
           ATCC 33641]
          Length = 203

 Score = 75.7 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/204 (14%), Positives = 65/204 (31%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K ++    L                   +          + +    F Q+         
Sbjct: 1   MKKLLIACCLLSGLI-------SGSVLADASTDLQGRLSKVNSFHANFSQKVTTADGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +GE ++ RP+ F +  +SP    LISDG  +  YN  ++  +            F +
Sbjct: 54  QEGEGELWVKRPNLFNWHMTSPDESVLISDGETLWFYNPFVEQATATWLKNATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  NN    ++   + + ++  +T       +           +  + N+  ++   + S
Sbjct: 114 ITRNNPDDWKQYNVKQKGDDFELTPKSASGNLKQFAITV--TPAGTIKNFAAVEQDGQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
              +   ++N+  D   F+    K
Sbjct: 172 TYVLKG-QQNSSTDASKFKFTLPK 194


>gi|165975935|ref|YP_001651528.1| outer-membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|229485822|sp|B0BU79|LOLA_ACTPJ RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|165876036|gb|ABY69084.1| outer membrane lipoprotein carrier protein [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
          Length = 213

 Score = 75.7 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/202 (14%), Positives = 61/202 (30%), Gaps = 12/202 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK-- 63
            K ++   +L F                QSV +       +      F Q       K  
Sbjct: 1   MKKLLKQSLLGFALV---SMTGAAFADAQSVAELQRRLEQVSQYSADFDQTVRSSKGKQI 57

Query: 64  ----GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G+F + RP+ F     SP    ++SDG+N+  Y++ +   +V  ++    +   + 
Sbjct: 58  QSGKGKFQVKRPNLFRMDTKSPQENLIVSDGANLWFYDSFVSQVTVNTVQDAVNNTPFVL 117

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             +          V  N     +  K               S  L  +  ++   + ++ 
Sbjct: 118 LTSSDKSHWDQYDVTQNADTFVLKPKSKKSNLKQFDVRIDQSGMLKGFSTIERDGQSNLY 177

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +        +   +F+    K
Sbjct: 178 VLRNI-TGGGVSSDLFKFSVPK 198


>gi|197284593|ref|YP_002150465.1| outer-membrane lipoprotein carrier protein [Proteus mirabilis
           HI4320]
 gi|227356775|ref|ZP_03841160.1| outer-membrane lipoprotein carrier protein [Proteus mirabilis ATCC
           29906]
 gi|229485834|sp|B4EV91|LOLA_PROMH RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|194682080|emb|CAR41634.1| outer-membrane lipoprotein carrier protein [Proteus mirabilis
           HI4320]
 gi|227163065|gb|EEI48000.1| outer-membrane lipoprotein carrier protein [Proteus mirabilis ATCC
           29906]
          Length = 201

 Score = 75.7 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/201 (13%), Positives = 60/201 (29%), Gaps = 17/201 (8%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM--- 62
            K V+  V                     + +   +    + + Q  F Q          
Sbjct: 1   MKKVLLTVCAIALF-------GSQAAWADARQDLQQRLNKVNSFQANFSQTVTSNEGALI 53

Query: 63  ---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +G   + RP  F ++ ++P   +LISDG  +  YN  ++  +   L     +   + 
Sbjct: 54  QKGEGHLKVQRPDLFNWQMTAPDESTLISDGKTLWFYNPFVEQVTATWLESATTNTPFML 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                  +     V+ N     +  K +      S+T      ++  +   +   + S  
Sbjct: 114 IARNDSKEWQNYDVKQNGDRFELTPKTENNLKHFSITVSPN-GQIQQFAATEQDGQVSQY 172

Query: 178 KILKYKENTVLDPKVFEIPYD 198
           ++   K    +D   F     
Sbjct: 173 QLTAQKV-APIDASAFRFTPP 192


>gi|108762741|ref|YP_629730.1| outer membrane lipoprotein carrier protein LolA [Myxococcus xanthus
           DK 1622]
 gi|108466621|gb|ABF91806.1| outer membrane lipoprotein carrier protein LolA [Myxococcus xanthus
           DK 1622]
          Length = 219

 Score = 75.7 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/180 (13%), Positives = 60/180 (33%), Gaps = 14/180 (7%)

Query: 33  DQSVKKAIEHFLSIQTMQGTFLQEDA------GYVMKGEFFMARPSKFYFKYSSPSSVSL 86
              V +    +      +  F Q+            +G     +P    ++Y  PS  + 
Sbjct: 26  KSLVDRMQAFYEKTGDFRAGFRQDYKYKTFRRTQTSEGTVTYKKPGLMRWEYLKPSPRTF 85

Query: 87  ISDGSNIAVYNAKLDTWSVYPLRYMAFS----VIFSNNQHVIQESIQRVESNN----SFI 138
           +  G+ +  Y+    + +V  +     S     +F   +   + +I +    +      +
Sbjct: 86  VLAGNKVYAYDPAAQSLTVANVDTSQLSASVTFLFGQGKLADEFNITKGACKDCKGTLLV 145

Query: 139 TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
               K++     + +  D  + ++L   ++D     + I  L  K N  LD   F++   
Sbjct: 146 LDPLKNEPRFRQVRLEVDPSTAQVLKSTVVDPDGSENTISFLNLKTNVGLDADSFKLDVP 205


>gi|56459775|ref|YP_155056.1| Outer membrane lipoprotein-sorting protein [Idiomarina loihiensis
           L2TR]
 gi|81600266|sp|Q5R0C0|LOLA_IDILO RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|56178785|gb|AAV81507.1| Outer membrane lipoprotein-sorting protein [Idiomarina loihiensis
           L2TR]
          Length = 200

 Score = 75.7 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 21/188 (11%), Positives = 58/188 (30%), Gaps = 8/188 (4%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------GE 65
           +  + F   +      +    +   +         Q++   F Q+      +      G 
Sbjct: 1   MKAVVFAMVMAVSFNVFASGDESDKQALQSLLKQTQSLSAEFEQQVKDEQGEVLQTLSGT 60

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQ 125
             + RP+  Y+    P    ++++G  +  YN  ++  ++Y  + M          +   
Sbjct: 61  LKLKRPANLYWHTKEPDESVMVANGKKVWYYNPFVEQVTIYAQQDMVDDSPLLLVLNSNG 120

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
              Q    +      F +    G+ + + F      L    ++ +    + + +     N
Sbjct: 121 NQWQNYNVSFRDNRYFVEHQTNGSKLELRFTDEK--LTEITMVQAQGERTELMLNNVALN 178

Query: 186 TVLDPKVF 193
             +  + F
Sbjct: 179 ETISDEQF 186


>gi|240949359|ref|ZP_04753701.1| outer-membrane lipoprotein carrier protein [Actinobacillus minor
           NM305]
 gi|240296209|gb|EER46862.1| outer-membrane lipoprotein carrier protein [Actinobacillus minor
           NM305]
          Length = 213

 Score = 75.7 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/202 (12%), Positives = 61/202 (30%), Gaps = 12/202 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK-- 63
            K ++   +   +       A       Q+V +       +      F Q       K  
Sbjct: 1   MKQIMKKSL---FGLALFSLAGSAFADAQAVAELQNRLEKVSQYSADFDQTVRSSKGKQI 57

Query: 64  ----GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G+F + RP+ F     SP    ++SDG+N+  Y+  +   +V  ++    +   + 
Sbjct: 58  QSGQGKFQVKRPNLFRMDTKSPQENLIVSDGANLWFYDPFVSQVTVNTVQDAVNNTPFVL 117

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             + +        V  N     +  K               +  +  +  ++   + ++ 
Sbjct: 118 LTSNNKSHWDQYDVTQNMDSFVLKPKWKKSSLKQFDVRIDANGVMKGFSTIERDGQSNLY 177

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +        +   +F+    K
Sbjct: 178 VLRNITT-ANVSSDLFKFSVPK 198


>gi|238795839|ref|ZP_04639352.1| Outer-membrane lipoprotein carrier protein [Yersinia mollaretii
           ATCC 43969]
 gi|238720302|gb|EEQ12105.1| Outer-membrane lipoprotein carrier protein [Yersinia mollaretii
           ATCC 43969]
          Length = 203

 Score = 75.7 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 65/204 (31%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM--- 62
            K ++    L                   +          + +    F Q+         
Sbjct: 1   MKKLLVACCLLSGLI-------STSVLADASTDLQGRLSKVNSFHANFSQKVTSSEGAAV 53

Query: 63  ---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +GE ++ RP+ F +  +SP    LISDG  +  YN  ++  +            F +
Sbjct: 54  QEGEGELWVKRPNLFNWHMTSPDESVLISDGETLWFYNPFVEQATATWLKNATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  NN    ++   + + ++  +T       +           +  + ++  ++   + S
Sbjct: 114 ITRNNPDDWKQYNVKQKGDDFELTPKNASGNLKQFTITV--TPAGTIKSFAAVEQDGQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
              +   ++N+  D   F+    K
Sbjct: 172 AYTLKG-QQNSSADASKFKFTLPK 194


>gi|332288541|ref|YP_004419393.1| outer membrane lipoprotein carrier protein [Gallibacterium anatis
           UMN179]
 gi|330431437|gb|AEC16496.1| outer membrane lipoprotein carrier protein [Gallibacterium anatis
           UMN179]
          Length = 204

 Score = 75.7 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 24/202 (11%), Positives = 61/202 (30%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K ++    LF                  +  +  +    I ++   F Q  +       
Sbjct: 1   MKKLLTFCALFSLIC-------STTAFADAKSELQQRLSQINSLSSQFQQRVSDAEGKVV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +G   +  P+ F  + SSP    ++SDG  +  Y+  ++  +   +     +   + 
Sbjct: 54  QQGEGTLQIKHPNLFKMEISSPQESEMVSDGKTLWYYDPFVEQATANWVSEAVNNTPFVL 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             +      +  +V       T+   D              +  L ++  ++   + ++ 
Sbjct: 114 LTSDDQHHWASYQVTQKQDVFTLTPVDKKSNIKQFTIRINTNGLLNSFSTIEKDGQANLY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +      +VL    F+    K
Sbjct: 174 ILRNINT-SVLPDSTFKFTLPK 194


>gi|114047508|ref|YP_738058.1| outer membrane lipoprotein carrier protein LolA [Shewanella sp.
           MR-7]
 gi|123030618|sp|Q0HV54|LOLA_SHESR RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|113888950|gb|ABI43001.1| outer membrane lipoprotein carrier protein LolA [Shewanella sp.
           MR-7]
          Length = 206

 Score = 75.7 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 26/192 (13%), Positives = 61/192 (31%), Gaps = 9/192 (4%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMA 69
              + +               K+  E     ++++  F Q              G F +A
Sbjct: 4   LLCAVLLSPLLYSNAVLADDAKQLRETLNGTESLKADFKQTVTDINKKVIQTGAGVFALA 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQES 127
            P++FY+  ++P    +++DG ++ +YN   +   +        +  +    ++     S
Sbjct: 64  HPNQFYWHLTAPDESQIVADGKDLWIYNPFAEEVVIMDFAEAINASPIALLVHRDDATWS 123

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
              V        I  K      + SV     +  L  + ++D     S   +      + 
Sbjct: 124 QYSVTKKQDCYEIKPKSTDA-GITSVNVCFNNGTLNKFNVLDDKGNLSQFDLSNQHSISA 182

Query: 188 LDPKVFEIPYDK 199
            D  +F+    +
Sbjct: 183 ADKSLFKFVLPE 194


>gi|153871550|ref|ZP_02000694.1| Outer membrane lipoprotein carrier protein LolA [Beggiatoa sp. PS]
 gi|152071984|gb|EDN69306.1| Outer membrane lipoprotein carrier protein LolA [Beggiatoa sp. PS]
          Length = 202

 Score = 75.7 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/204 (16%), Positives = 72/204 (35%), Gaps = 22/204 (10%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV---- 61
            K    +++L                   + +        +QT++G F QE         
Sbjct: 1   MKKYWLLILLLSI-----------PNWLSANENLDNFLQGLQTLRGQFYQELYNEKGTLL 49

Query: 62  --MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FS 114
              +G+ +M RP +F ++Y  P +  +++DG NI +Y+  L+  ++  L         F 
Sbjct: 50  ERSQGKMYMQRPDQFRWEYEQPYNQLIVADGKNIFIYDIDLEQVTLRSLDKTIGKTPAFL 109

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +  S          Q  +  +         D      S+  +     L +++++D+  + 
Sbjct: 110 LSRSRQLGEDFFVNQLSQQEDKTRFELIPKDAQAQFDSIRINLRGNTLQSFELVDNLGQT 169

Query: 175 SIIKILKYKENTVLDPKVFEIPYD 198
           + I   +   N  LD  +F     
Sbjct: 170 TYITFRQLIRNKKLDEGLFIFTPP 193


>gi|157826350|ref|YP_001494070.1| hypothetical protein A1C_06695 [Rickettsia akari str. Hartford]
 gi|157800308|gb|ABV75562.1| hypothetical protein A1C_06695 [Rickettsia akari str. Hartford]
          Length = 212

 Score = 75.7 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/197 (17%), Positives = 83/197 (42%), Gaps = 6/197 (3%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKG 64
            K +  V+I  F +++  F  A       ++ +   +  +I+++   F QED+ G +++G
Sbjct: 1   MKKIFLVIICVFINSVVAFGGA---DDKTTISELKTYLRTIKSIAIDFTQEDSYGKIVEG 57

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
           +  + +P  F   Y  P  + +I   + +++Y+  ++  S       A + +  +N+H  
Sbjct: 58  KLLIHKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENALNFLLEDNKHFD 117

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMIS-VTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
           ++ +     N   I+       +    S +TF++ + ++   KI  +      I   K  
Sbjct: 118 KDFVFESVINERNISKITIYHTLTEKRSEITFNKATKQIEALKIF-ADNNIVTITFDKIA 176

Query: 184 ENTVLDPKVFEIPYDKI 200
           +       +F++    I
Sbjct: 177 KVQKFSDDLFKLKNPAI 193


>gi|237745818|ref|ZP_04576298.1| outer-membrane lipoprotein carrier protein [Oxalobacter formigenes
           HOxBLS]
 gi|229377169|gb|EEO27260.1| outer-membrane lipoprotein carrier protein [Oxalobacter formigenes
           HOxBLS]
          Length = 233

 Score = 75.3 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 33/208 (15%), Positives = 76/208 (36%), Gaps = 18/208 (8%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV 61
           + +S I   +        P  A        ++ +      +  + +G F Q   +    V
Sbjct: 24  IMRSYISKTVGTVLLLFLPLFA-----GATALDQLKNFSANAHSARGEFSQAQVKSGEKV 78

Query: 62  -----MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMA 112
                  G F  +RP KF + Y  P    L +DG+ + +Y+  L+  +V  L        
Sbjct: 79  RFTNAASGTFLFSRPGKFIWTYKKPYEQVLQADGTRLYMYDKDLNQVTVKKLGDALGSSP 138

Query: 113 FSVIFSNNQHVIQESIQRVESNNSFITIF-FKDDFMGNMISVTFDRLSYRLLNWKIMDSS 171
            +++F +N       ++   ++N +  +             +     +      ++ DS 
Sbjct: 139 AAILFGSNNLEKNFMLKNAGAHNGYEWVEVIPKKKDTPFEKINIGMKNGIPEAMELYDSL 198

Query: 172 RRYSIIKILKYKENTVLDPKVFEIPYDK 199
            + ++IK  ++ +N  ++  +F+    K
Sbjct: 199 GQLTLIKFTQFTKNPPVNAGMFKFVAPK 226


>gi|331646158|ref|ZP_08347261.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           M605]
 gi|331044910|gb|EGI17037.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           M605]
          Length = 204

 Score = 75.3 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 24/205 (11%), Positives = 64/205 (31%), Gaps = 20/205 (9%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K +         +     +         +          + + Q +F Q+        
Sbjct: 1   MMKKI-------AITCALLSSLVASSVWADAASDLKSRLDKVSSFQASFTQKVTDGSGAA 53

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFS 114
               +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F 
Sbjct: 54  VQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFM 113

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +I  N     Q+   +   ++  +T    +  +              +  +  ++   + 
Sbjct: 114 LIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQR 171

Query: 175 SIIKILKYKENTVLDPKVFEIPYDK 199
           S  ++   ++N  +D   F     +
Sbjct: 172 SSYQLKS-QQNGAVDAAKFTFTPPQ 195


>gi|171463820|ref|YP_001797933.1| outer membrane lipoprotein carrier protein LolA [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|171193358|gb|ACB44319.1| outer membrane lipoprotein carrier protein LolA [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 227

 Score = 75.3 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 66/220 (30%), Gaps = 29/220 (13%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE--------- 56
               +   IL   + +F   A      +   ++  +   + +T +G F+Q+         
Sbjct: 1   MSRFLISAILAIANILFSGTALSQS--ESGAEQLRQFVRNSKTAEGDFIQQQLRAPKANE 58

Query: 57  --DAG----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY 110
             D G       +G F   RP +F +    P    L++DG  + +++  L+  ++ P   
Sbjct: 59  PQDKGLKVVRQTQGHFVFQRPGRFIWDTQKPYEQKLVADGKQLILWDKDLNQATLRPAGQ 118

Query: 111 ----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGN--------MISVTFDRL 158
                  +++F          +   E       +                    V+    
Sbjct: 119 ALASTPAAILFGETSLEQHFDLVEGEERLGMKWVSLIPKRDPGAKNKNDLPYTKVSIGMA 178

Query: 159 SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           +      ++ D      ++ + K + N  L    F     
Sbjct: 179 NGLPKALELTDGLGSVVLVALDKIQLNVNLPANRFTFTPP 218


>gi|311104408|ref|YP_003977261.1| outer membrane lipocarrier protein LolA [Achromobacter xylosoxidans
           A8]
 gi|310759097|gb|ADP14546.1| outer membrane lipocarrier protein LolA [Achromobacter xylosoxidans
           A8]
          Length = 207

 Score = 75.3 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 24/174 (13%), Positives = 54/174 (31%), Gaps = 11/174 (6%)

Query: 37  KKAIEHFLSIQTMQGTFLQEDAGYVM------KGEFFMARPSKFYFKYSSPSSVSLISDG 90
           ++      ++ +  G+F Q              G F   RP KF +    P    ++SDG
Sbjct: 27  EQLRAFVATVTSATGSFSQYTVNNQGRTQPAQTGVFSFQRPGKFKWAVQKPYEQLVVSDG 86

Query: 91  SNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQESIQRVESNNSF-ITIFFKDD 145
             +  ++  L   +   +         +++F +        +  + S +           
Sbjct: 87  RQVFQFDPDLAQVTERKVDAAIGTSPAAILFGSGSLEQSFDVSALPSEDGIDWLRAKPRT 146

Query: 146 FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                  V         +  +++DS  + + + +     N  L  K F+    K
Sbjct: 147 ADAGFSRVDIGMKDNLPVRVELLDSFGQTTRVDLSGIAANPQLPAKEFQFVAPK 200


>gi|294669469|ref|ZP_06734536.1| hypothetical protein NEIELOOT_01366 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308382|gb|EFE49625.1| hypothetical protein NEIELOOT_01366 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 208

 Score = 75.3 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 46/145 (31%), Gaps = 5/145 (3%)

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSV 115
               G F + RP  F ++YS P   +++ DG +I +Y+  L   +             S+
Sbjct: 57  QTSGGTFQIMRPGLFRWEYSKPYKQTIVGDGQHIWLYDVDLKQVTKSDQSQAIGDSPASI 116

Query: 116 IFSNNQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +   N      S++   S +     +            +        L   ++ D     
Sbjct: 117 LSDKNALDSSYSLKEDGSGDGIDYVLATPKKNNAGYQFIRIGFKGETLAAMELKDGFGNQ 176

Query: 175 SIIKILKYKENTVLDPKVFEIPYDK 199
           + IK      +  L    F+    K
Sbjct: 177 TSIKFSNVNTHPNLSRGNFKFVPPK 201


>gi|261868433|ref|YP_003256355.1| outer-membrane lipoprotein carrier protein [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|293392024|ref|ZP_06636358.1| outer membrane lipoprotein carrier protein LolA [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|261413765|gb|ACX83136.1| outer membrane lipoprotein carrier protein LolA [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|290952558|gb|EFE02677.1| outer membrane lipoprotein carrier protein LolA [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 205

 Score = 74.9 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 20/180 (11%), Positives = 54/180 (30%), Gaps = 9/180 (5%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSP 81
             +    +  +       +  +   F Q  +           G+  + RP+ F     +P
Sbjct: 17  SSVVWANADIELQNRLNKVDVLSADFAQTVSSANGKNVQQGNGKLQIKRPNLFRMDTKAP 76

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRVESNNSFIT 139
               +I+DG  +  Y+  ++  +   ++    +   +   +      S   V+  +    
Sbjct: 77  QETQIIADGQTLWFYDPFVEQVTANWVKDAVNNTPFVLLTSGDKSHWSQYTVQQKDDTFV 136

Query: 140 IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           +  K               +  L  +  ++   + +   +     N  LD  +F+    K
Sbjct: 137 LTPKAKNSNVKQFDIRIDSNGVLKGFSTIEKDGQSNQYVLRNI-TNQNLDDGLFKFSVPK 195


>gi|251789958|ref|YP_003004679.1| outer-membrane lipoprotein carrier protein [Dickeya zeae Ech1591]
 gi|247538579|gb|ACT07200.1| outer membrane lipoprotein carrier protein LolA [Dickeya zeae
           Ech1591]
          Length = 204

 Score = 74.9 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/198 (12%), Positives = 64/198 (32%), Gaps = 13/198 (6%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGE 65
           ++ +   +     +         +          + +    F Q+             GE
Sbjct: 1   MIKIGLITGCLLTSLVSGAVYADAAGDLQSRLSKVNSFHAGFTQKVTTNDGAAVQEGAGE 60

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQ 121
            ++ RP+ F +K +SP   +L+SDG  +  YN  ++  +   ++       F +I  N+ 
Sbjct: 61  LWVKRPNLFNWKTTSPDESTLVSDGKTLWFYNPFVEQVTATWVKDATGNTPFILITRNDP 120

Query: 122 HVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
               +     + ++  +T    +  +              +  +   +   + S   +  
Sbjct: 121 KDWGKYNVSQKGDDFDLTPRAANGNLKRFSINV--TSDGTIHGFTATEQDGQRSAYTLKN 178

Query: 182 YKENTVLDPKVFEIPYDK 199
            ++N  +D   F     K
Sbjct: 179 -QQNGEIDAAKFRFTPPK 195


>gi|317047547|ref|YP_004115195.1| outer membrane lipoprotein carrier protein LolA [Pantoea sp. At-9b]
 gi|316949164|gb|ADU68639.1| outer membrane lipoprotein carrier protein LolA [Pantoea sp. At-9b]
          Length = 203

 Score = 74.9 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 24/191 (12%), Positives = 58/191 (30%), Gaps = 9/191 (4%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMAR 70
             +     +         +     +    + +   +F Q+            +GE ++ R
Sbjct: 5   VIACGLLASFLSASVLADASSDLQQRLNKVNSFHASFSQKVTDGSGANVQDGEGELWVKR 64

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESI 128
           PS F +  ++P    +ISDG  +  YN  ++  S   L+    +   +          + 
Sbjct: 65  PSLFNWHMTAPDESVIISDGKTLWFYNPFVEQVSASWLKNATSNTPFMLIARNQPSDWTQ 124

Query: 129 QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
             ++       +  K               S  +  +  ++   + S  ++   + N  +
Sbjct: 125 YNIKQQGDNFELTPKSSDGNLKQFTITVTPSGTINQFSAIEQDGQRSSYQLKS-QTNGAI 183

Query: 189 DPKVFEIPYDK 199
            P  F     K
Sbjct: 184 SPDKFTFTPPK 194


>gi|296116274|ref|ZP_06834891.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295977208|gb|EFG83969.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 237

 Score = 74.5 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 27/195 (13%), Positives = 68/195 (34%), Gaps = 17/195 (8%)

Query: 2   AFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQ-----------SVKKAIEHFLSIQTMQ 50
           + L  + +   +++          A     + Q            + +  EH  +I  + 
Sbjct: 18  SLLRLRCMRPFMLVMPLVLGLGAYAQPASAQAQMVVGASDQDHALINRIEEHLNTITLLT 77

Query: 51  GTFLQE-DAGYVMKGEFFMARPS-KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPL 108
             F Q    G    G  ++ R + +  F+Y  PS + L+++   +   +++L   +  P+
Sbjct: 78  AQFHQVASDGKQSTGTAWLDRRNRRMRFQYDPPSPLLLVANHDQVVFNDSELGQTTTMPM 137

Query: 109 RYMAFSVIFSNNQHVIQESIQRV---ESNNSFITIFFKDDFMGNMISVTF-DRLSYRLLN 164
                 ++   +  +  +        E     IT+   D      +++ F +    RL  
Sbjct: 138 DKTPIGLLLRPHLELSGDVRVTALMHEGPEIEITLVRADSPGDGSLTLLFQEDKGLRLRG 197

Query: 165 WKIMDSSRRYSIIKI 179
           W + D+    + + +
Sbjct: 198 WIVQDAQGESTRVDL 212


>gi|212702993|ref|ZP_03311121.1| hypothetical protein DESPIG_01031 [Desulfovibrio piger ATCC 29098]
 gi|212673581|gb|EEB34064.1| hypothetical protein DESPIG_01031 [Desulfovibrio piger ATCC 29098]
          Length = 223

 Score = 74.5 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 24/204 (11%), Positives = 57/204 (27%), Gaps = 15/204 (7%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM------K 63
           + ++      A+     A        V    + + ++Q+    F Q+             
Sbjct: 1   MRMIKSLVLGAVSLLALASWAQAADLVGDLKQRYDTLQSFSAEFEQKLTHKESGAVETRY 60

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAFSVIFS 118
           G     +P    ++   P   +L+  G  I  Y    +    YP            V+  
Sbjct: 61  GTLHFKKPLLIRWETKKPIKETLVVTGKEIWDYIPDEEVAYRYPHDLVQDSRSIIQVLTG 120

Query: 119 NNQHVIQESIQRVESNN---SFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
                    I+   + N                    +  D  ++ +    ++D    ++
Sbjct: 121 QAALSKDFDIKEEGTENGMRKIRLYPKDPTPQMVEALIWVDAQTF-IRRVDLVDFYGNHN 179

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
            +  +K+  + +L    F+    K
Sbjct: 180 DVNFIKFIPDVMLGSGTFQFTPPK 203


>gi|15800754|ref|NP_286768.1| outer-membrane lipoprotein carrier protein [Escherichia coli
           O157:H7 EDL933]
 gi|15830230|ref|NP_309003.1| outer-membrane lipoprotein carrier protein [Escherichia coli
           O157:H7 str. Sakai]
 gi|24112266|ref|NP_706776.1| outer-membrane lipoprotein carrier protein [Shigella flexneri 2a
           str. 301]
 gi|26246917|ref|NP_752957.1| outer-membrane lipoprotein carrier protein [Escherichia coli
           CFT073]
 gi|30062378|ref|NP_836549.1| outer-membrane lipoprotein carrier protein [Shigella flexneri 2a
           str. 2457T]
 gi|74311449|ref|YP_309868.1| outer-membrane lipoprotein carrier protein [Shigella sonnei Ss046]
 gi|82543377|ref|YP_407324.1| outer-membrane lipoprotein carrier protein [Shigella boydii Sb227]
 gi|82777587|ref|YP_403936.1| outer-membrane lipoprotein carrier protein [Shigella dysenteriae
           Sd197]
 gi|89107741|ref|AP_001521.1| chaperone for lipoproteins [Escherichia coli str. K-12 substr.
           W3110]
 gi|91209936|ref|YP_539922.1| outer-membrane lipoprotein carrier protein [Escherichia coli UTI89]
 gi|117623075|ref|YP_851988.1| outer-membrane lipoprotein carrier protein [Escherichia coli APEC
           O1]
 gi|209918140|ref|YP_002292224.1| outer-membrane lipoprotein carrier protein [Escherichia coli SE11]
 gi|215486021|ref|YP_002328452.1| outer-membrane lipoprotein carrier protein [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218548413|ref|YP_002382204.1| outer-membrane lipoprotein carrier protein [Escherichia fergusonii
           ATCC 35469]
 gi|218553477|ref|YP_002386390.1| outer-membrane lipoprotein carrier protein [Escherichia coli IAI1]
 gi|218557799|ref|YP_002390712.1| outer-membrane lipoprotein carrier protein [Escherichia coli S88]
 gi|218688679|ref|YP_002396891.1| outer-membrane lipoprotein carrier protein [Escherichia coli ED1a]
 gi|218694364|ref|YP_002402031.1| outer-membrane lipoprotein carrier protein [Escherichia coli 55989]
 gi|218700591|ref|YP_002408220.1| outer-membrane lipoprotein carrier protein [Escherichia coli IAI39]
 gi|218704320|ref|YP_002411839.1| outer-membrane lipoprotein carrier protein [Escherichia coli
           UMN026]
 gi|227884142|ref|ZP_04001947.1| outer-membrane lipoprotein carrier protein [Escherichia coli 83972]
 gi|237707119|ref|ZP_04537600.1| periplasmic protein [Escherichia sp. 3_2_53FAA]
 gi|254161005|ref|YP_003044113.1| outer-membrane lipoprotein carrier protein [Escherichia coli B str.
           REL606]
 gi|260843141|ref|YP_003220919.1| chaperone IolA [Escherichia coli O103:H2 str. 12009]
 gi|260854182|ref|YP_003228073.1| chaperone IolA [Escherichia coli O26:H11 str. 11368]
 gi|260867063|ref|YP_003233465.1| chaperone IolA [Escherichia coli O111:H- str. 11128]
 gi|261227396|ref|ZP_05941677.1| outer-membrane lipoprotein carrier protein precursor [Escherichia
           coli O157:H7 str. FRIK2000]
 gi|261256181|ref|ZP_05948714.1| chaperone IolA [Escherichia coli O157:H7 str. FRIK966]
 gi|291281894|ref|YP_003498712.1| outer-membrane lipoprotein carrier protein precursor [Escherichia
           coli O55:H7 str. CB9615]
 gi|300817007|ref|ZP_07097226.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 107-1]
 gi|300823630|ref|ZP_07103757.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 119-7]
 gi|300896502|ref|ZP_07115026.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 198-1]
 gi|300902952|ref|ZP_07120896.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 84-1]
 gi|300921075|ref|ZP_07137459.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 115-1]
 gi|300926529|ref|ZP_07142318.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 182-1]
 gi|300929584|ref|ZP_07145047.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 187-1]
 gi|300937615|ref|ZP_07152424.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 21-1]
 gi|300949749|ref|ZP_07163726.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 116-1]
 gi|300954714|ref|ZP_07167149.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 175-1]
 gi|300978545|ref|ZP_07174298.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 45-1]
 gi|300983198|ref|ZP_07176477.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 200-1]
 gi|301047851|ref|ZP_07194901.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 185-1]
 gi|301302502|ref|ZP_07208633.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 124-1]
 gi|301325786|ref|ZP_07219234.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 78-1]
 gi|301646336|ref|ZP_07246224.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 146-1]
 gi|309795300|ref|ZP_07689718.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 145-7]
 gi|331641412|ref|ZP_08342547.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           H736]
 gi|331651910|ref|ZP_08352929.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           M718]
 gi|331676678|ref|ZP_08377374.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           H591]
 gi|332282206|ref|ZP_08394619.1| periplasmic protein [Shigella sp. D9]
 gi|25348770|pir||H90750 outer membrane lipoprotein carrier protein precursor [similarity] -
           Escherichia coli (strain O157:H7, substrain RIMD
           0509952)
 gi|25348772|pir||F85614 outer membrane lipoprotein carrier protein precursor [similarity] -
           Escherichia coli (strain O157:H7, substrain EDL933)
 gi|12514053|gb|AAG55378.1|AE005278_4 periplasmic protein effects translocation of lipoproteins from
           inner membrane to outer [Escherichia coli O157:H7 str.
           EDL933]
 gi|26107317|gb|AAN79500.1|AE016758_104 Outer-membrane lipoproteins carrier protein precursor [Escherichia
           coli CFT073]
 gi|974728|dbj|BAA08390.1| lipoprotein carrier protein precursor [Escherichia coli]
 gi|1651413|dbj|BAA35616.1| chaperone for lipoproteins [Escherichia coli str. K12 substr.
           W3110]
 gi|13360435|dbj|BAB34399.1| periplasmic protein effects translocation of lipoproteins from
           inner membrane to outer [Escherichia coli O157:H7 str.
           Sakai]
 gi|24051118|gb|AAN42483.1| periplasmic protein [Shigella flexneri 2a str. 301]
 gi|30040624|gb|AAP16355.1| periplasmic protein [Shigella flexneri 2a str. 2457T]
 gi|73854926|gb|AAZ87633.1| periplasmic protein effects translocation of lipoproteins from
           inner membrane to outer [Shigella sonnei Ss046]
 gi|81241735|gb|ABB62445.1| periplasmic protein effects translocation of lipoproteins from
           inner membrane to outer [Shigella dysenteriae Sd197]
 gi|81244788|gb|ABB65496.1| LolA [Shigella boydii Sb227]
 gi|91071510|gb|ABE06391.1| outer membrane lipoproteins carrier protein precursor [Escherichia
           coli UTI89]
 gi|115512199|gb|ABJ00274.1| Outer-membrane lipoprotein carrier protein precursor [Escherichia
           coli APEC O1]
 gi|209775038|gb|ACI85831.1| periplasmic protein effects translocation of lipoproteins from
           inner membrane to outer [Escherichia coli]
 gi|209775040|gb|ACI85832.1| periplasmic protein effects translocation of lipoproteins from
           inner membrane to outer [Escherichia coli]
 gi|209775042|gb|ACI85833.1| periplasmic protein effects translocation of lipoproteins from
           inner membrane to outer [Escherichia coli]
 gi|209775044|gb|ACI85834.1| periplasmic protein effects translocation of lipoproteins from
           inner membrane to outer [Escherichia coli]
 gi|209775046|gb|ACI85835.1| periplasmic protein effects translocation of lipoproteins from
           inner membrane to outer [Escherichia coli]
 gi|209911399|dbj|BAG76473.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215264093|emb|CAS08435.1| chaperone for lipoproteins [Escherichia coli O127:H6 str. E2348/69]
 gi|218351096|emb|CAU96800.1| chaperone for lipoproteins [Escherichia coli 55989]
 gi|218355954|emb|CAQ88570.1| chaperone for lipoproteins [Escherichia fergusonii ATCC 35469]
 gi|218360245|emb|CAQ97795.1| chaperone for lipoproteins [Escherichia coli IAI1]
 gi|218364568|emb|CAR02254.1| chaperone for lipoproteins [Escherichia coli S88]
 gi|218370577|emb|CAR18384.1| chaperone for lipoproteins [Escherichia coli IAI39]
 gi|218426243|emb|CAR07068.1| chaperone for lipoproteins [Escherichia coli ED1a]
 gi|218431417|emb|CAR12295.1| chaperone for lipoproteins [Escherichia coli UMN026]
 gi|222032625|emb|CAP75364.1| Outer-membrane lipoprotein carrier protein [Escherichia coli LF82]
 gi|226898329|gb|EEH84588.1| periplasmic protein [Escherichia sp. 3_2_53FAA]
 gi|227838894|gb|EEJ49360.1| outer-membrane lipoprotein carrier protein [Escherichia coli 83972]
 gi|242376706|emb|CAQ31419.1| periplasmic chaperone, effects translocation of lipoproteins from
           inner membrane to outer [Escherichia coli BL21(DE3)]
 gi|253972906|gb|ACT38577.1| outer-membrane lipoprotein carrier protein precursor [Escherichia
           coli B str. REL606]
 gi|253977120|gb|ACT42790.1| outer-membrane lipoprotein carrier protein precursor [Escherichia
           coli BL21(DE3)]
 gi|257752831|dbj|BAI24333.1| chaperone IolA [Escherichia coli O26:H11 str. 11368]
 gi|257758288|dbj|BAI29785.1| chaperone IolA [Escherichia coli O103:H2 str. 12009]
 gi|257763419|dbj|BAI34914.1| chaperone IolA [Escherichia coli O111:H- str. 11128]
 gi|281178025|dbj|BAI54355.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|290761767|gb|ADD55728.1| Outer-membrane lipoprotein carrier protein precursor [Escherichia
           coli O55:H7 str. CB9615]
 gi|300300279|gb|EFJ56664.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 185-1]
 gi|300306962|gb|EFJ61482.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 200-1]
 gi|300318325|gb|EFJ68109.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 175-1]
 gi|300359651|gb|EFJ75521.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 198-1]
 gi|300405013|gb|EFJ88551.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 84-1]
 gi|300409624|gb|EFJ93162.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 45-1]
 gi|300411926|gb|EFJ95236.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 115-1]
 gi|300417446|gb|EFK00757.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 182-1]
 gi|300450863|gb|EFK14483.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 116-1]
 gi|300457345|gb|EFK20838.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 21-1]
 gi|300462472|gb|EFK25965.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 187-1]
 gi|300523830|gb|EFK44899.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 119-7]
 gi|300530359|gb|EFK51421.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 107-1]
 gi|300842341|gb|EFK70101.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 124-1]
 gi|300847429|gb|EFK75189.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 78-1]
 gi|301075439|gb|EFK90245.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 146-1]
 gi|308120950|gb|EFO58212.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 145-7]
 gi|309701167|emb|CBJ00467.1| outer membrane lipoprotein carrier protein [Escherichia coli ETEC
           H10407]
 gi|315135539|dbj|BAJ42698.1| outer-membrane lipoprotein carrier protein precursor [Escherichia
           coli DH1]
 gi|315257931|gb|EFU37899.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 85-1]
 gi|315287522|gb|EFU46933.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 110-3]
 gi|315291250|gb|EFU50610.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 153-1]
 gi|315296141|gb|EFU55450.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 16-3]
 gi|323155735|gb|EFZ41904.1| outer membrane lipocarrier protein LolA [Escherichia coli EPECa14]
 gi|324009814|gb|EGB79033.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 57-2]
 gi|324012981|gb|EGB82200.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 60-1]
 gi|324019018|gb|EGB88237.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 117-3]
 gi|331038210|gb|EGI10430.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           H736]
 gi|331050188|gb|EGI22246.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           M718]
 gi|331075367|gb|EGI46665.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           H591]
 gi|332104558|gb|EGJ07904.1| periplasmic protein [Shigella sp. D9]
          Length = 204

 Score = 74.5 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 23/205 (11%), Positives = 63/205 (30%), Gaps = 20/205 (9%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K +         +     +         +          + +   +F Q+        
Sbjct: 1   MMKKI-------AITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAA 53

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFS 114
               +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F 
Sbjct: 54  VQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFM 113

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +I  N     Q+   +   ++  +T    +  +              +  +  ++   + 
Sbjct: 114 LIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQR 171

Query: 175 SIIKILKYKENTVLDPKVFEIPYDK 199
           S  ++   ++N  +D   F     +
Sbjct: 172 SSYQLKS-QQNGAVDAAKFTFTPPQ 195


>gi|117920495|ref|YP_869687.1| outer membrane lipoprotein carrier protein LolA [Shewanella sp.
           ANA-3]
 gi|166230501|sp|A0KWW2|LOLA_SHESA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|117612827|gb|ABK48281.1| outer membrane lipoprotein carrier protein LolA [Shewanella sp.
           ANA-3]
          Length = 206

 Score = 74.5 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 26/192 (13%), Positives = 60/192 (31%), Gaps = 9/192 (4%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMA 69
              + +               K+  E     ++++  F Q              G F +A
Sbjct: 4   LLCAVLLSPLLYSNAVLADDAKQLRETLNGTESLKADFKQTVTDINKKVIQTGAGVFALA 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQES 127
            P++FY+  ++P    +++DG ++ +YN   +   +        +  +    ++     S
Sbjct: 64  HPNQFYWHLTAPDESQIVADGKDLWIYNPFAEEVVIMDFAEAINASPIALLVHRDDATWS 123

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
              V        I  K      + SV        L  + ++D     S   +      + 
Sbjct: 124 QYSVAKKQDCYEIKPKATDA-GISSVNVCFNKGTLNKFNVLDDKGNQSQFDLSNQHSISA 182

Query: 188 LDPKVFEIPYDK 199
            D  +F+    +
Sbjct: 183 ADKALFKFVLPE 194


>gi|156974087|ref|YP_001444994.1| outer-membrane lipoprotein carrier protein [Vibrio harveyi ATCC
           BAA-1116]
 gi|166230503|sp|A7MSW6|LOLA_VIBHB RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|156525681|gb|ABU70767.1| hypothetical protein VIBHAR_01798 [Vibrio harveyi ATCC BAA-1116]
          Length = 208

 Score = 74.5 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 22/202 (10%), Positives = 49/202 (24%), Gaps = 11/202 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV- 61
            K +    +  F + +  F+            +  +           F Q      G   
Sbjct: 1   MKKLFSAKL--FSALVLSFSLFSTAHAASPKDELNKRLSMNGGFSADFSQQVISPEGETV 58

Query: 62  --MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIF 117
              +G   +ARPS F +  +SP    L+SDG  +  Y+  ++                + 
Sbjct: 59  MEGEGTVEIARPSLFRWSTTSPDENLLVSDGKTLWYYSPFIEQVSIYWQEQATEQTPFVL 118

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                       ++       T+                     +  + +++   +  + 
Sbjct: 119 LTRNRASDWDNYKISQKGDQFTLIPTAVDSTQGQFQINIDAKGVVKGFNVVEQDGQKGLF 178

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
                K         F      
Sbjct: 179 TFNNVKLGKP-KADRFTFTIPN 199


>gi|145588876|ref|YP_001155473.1| outer membrane lipoprotein carrier protein LolA [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145047282|gb|ABP33909.1| outer membrane lipoprotein carrier protein LolA [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 227

 Score = 74.5 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 28/221 (12%), Positives = 70/221 (31%), Gaps = 29/221 (13%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE--------- 56
            + +   + +   S +    A      +   ++  +   + +T +G F+Q+         
Sbjct: 1   MQRLFSALAIGIASILISNVAI--AEGESGSEQLRQFVRNSKTAEGDFVQQQLRAPKANE 58

Query: 57  --DAG----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY 110
             D G       +G+F   RP +F +    P    LI++G+ + +++  L+  +  P   
Sbjct: 59  PQDKGLKVVRQTQGQFVFQRPGRFVWDTQKPYEQKLITNGTQLILWDKDLNQATFRPAGQ 118

Query: 111 ----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGN--------MISVTFDRL 158
                  +++F  +       +   E       +        N           ++    
Sbjct: 119 ALASTPAAILFGESSLDQHFELIDGEERLGMKWVALVPKKDPNAKNQNDLPYTKISIGMT 178

Query: 159 SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           +      +++D      ++ +   K N  L    F     K
Sbjct: 179 NGLPKALELIDGLGSVVLVTLDNIKLNVNLPANRFNFIPPK 219


>gi|16764322|ref|NP_459937.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|205352169|ref|YP_002225970.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|207856353|ref|YP_002243004.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|16419473|gb|AAL19896.1| periplasmic protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|205271950|emb|CAR36794.1| outer membrane lipoprotein carrier protein precursor [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|206708156|emb|CAR32449.1| outer membrane lipoprotein carrier protein precursor [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|261246178|emb|CBG23982.1| outer membrane lipoprotein carrier protein precursor [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           D23580]
 gi|267992694|gb|ACY87579.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301157505|emb|CBW16995.1| outer membrane lipoprotein carrier protein precursor [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|322659226|gb|EFY55475.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|323129227|gb|ADX16657.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|323191718|gb|EFZ76972.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323215846|gb|EGA00586.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323229820|gb|EGA13943.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323233045|gb|EGA17141.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|326622638|gb|EGE28983.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
 gi|326627213|gb|EGE33556.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
 gi|332987853|gb|AEF06836.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 204

 Score = 74.5 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 26/205 (12%), Positives = 65/205 (31%), Gaps = 20/205 (9%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K +         +     +         +          + +   TF Q+        
Sbjct: 1   MMKKM-------AIACALLSSVVASSVWADAASSLKSRLDKVSSFHATFTQKVTDGSGAA 53

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFS 114
               +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F 
Sbjct: 54  VQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFM 113

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +I  N     Q+   + + +N  +T    +  +              +  +  ++   + 
Sbjct: 114 LIARNQASDWQQYNIKQDGDNFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQR 171

Query: 175 SIIKILKYKENTVLDPKVFEIPYDK 199
           S  ++   ++N  +DP  F     +
Sbjct: 172 SAYQLKS-QQNGAVDPSKFTFTPPQ 195


>gi|311745583|ref|ZP_07719368.1| outer membrane lipoprotein carrier protein LolA [Algoriphagus sp.
           PR1]
 gi|126578144|gb|EAZ82364.1| outer membrane lipoprotein carrier protein LolA [Algoriphagus sp.
           PR1]
          Length = 217

 Score = 74.5 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 22/207 (10%), Positives = 53/207 (25%), Gaps = 12/207 (5%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-----AG 59
           + K  +   I+F         A       + +    + + S++    +F          G
Sbjct: 1   MKKIALVFTIVFAAFITLDAAAQKDPKAKEVLDGMSQKYQSMKGFTASFDYTYSDIAGTG 60

Query: 60  YVMKGEFF-------MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA 112
               GE         +  P +  F         + +        N             + 
Sbjct: 61  DRQSGEIAVKGNQYRLKLPDQEIFNDGKTVWTFIETSTYKEVTINDVSQMEGELTPSNIY 120

Query: 113 FSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSR 172
                  +  ++ +   + ++ N       K +     + +  D+ +  LL W++ D   
Sbjct: 121 KMYEKGYDYKLLADKSYQGKTANVVELEAEKSNAPFQKVKLMIDKNTKDLLGWEMFDDQG 180

Query: 173 RYSIIKILKYKENTVLDPKVFEIPYDK 199
                     K +  +    F     K
Sbjct: 181 GTFAYAFKNLKADPNIPDSHFVFDTKK 207


>gi|91204861|ref|YP_537216.1| Outer membrane lipoprotein-sorting protein LolA [Rickettsia bellii
           RML369-C]
 gi|157826507|ref|YP_001495571.1| Outer membrane lipoprotein-sorting protein LolA [Rickettsia bellii
           OSU 85-389]
 gi|91068405|gb|ABE04127.1| Outer membrane lipoprotein-sorting protein LolA [Rickettsia bellii
           RML369-C]
 gi|157801811|gb|ABV78534.1| Outer membrane lipoprotein-sorting protein LolA [Rickettsia bellii
           OSU 85-389]
          Length = 214

 Score = 74.5 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 25/196 (12%), Positives = 77/196 (39%), Gaps = 4/196 (2%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKG 64
            K +  ++I+  ++      AA+      ++ +   +  +++++   F QED  G +++G
Sbjct: 1   MKKIFFLIIVCIFT---NSIAAFGSDDKAAILELKTYLRTMKSIAVDFTQEDSKGNIVQG 57

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
           +  +++P  F   Y  P  + ++   + +++Y+  ++  S        F+ +  +N++  
Sbjct: 58  KLLISKPYNFRCNYYPPFPIIIVGTKNFVSMYDYDMEQVSRIARDENIFNFLLEDNENFD 117

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           ++ +     N    +       +    S      + + +    +        IK     +
Sbjct: 118 KDFVVESVVNEKEFSRINIYHKVTERHSEITLNKANKQIELLKIFEDTNVVTIKFDNIVK 177

Query: 185 NTVLDPKVFEIPYDKI 200
               D  +F++   +I
Sbjct: 178 VQKFDEDLFKLKNPEI 193


>gi|194435160|ref|ZP_03067393.1| outer membrane lipoprotein carrier protein LolA [Shigella
           dysenteriae 1012]
 gi|194416598|gb|EDX32734.1| outer membrane lipoprotein carrier protein LolA [Shigella
           dysenteriae 1012]
          Length = 204

 Score = 74.5 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 23/205 (11%), Positives = 64/205 (31%), Gaps = 20/205 (9%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K +         +     +         +          + +   +F Q+        
Sbjct: 1   MMKKI-------AITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAA 53

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFS 114
               +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F 
Sbjct: 54  VQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFM 113

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +I  N     Q+   +   ++  +T    +  +           +  +  +  ++   + 
Sbjct: 114 LIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGCDGT--IHQFSAVEQDDQR 171

Query: 175 SIIKILKYKENTVLDPKVFEIPYDK 199
           S  ++   ++N  +D   F     +
Sbjct: 172 SSYQLKS-QQNGAVDAAKFTFTPPQ 195


>gi|224582771|ref|YP_002636569.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|224467298|gb|ACN45128.1| outer-membrane lipoprotein carrier protein precursor [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
          Length = 204

 Score = 74.5 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 26/205 (12%), Positives = 65/205 (31%), Gaps = 20/205 (9%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K +         +     +         +          + +   TF Q+        
Sbjct: 1   MMKKM-------AIACALLSSVVASSVWADAASSLKSRLDKVSSFHATFTQKVTDGSGAA 53

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFS 114
               +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F 
Sbjct: 54  VQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQVTATWLKDATGNTPFM 113

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +I  N     Q+   + + +N  +T    +  +              +  +  ++   + 
Sbjct: 114 LIARNQASDWQQYNIKQDGDNFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQR 171

Query: 175 SIIKILKYKENTVLDPKVFEIPYDK 199
           S  ++   ++N  +DP  F     +
Sbjct: 172 SAYQLKS-QQNGAVDPSKFTFTPPQ 195


>gi|304311213|ref|YP_003810811.1| Outer-membrane lipoprotein carrier protein [gamma proteobacterium
           HdN1]
 gi|301796946|emb|CBL45159.1| Outer-membrane lipoprotein carrier protein [gamma proteobacterium
           HdN1]
          Length = 226

 Score = 74.5 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 56/183 (30%), Gaps = 13/183 (7%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSPSS 83
           +  +Q V   +     +++   TF Q  +         + G  ++ RP  F +  + P  
Sbjct: 36  LASEQGVTGLVRDLSMMKSFNATFHQWVSDAQNHVLQEVTGTMWVQRPGLFRWDTNDPYP 95

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIF-------SNNQHVIQESIQRVESNNS 136
             +ISDG  + +Y+  L+  +   L     +                        E    
Sbjct: 96  QQIISDGEVLWIYDLDLEQATKRKLDKQVGNTPALLLSGDPEKLAESFTVRASMYEETGE 155

Query: 137 FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
                           +     S ++ +  + D+  + + I+      N  +D KVF   
Sbjct: 156 VRYDLIPKHKGALFELLRVHFRSGKIHDMFLRDNLGQTTRIEFETKAFNKPIDAKVFAFK 215

Query: 197 YDK 199
             K
Sbjct: 216 PPK 218


>gi|298529602|ref|ZP_07017005.1| outer membrane lipoprotein carrier protein LolA
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298511038|gb|EFI34941.1| outer membrane lipoprotein carrier protein LolA
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 212

 Score = 74.5 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 17/193 (8%), Positives = 58/193 (30%), Gaps = 13/193 (6%)

Query: 23  PFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYF 76
            F      +  + V +  +   +++ ++  ++Q              G  +  +P +  +
Sbjct: 14  CFALPATASDQEVVDRVQDRLDALEGLKADYVQILTNAATKETQERTGSIYFKKPLQVRW 73

Query: 77  KYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAFSVIFSNNQHVIQESIQRV 131
           +  +P    L+ D   +  Y    +    Y +          + I    +      ++  
Sbjct: 74  EADAPHQELLVIDQDKVWNYFPDDEVAYEYEVEEVLTSRAMINFISGQAKLTEDFQVEEQ 133

Query: 132 ESNNSFITIFFKDDFMGNMISVTF--DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLD 189
              +    +          + + +        L    ++D     + +++   + +  LD
Sbjct: 134 GMEDGLHKLKLVPASPEPDLVLAYLWSDDQGLLHRILLVDFFGNGNELRLESMETDPELD 193

Query: 190 PKVFEIPYDKIHN 202
            + FE   + +  
Sbjct: 194 REKFEFSPEDVEI 206


>gi|315126410|ref|YP_004068413.1| periplasmic chaperone effects translocation of lipoproteins from
           inner membrane to outer membrane [Pseudoalteromonas sp.
           SM9913]
 gi|315014924|gb|ADT68262.1| periplasmic chaperone effects translocation of lipoproteins from
           inner membrane to outer membrane [Pseudoalteromonas sp.
           SM9913]
          Length = 208

 Score = 74.1 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 23/176 (13%), Positives = 55/176 (31%), Gaps = 10/176 (5%)

Query: 33  DQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------GEFFMARPSKFYFKYSSPSSVSL 86
               +   +   ++++ +  F Q       +      G   + +P    ++ ++P     
Sbjct: 21  ADDSQALQDKLSTLKSFKAQFKQNVTDGEGQLVMQGQGNIALQQPLMIRWQQTNPDDTLF 80

Query: 87  ISDGSNIAVYN----AKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFF 142
           +S+G     ++          +   +    F ++ S +    ++           IT   
Sbjct: 81  VSNGDKTYYFDSFAEQVTIMKTSGLIDSTPFILLTSKDPAQWEKYSVIATDLGFSITPNK 140

Query: 143 KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
             +     + +TF      L    + D+S + S       + NT LD   FE    
Sbjct: 141 GVESQVEQLDITFADNEQGLAKLVVKDNSGQLSAFTFSNAQVNTELDKTTFEFTPP 196


>gi|113970301|ref|YP_734094.1| outer membrane lipoprotein carrier protein LolA [Shewanella sp.
           MR-4]
 gi|122943832|sp|Q0HIT0|LOLA_SHESM RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|113884985|gb|ABI39037.1| outer membrane lipoprotein carrier protein LolA [Shewanella sp.
           MR-4]
          Length = 206

 Score = 74.1 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 26/192 (13%), Positives = 59/192 (30%), Gaps = 9/192 (4%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMA 69
              + +               K+  E     ++++  F Q              G F +A
Sbjct: 4   LLCAVLLSPLLYSNAVLADDAKQLRETLNGTESLKADFKQTVTDINKKVIQTGAGVFALA 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQES 127
            P++FY+  ++P    +++DG ++ +YN   +   +        +  +    ++     S
Sbjct: 64  HPNQFYWHLTAPDESQIVADGKDLWIYNPFAEEVVIMDFAEAINASPIALLVHRDDATWS 123

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
              V        I  K      + SV        L  + ++D     S   +        
Sbjct: 124 QYSVTKKQDCYEIKPKSTDA-GITSVNVCFNKGTLNKFNVLDDKGNLSQFDLSNQHSINA 182

Query: 188 LDPKVFEIPYDK 199
            D  +F+    +
Sbjct: 183 ADKALFKFVLPE 194


>gi|149928210|ref|ZP_01916455.1| outer-membrane lipoprotein carrier protein precursor [Limnobacter
           sp. MED105]
 gi|149823101|gb|EDM82341.1| outer-membrane lipoprotein carrier protein precursor [Limnobacter
           sp. MED105]
          Length = 211

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 57/192 (29%), Gaps = 11/192 (5%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARP 71
             A+     A       +         +    +G F Q              GEF  +RP
Sbjct: 11  LMALLISTGAVGSAWASAQDALNNFVKNRGFAEGQFSQVVISPSGAVKQRGTGEFTFSRP 70

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFSNNQHVIQE 126
            KF ++   P  + L+S+GS++  Y+  +   +  P+           +  S +   +  
Sbjct: 71  GKFRWEIKKPYPLLLLSNGSSVVSYDEDMGHATQKPIGNAMDSTPVALLFGSKDVDKLFN 130

Query: 127 SIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
                  +     +    D                 +N +I D+  + + +++  +  + 
Sbjct: 131 LKDEGMKDGKEWLVIRPKDKDSLFDYARIGWKDGLPVNLEIHDALGQVTQLELSNWDFSK 190

Query: 187 VLDPKVFEIPYD 198
                 F+    
Sbjct: 191 QRPAGFFDFKAP 202


>gi|33152331|ref|NP_873684.1| outer-membrane lipoprotein carrier protein [Haemophilus ducreyi
           35000HP]
 gi|47117173|sp|Q7VLZ6|LOLA_HAEDU RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|33148554|gb|AAP96073.1| outer membrane lipoprotein carrier protein [Haemophilus ducreyi
           35000HP]
          Length = 210

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/208 (12%), Positives = 67/208 (32%), Gaps = 13/208 (6%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK- 63
           + K +   ++    + +F   ++      QS+ +       +      F Q       + 
Sbjct: 1   MKKRIQKTIL----TVLFSSLSSIAFADMQSIAELQRRLEHVAQYSADFEQTVRSSKGQQ 56

Query: 64  -----GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VI 116
                G+F + RP+ F    ++P    ++SDG N+  Y+  +   +V  ++        +
Sbjct: 57  IQSGRGKFQVKRPNLFRMDINAPQENVIVSDGENLWFYDPFVAQVTVNSVQNAVNGTPFV 116

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
              +      +   V  N     +  K               +  L  +  ++   + ++
Sbjct: 117 LLTSSDKQHWTQYEVTQNADTFVLKPKSAKNNLRQFDVQIDQNGLLKGFSTIERDGQTNL 176

Query: 177 IKILKYKENTVLDPKVFEIPYDKIHNIN 204
            ++        L   +F+    K   ++
Sbjct: 177 YRLRNITT-ADLSADLFKFSVPKDVEVD 203


>gi|148828419|ref|YP_001293172.1| outer-membrane lipoprotein carrier protein [Haemophilus influenzae
           PittGG]
 gi|148719661|gb|ABR00789.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           influenzae PittGG]
          Length = 185

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/175 (10%), Positives = 51/175 (29%), Gaps = 9/175 (5%)

Query: 33  DQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSPSSVSL 86
             +  +       +  +   F+Q              G+  + RP+ F  +  +P    +
Sbjct: 2   ADAASELQMRLAKVDVLSAEFVQTVTSGSGKNVQQGSGKLQIKRPNLFRMETKTPQETQI 61

Query: 87  ISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRVESNNSFITIFFKD 144
           ISDG  +  Y+  +   +   ++    +   +   +          V        +    
Sbjct: 62  ISDGKTLWFYDPFVQQVTAQWVKDAVNNTPFVLLTSNDHSHWHQYTVTQQADTFVLKPTL 121

Query: 145 DFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                        ++  L N+   +   + ++  +     N  L   +F+   +K
Sbjct: 122 STSNIKQFDIRVDVNGILRNFSTTEKDGQTNLYVLRNI-TNQTLSDSLFQFKPEK 175


>gi|331672432|ref|ZP_08373222.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           TA280]
 gi|331070338|gb|EGI41703.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           TA280]
          Length = 204

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/205 (11%), Positives = 63/205 (30%), Gaps = 20/205 (9%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K +         +     +         +          + +   +F Q+        
Sbjct: 1   MMKKI-------AITCALLSSLVASRVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAA 53

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFS 114
               +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F 
Sbjct: 54  VQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFM 113

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +I  N     Q+   +   ++  +T    +  +              +  +  ++   + 
Sbjct: 114 LIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQR 171

Query: 175 SIIKILKYKENTVLDPKVFEIPYDK 199
           S  ++   ++N  +D   F     +
Sbjct: 172 SSYQLKS-QQNGAVDAAKFTFTPPQ 195


>gi|300716071|ref|YP_003740874.1| outer-membrane lipoprotein carrier protein [Erwinia billingiae
           Eb661]
 gi|299061907|emb|CAX59023.1| Outer-membrane lipoprotein carrier protein [Erwinia billingiae
           Eb661]
          Length = 203

 Score = 73.8 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/204 (14%), Positives = 67/204 (32%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K ++    L           A       +     +    +++   +F Q+         
Sbjct: 1   MKKLLISCCLLTAF-------ASASVLADASSDLQQRLDKVKSFHASFTQKVTDGSGQSV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +GE ++ RP+ F +  ++P    LISDG  +  YN  ++  S            F +
Sbjct: 54  QDGEGELWVKRPNLFNWHMTAPDESVLISDGKTLWFYNPFVEQVSATWLKDATSNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  N     ++   + + +N  +T    D  +           +     +  ++   + S
Sbjct: 114 IARNQGSDWKQYNIKQQGDNFDLTPKSTDGNLKQFTINVSTNGTIN--QFSAVEQDGQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
              +   ++N  ++   F+    K
Sbjct: 172 SYALKS-QQNGAVEASKFQFTPPK 194


>gi|242278009|ref|YP_002990138.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           salexigens DSM 2638]
 gi|242120903|gb|ACS78599.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           salexigens DSM 2638]
          Length = 210

 Score = 73.8 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 69/207 (33%), Gaps = 19/207 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----- 60
              V   ++L F   +   + A    +   +K+      SI+++   F Q+         
Sbjct: 1   MAIVKKTILLTFLLLVISASNAIADRQSDFLKELQTRSQSIKSISSDFTQQSHITLFAEV 60

Query: 61  -VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS----- 114
              KG+F  ARP+   ++Y++P     +  G     ++      + +             
Sbjct: 61  MEAKGKFCFARPNNLRWEYTAPFVSGFLLKGQKGLKWDGASKESTQFNTETSPEMAIISE 120

Query: 115 --VIFSNNQHVIQESIQRVESNNS------FITIFFKDDFMGNMISVTFDRLSYRLLNWK 166
             + ++       +S+  ++  N             K     N+I + F      L + +
Sbjct: 121 QILAWTTMDIPWLQSLYSIKVTNYSPAVMELTPKSSKTKHFLNLIRIFFAPDETHLESIE 180

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVF 193
           + + S  Y+ I       N  LD  +F
Sbjct: 181 LHEPSGDYTKIIFSNVLLNQKLDQDIF 207


>gi|62179485|ref|YP_215902.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|62127118|gb|AAX64821.1| periplasmic protein effects translocation of lipoproteins from
           inner membrane to outer membrane [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|322713954|gb|EFZ05525.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
          Length = 204

 Score = 73.8 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/203 (10%), Positives = 60/203 (29%), Gaps = 16/203 (7%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K +         +     +         +          + +   TF Q+        
Sbjct: 1   MMKKM-------AIACALLSSVVASSVWADAASSLKSRLDKVSSFHATFTQKVTDGSDAA 53

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VI 116
               +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +   L+    +   +
Sbjct: 54  VQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQVTATWLKDATGNTPFM 113

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
                         ++ +     +  K                  +  +  ++   + S 
Sbjct: 114 LIARNQASDWQQYNIKQDGDNFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSA 173

Query: 177 IKILKYKENTVLDPKVFEIPYDK 199
            ++   ++N  +DP  F     +
Sbjct: 174 YQLKS-QQNGAVDPSKFTFTPPQ 195


>gi|15893258|ref|NP_360972.1| hypothetical protein RC1335 [Rickettsia conorii str. Malish 7]
 gi|15620478|gb|AAL03873.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 212

 Score = 73.8 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 84/197 (42%), Gaps = 6/197 (3%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKG 64
            K +  ++I++ +      + A+      ++ +   +   I+++   F QED+ G ++KG
Sbjct: 1   MKKIFFLIIIYLF---VNSSLAFGADDKTAISELKTYLRKIKSVAIDFTQEDSYGKIVKG 57

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
           +  + +P  F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N+H+ 
Sbjct: 58  KLLIHKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENTFNFLLEDNEHLD 117

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMIS-VTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
           ++ +     N   I+       +    S +TF++ + ++   KI +       I   K  
Sbjct: 118 KDFVFEAVINARNISKITIYHTLTEKRSEITFNKATQQIEALKIFE-DNNIVTITFDKIA 176

Query: 184 ENTVLDPKVFEIPYDKI 200
           +       +F+I   +I
Sbjct: 177 KVQKFSDDLFKIKNPEI 193


>gi|157829165|ref|YP_001495407.1| hypothetical protein A1G_07300 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933894|ref|YP_001650683.1| hypothetical protein RrIowa_1560 [Rickettsia rickettsii str. Iowa]
 gi|157801646|gb|ABV76899.1| hypothetical protein A1G_07300 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908981|gb|ABY73277.1| hypothetical protein RrIowa_1560 [Rickettsia rickettsii str. Iowa]
          Length = 212

 Score = 73.8 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 83/197 (42%), Gaps = 6/197 (3%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKG 64
            K +  ++I++ +      + A+      ++ +   +   I+++   F QED+ G ++KG
Sbjct: 1   MKKIFFLIIIYLF---VNSSLAFGADDKTAISELKTYLRKIKSVAIDFTQEDSYGKIVKG 57

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
           +  + +P  F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N+H  
Sbjct: 58  KLLIHKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENTFNFLLEDNEHFD 117

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMIS-VTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
           ++ +     N   I+       +    S +TF++ + ++   KI +       I   K  
Sbjct: 118 KDFVFEAVINARNISKITIYHTLTEKRSEITFNKATQQIEALKIFE-DNNIVTITFDKIA 176

Query: 184 ENTVLDPKVFEIPYDKI 200
           +       +F+I   +I
Sbjct: 177 KVQKFSDDLFKIKNPEI 193


>gi|153835804|ref|ZP_01988471.1| outer membrane lipoprotein carrier protein LolA [Vibrio harveyi
           HY01]
 gi|148867451|gb|EDL66840.1| outer membrane lipoprotein carrier protein LolA [Vibrio harveyi
           HY01]
          Length = 208

 Score = 73.8 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/202 (9%), Positives = 48/202 (23%), Gaps = 11/202 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +    +  F + +  F+            +  +           F Q+         
Sbjct: 1   MKKLFSAKL--FSALVLSFSLFSTAHAASPKDELNKRLSMNDGFSADFSQQVISPEGETV 58

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIF 117
              +G   +ARPS F +  + P    L+SDG  +  Y+  ++                + 
Sbjct: 59  MEGEGTVEIARPSLFRWSTTFPDENLLVSDGKTLWYYSPFIEQVSIYWQEQATEQTPFVL 118

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                       ++       T+                     +  + +++   +  + 
Sbjct: 119 LTRNRASDWDNYKISQKGDQFTLIPTAVDSTQGQFQINIDAKGVVKGFNVVEQDGQKGLF 178

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
                K         F      
Sbjct: 179 TFNNVKLGKP-KADRFTFTIPN 199


>gi|78356999|ref|YP_388448.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
 gi|78219404|gb|ABB38753.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
          Length = 224

 Score = 73.8 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/199 (11%), Positives = 48/199 (24%), Gaps = 13/199 (6%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM------KGEF 66
           ++   +                +V    +   S  + +  F+Q             +G  
Sbjct: 6   ILTIVFFIAALALTGQAAAAPDAVAALEKKVRSYTSFKADFVQTLTHRQSGTTETRQGSI 65

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAFSVIFSNNQ 121
              +P    ++   PS   ++   S +  Y    +    YPL            I     
Sbjct: 66  IFRKPDSLRWETVHPSRELIVVTDSAVWNYIPDEEVAYKYPLDILKDSDTIMRFITGRAN 125

Query: 122 HVIQESIQRVESNNSFITIFFKDDFMGN--MISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
                 I+  E   S     +            +  D  S  L    + D     ++++ 
Sbjct: 126 LDSDFEIEVEEEQGSTRIHLYPYHPQQTLTEAVLWVDTQSGELKKVAVTDFYGNENMLEF 185

Query: 180 LKYKENTVLDPKVFEIPYD 198
              + +       F     
Sbjct: 186 SDMQFDIESGTDSFRFSPP 204


>gi|167624140|ref|YP_001674434.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           halifaxensis HAW-EB4]
 gi|189028560|sp|B0TUP7|LOLA_SHEHH RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|167354162|gb|ABZ76775.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           halifaxensis HAW-EB4]
          Length = 208

 Score = 73.8 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/197 (13%), Positives = 62/197 (31%), Gaps = 13/197 (6%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +  +  L           ++      +  +       I +++  F Q          
Sbjct: 1   MKKIFAIAALSLPLF------SHFPAFAGASDELKVKLTEISSLKANFNQTVTDINDKVI 54

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
              +G F ++ P++FY+  ++P    +++DG+++ +YN   +  SV  L     +   + 
Sbjct: 55  QTGEGVFALSHPNQFYWHLTAPDESLIVADGTDVWIYNPFAEEVSVMDLNQAINASPIAL 114

Query: 120 NQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
             H   E+  +   +           D       V       +L    + D     S   
Sbjct: 115 LVHSDDETWSQYNVSQKENCFDISPKDKDSGGSEVQVCFNDNQLTKMVLKDQQGNISDFT 174

Query: 179 ILKYKENTVLDPKVFEI 195
           +         D  +F+ 
Sbjct: 175 LTNQSVIAGKDQDLFKF 191


>gi|317402129|gb|EFV82721.1| outer-membrane lipoprotein carrier protein [Achromobacter
           xylosoxidans C54]
          Length = 211

 Score = 73.8 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/203 (13%), Positives = 57/203 (28%), Gaps = 11/203 (5%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYVM-- 62
                +       + P  A        + ++      ++    GTF Q      G     
Sbjct: 2   KTFRGLAAGLALCMAPALAPTAAVAATAQEQLRAFVSTVTAATGTFSQYTVSTQGRTQPA 61

Query: 63  -KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIF 117
             G F   RP KF +    P    +ISDG  +  ++  L   +   +         +++F
Sbjct: 62  QTGVFSFQRPGKFKWAVQKPYDQLVISDGKQVFQFDPDLAQVTERKVDAAIGTSPAAILF 121

Query: 118 SNNQHVIQESIQRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
            +        +  + S +                  V         +  +++DS  + + 
Sbjct: 122 GSGSLEQSFDVSALPSKDGVDWLRAKPRTADAGFSRVDIGMKDNLPVRVELLDSFGQTTR 181

Query: 177 IKILKYKENTVLDPKVFEIPYDK 199
           + +     N  L    F     K
Sbjct: 182 VDLSGIVPNPKLGEGEFRFVAPK 204


>gi|239948371|ref|ZP_04700124.1| outer membrane lipoprotein-sorting protein LolA [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239922647|gb|EER22671.1| outer membrane lipoprotein-sorting protein LolA [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 212

 Score = 73.8 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 85/197 (43%), Gaps = 6/197 (3%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKG 64
            K +  ++I++ +      N A+      ++ +   +  +I+++   F QED+ G ++KG
Sbjct: 1   MKKIFFLIIIYLF---VNSNLAFGAGDKTAISELKTYLRTIKSVVIDFTQEDSYGKIVKG 57

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
           +  + +P  F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N+H  
Sbjct: 58  KLLIHKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSKNTFNFLLEDNEHFD 117

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMIS-VTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
           ++ +     N   I+       +    S +TF++ + ++   KI +  +    I   K  
Sbjct: 118 KDFVFESVVNEGNISKITIYHTLTEKRSEITFNKATKQIEALKIFE-DKNIITITFDKIA 176

Query: 184 ENTVLDPKVFEIPYDKI 200
           +       +F++   +I
Sbjct: 177 KVQKFSDDLFKLKNPEI 193


>gi|218885474|ref|YP_002434795.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           vulgaris str. 'Miyazaki F']
 gi|218756428|gb|ACL07327.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           vulgaris str. 'Miyazaki F']
          Length = 233

 Score = 73.8 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/180 (11%), Positives = 50/180 (27%), Gaps = 14/180 (7%)

Query: 34  QSVKKAIEHFLSIQTMQGTFLQEDAGYVM------KGEFFMARPSKFYFKYSSPSSVSLI 87
           +   +  + + +  T++  F Q             +G     +P    ++  +P +  L+
Sbjct: 35  ELTNRLQQRYDATTTLKADFTQVLLHRESGARETRQGTLQFRKPLLVRWETKAPHAELLV 94

Query: 88  SDGSNIAVYNAKLDTWSVYPLR-----YMAFSVIFSNNQHVIQESIQRVESNNSFITIFF 142
              + I  Y    +    YP+           VI    +      +     +N    +  
Sbjct: 95  VTAAEIWNYLPDEEVAYKYPVELVQDSRSIIKVITGQAKLEQDFDVAEEADDNGMARLHM 154

Query: 143 KDDFMG---NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                        +  D  +  +   KI+D     + I +     +  +    F     K
Sbjct: 155 YPKEPTPQLTEAFLWVDPNTNLIRRAKIIDFYGNENNITLNSLATDAGVQDSAFRFAPPK 214


>gi|167854724|ref|ZP_02477503.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           parasuis 29755]
 gi|219870512|ref|YP_002474887.1| outer-membrane lipoprotein carrier protein [Haemophilus parasuis
           SH0165]
 gi|254809231|sp|B8F3N7|LOLA_HAEPS RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|167854138|gb|EDS25373.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           parasuis 29755]
 gi|219690716|gb|ACL31939.1| outer-membrane lipoprotein carrier protein precursor [Haemophilus
           parasuis SH0165]
          Length = 209

 Score = 73.8 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/202 (11%), Positives = 57/202 (28%), Gaps = 12/202 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK-- 63
            K+++   +L            +     Q+V +  +           F Q       K  
Sbjct: 1   MKNLLKKSLLGLAFLSL---NGFAFADAQAVAELQQRLDKAMQYSADFEQTVRSSKGKEI 57

Query: 64  ----GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G+F + RP+ F     SP    ++SDG  +  Y+  +   +   ++    +   + 
Sbjct: 58  QKGQGKFQVKRPNLFRMDTQSPQENLIVSDGKTLWFYDPFVSQVTANWVKDAVSNTPFVL 117

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             +          V  N     +  K               +  +  +  ++   + ++ 
Sbjct: 118 LTSNDKSHWDQYDVTQNVDNFVLKPKSKKSAIKQFDIRIDATGLVKGFSTIERDGQSNLY 177

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +        L   +F     K
Sbjct: 178 VLRNIST-AHLSESLFSFSVPK 198


>gi|239907032|ref|YP_002953773.1| outer membrane lipoprotein carrier protein precursor [Desulfovibrio
           magneticus RS-1]
 gi|239796898|dbj|BAH75887.1| outer membrane lipoprotein carrier protein precursor [Desulfovibrio
           magneticus RS-1]
          Length = 226

 Score = 73.4 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 21/187 (11%), Positives = 48/187 (25%), Gaps = 16/187 (8%)

Query: 33  DQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSPSSVSL 86
            Q   +  + + ++      F Q              G F   +P+   ++   P    L
Sbjct: 27  AQLAGRIQKKYAALTAFSAEFSQAIRNAASGETEQRSGSFVFKKPTLVRWETVKPEKELL 86

Query: 87  ISDGSNIAVYNAKLDTWSVY-----PLRYMAFSVIFSNNQHVIQESIQRVESNNS----- 136
           I     +  Y  +      Y              +           +   +         
Sbjct: 87  IVGKDAVWDYFEEDKEAYRYAVEEIINSKTMLRFLTGKANLTEDFVVSAAKDEAGPSEAA 146

Query: 137 FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
            + +  + +    M  V  D  +  ++   I D     + +K+ K   +  L   +F   
Sbjct: 147 LLLVPREPEPGLVMAKVWVDTTTDMIVRIYIQDFYANTNDLKLAKIVADPKLSDSLFAFT 206

Query: 197 YDKIHNI 203
             K   +
Sbjct: 207 PPKDAKV 213


>gi|325496836|gb|EGC94695.1| outer-membrane lipoprotein carrier protein [Escherichia fergusonii
           ECD227]
          Length = 204

 Score = 73.4 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/205 (11%), Positives = 63/205 (30%), Gaps = 20/205 (9%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K +         +     +         +          + +   +F Q+        
Sbjct: 1   MMKKI-------AITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAA 53

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFS 114
               +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F 
Sbjct: 54  VQEGQGDLWVKRPNLFNWYMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFM 113

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +I  N     Q+   +   ++  +T    +  +              +  +  ++   + 
Sbjct: 114 LIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQR 171

Query: 175 SIIKILKYKENTVLDPKVFEIPYDK 199
           S  ++   ++N  +D   F     +
Sbjct: 172 SSYQLKS-QQNGAVDAAKFTFTPPQ 195


>gi|269967797|ref|ZP_06181844.1| outer-membrane lipoprotein carrier protein precursor [Vibrio
           alginolyticus 40B]
 gi|269827617|gb|EEZ81904.1| outer-membrane lipoprotein carrier protein precursor [Vibrio
           alginolyticus 40B]
          Length = 208

 Score = 73.4 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 21/202 (10%), Positives = 50/202 (24%), Gaps = 11/202 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +    +  F + +  F+            +  +           F Q+         
Sbjct: 1   MKKLFSAKL--FSALVLSFSLFSTAHAASPKDELNKRLSMNDGFSADFSQQVISPEGETV 58

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIF 117
              +G   +ARPS F +  + P    L+SDG  +  Y+  ++                + 
Sbjct: 59  MEGEGTVEIARPSLFRWSTTFPDENLLVSDGKTLWYYSPFIEQVSIYWQEQATEQTPFVL 118

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                    +  ++       T+                     +  + +++   +  + 
Sbjct: 119 LTRNRASDWNNYKISQKGDQFTLIPTAVDSTQGQFQINIDAKGVVKGFNVVEQDGQKGLF 178

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
                K         F     K
Sbjct: 179 TFNNVKLGKP-KADRFTFTIPK 199


>gi|260913896|ref|ZP_05920370.1| outer membrane lipoprotein carrier protein LolA [Pasteurella
           dagmatis ATCC 43325]
 gi|260631983|gb|EEX50160.1| outer membrane lipoprotein carrier protein LolA [Pasteurella
           dagmatis ATCC 43325]
          Length = 205

 Score = 73.4 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/203 (10%), Positives = 58/203 (28%), Gaps = 16/203 (7%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K ++    LF  +               +  +       +  +  T+ Q  +      
Sbjct: 1   MKKMLVKSTALFIATF-------STFAWADAASELQMRLSKVDELSATYTQTVSSVEGKK 53

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VI 116
                G   + RP+ F      P    +ISDG+ +  Y+  +   +   ++    +   +
Sbjct: 54  VQDGSGTLKIKRPNLFRMDNQVPQETQIISDGNTLWFYDPFVAQVTASWVKDAVNNTPFV 113

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
              +      +   VE       +  K                  L ++  ++   + ++
Sbjct: 114 LLTSSDKSHWAQYDVEQKADTFVLKPKAKNSNLRQFDIRIDSEGVLRHFSTIEKDGQSNL 173

Query: 177 IKILKYKENTVLDPKVFEIPYDK 199
             +     N  +   +F+    K
Sbjct: 174 YVLRNI-TNQPIANSLFKFNLPK 195


>gi|251792119|ref|YP_003006839.1| outer-membrane lipoprotein carrier protein [Aggregatibacter
           aphrophilus NJ8700]
 gi|247533506|gb|ACS96752.1| outer membrane lipoprotein carrier protein LolA [Aggregatibacter
           aphrophilus NJ8700]
          Length = 205

 Score = 73.4 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/202 (11%), Positives = 54/202 (26%), Gaps = 15/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K     +       +             +  +       +  +   F Q          
Sbjct: 1   MKKTFQKLTALSLLGMVSL------AWANADIELQNRLNKVDVLSADFAQTVMSANGKNV 54

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G+  + RP+ F     SP    +I+DG  +  Y+  ++  +   ++    +   + 
Sbjct: 55  QQGNGKLQIKRPNLFRMDTKSPQETQIIADGQTLWFYDPFVEQVTANWVKDAVNNTPFVL 114

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             +          VE  +    +  K               S  L  +  ++   + +  
Sbjct: 115 LTSNDKSHWEQYSVEQKSDTFVLTPKAKNSNIKQFDIRIDESGVLKGFSTIEKDGQSNQY 174

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +     N  LD  +F+    K
Sbjct: 175 VLRNIS-NQNLDSALFKFSVPK 195


>gi|327314294|ref|YP_004329731.1| outer membrane lipoprotein carrier protein LolA [Prevotella
           denticola F0289]
 gi|326946379|gb|AEA22264.1| outer membrane lipoprotein carrier protein LolA [Prevotella
           denticola F0289]
          Length = 208

 Score = 73.4 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 28/209 (13%), Positives = 73/209 (34%), Gaps = 20/209 (9%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DA 58
           + K ++  ++L  +       +A    + +  ++       ++TMQ  F+Q       + 
Sbjct: 1   MMKRLL--LVLMAFCIATASVSAQSAGEARIRQQIEAAAAGMRTMQCDFVQTKYLRMLND 58

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI------------AVYNAKLDTWSVY 106
             V  G  +  +  K  ++Y+SP S + + +G  +               +      +  
Sbjct: 59  RMVSHGRMYYQQRDKLRWEYTSPYSYAFVLNGPRVLISKGSRNDVINVNQSKFFKEIARI 118

Query: 107 PLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWK 166
            +  +    +       +  S    E          +   M   I + F R    +   +
Sbjct: 119 MMNSVVGKALNDRRDFKVTLSSSAAEYVAVLYPQQKQMQQMFQKIVLHFSRQHAMVAKVE 178

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEI 195
           +++     ++I++   K N+ ++ KVF +
Sbjct: 179 LVEKRGDRTVIEMKNVKVNSPVNAKVFSV 207


>gi|317491439|ref|ZP_07949875.1| outer membrane lipoprotein carrier protein LolA [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316920986|gb|EFV42309.1| outer membrane lipoprotein carrier protein LolA [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 203

 Score = 73.4 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/202 (12%), Positives = 60/202 (29%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K ++    L           A    +             + +   +F Q          
Sbjct: 1   MKKLLLACCLVTGF-------ASTAVQASPTSDLQSRLDKVNSFHSSFTQTVTTADGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +GE ++ RP+ F +  +SP    L+SDG  +  YN  ++  +   L     +   + 
Sbjct: 54  QQGEGELWVKRPNLFNWHMTSPDESVLVSDGKTLWFYNPFVEQVTATWLDSATSNTPFML 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                  + +   V+       +  K               +  + ++  ++   + S  
Sbjct: 114 ITRNDAKEWNQYNVKQTGDTFDLTPKSQKNNLKKFTISVSPTGTINSFTAVEQDGQSSAY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
           K+   +    +D   F+    K
Sbjct: 174 KLKSQQSGV-VDASKFQFTPPK 194


>gi|110641091|ref|YP_668821.1| outer-membrane lipoprotein carrier protein [Escherichia coli 536]
 gi|110342683|gb|ABG68920.1| outer-membrane lipoproteins carrier protein precursor [Escherichia
           coli 536]
          Length = 204

 Score = 73.4 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/201 (11%), Positives = 62/201 (30%), Gaps = 20/201 (9%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K +         +     +         +          + +   +F Q+        
Sbjct: 1   MMKKI-------AITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAA 53

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFS 114
               +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F 
Sbjct: 54  VQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFM 113

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +I  N     Q+   +   ++  +T    +  +              +  +  ++   + 
Sbjct: 114 LIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQR 171

Query: 175 SIIKILKYKENTVLDPKVFEI 195
           S  ++   ++N  +D   F  
Sbjct: 172 SSYQLKS-QQNGAVDAAKFTF 191


>gi|304408766|ref|ZP_07390387.1| outer membrane lipoprotein carrier protein LolA [Shewanella baltica
           OS183]
 gi|307302769|ref|ZP_07582524.1| outer membrane lipoprotein carrier protein LolA [Shewanella baltica
           BA175]
 gi|304352587|gb|EFM16984.1| outer membrane lipoprotein carrier protein LolA [Shewanella baltica
           OS183]
 gi|306913129|gb|EFN43551.1| outer membrane lipoprotein carrier protein LolA [Shewanella baltica
           BA175]
          Length = 208

 Score = 73.4 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 30/198 (15%), Positives = 65/198 (32%), Gaps = 15/198 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K  +  V+L                    V++  +  +   +++  F Q          
Sbjct: 1   MKKRLCAVLLASPLLF------SAAVFADDVQQLRDKLIGTASLKADFKQTVTDVNKKVI 54

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G F +A P++FY+  + P    +++DG ++ +YN   +   +        +  +  
Sbjct: 55  QTGSGIFALAYPNQFYWHLTQPDESQIVADGKDLWIYNPFAEEVVIMDFAEAINASPIAL 114

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             ++     S   V        I  K      ++SV     + +L N+ + D     S  
Sbjct: 115 LVHRDDATWSQYSVTKQQDCYEIKPKAIDS-GILSVKVCFKNAQLANFNVADDKGNLSQF 173

Query: 178 KILKYKENTVLDPKVFEI 195
            +   +  T  D  +F  
Sbjct: 174 DLSNQQAITDKDKALFSF 191


>gi|28897880|ref|NP_797485.1| outer-membrane lipoprotein carrier protein [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|153840137|ref|ZP_01992804.1| outer membrane lipoprotein carrier protein LolA [Vibrio
           parahaemolyticus AQ3810]
 gi|260877039|ref|ZP_05889394.1| outer membrane lipoprotein carrier protein LolA [Vibrio
           parahaemolyticus AN-5034]
 gi|260902449|ref|ZP_05910844.1| outer membrane lipoprotein carrier protein LolA [Vibrio
           parahaemolyticus AQ4037]
 gi|31340192|sp|Q87QP3|LOLA_VIBPA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|28806093|dbj|BAC59369.1| outer membrane lipoproteins carrier protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149746234|gb|EDM57328.1| outer membrane lipoprotein carrier protein LolA [Vibrio
           parahaemolyticus AQ3810]
 gi|308093825|gb|EFO43520.1| outer membrane lipoprotein carrier protein LolA [Vibrio
           parahaemolyticus AN-5034]
 gi|308110660|gb|EFO48200.1| outer membrane lipoprotein carrier protein LolA [Vibrio
           parahaemolyticus AQ4037]
 gi|328473160|gb|EGF44008.1| lipoprotein chaperone [Vibrio parahaemolyticus 10329]
          Length = 208

 Score = 73.4 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 20/202 (9%), Positives = 49/202 (24%), Gaps = 11/202 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K      +  F + +   +            +  +     +     F Q+         
Sbjct: 1   MKKRFSAKL--FSALVLSISFFSAANAASPKDELNKRLAMNEGFSADFSQQVISPEGETV 58

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIF 117
              +G   +ARPS F +  + P    L+SDG  +  Y+  ++                + 
Sbjct: 59  MEGEGTVEIARPSLFRWSTTFPDENLLVSDGKTLWYYSPFIEQVSIYWQEQATEQTPFVL 118

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                       ++    +  T+                     +  + +++   +  + 
Sbjct: 119 LTRNRASDWDNYKISQKGNEFTLIPTAVDSTQGQFQINIDAKGVVKGFNVIEQDGQKGLF 178

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
                K         F     K
Sbjct: 179 TFSNVKLGKP-KADRFTFTVPK 199


>gi|307130788|ref|YP_003882804.1| chaperone for lipoproteins [Dickeya dadantii 3937]
 gi|306528317|gb|ADM98247.1| chaperone for lipoproteins [Dickeya dadantii 3937]
          Length = 204

 Score = 73.4 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/193 (12%), Positives = 63/193 (32%), Gaps = 13/193 (6%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMAR 70
             +     +    +    +          + +   +F Q+             GE ++ R
Sbjct: 6   LIAGCLLTSLVSGVVYADAAGDLQSRLSKVNSFHASFTQKVTANDGAAVQEGAGELWVKR 65

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFSVIFSNNQHVIQE 126
           P+ F +K +SP   +L+SDG  +  YN  ++  +   ++       F +I  N+     +
Sbjct: 66  PNLFNWKTTSPDESTLVSDGKTLWFYNPFVEQVTATWVKDATGNTPFILITRNDPKDWGK 125

Query: 127 SIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
                + ++  +T    +  +           +  +  +   +   + S   +   ++N 
Sbjct: 126 YNVSQKGDDFDLTPRTANGNLKQFSINVSSDGT--IHGFTATEQDGQRSAYTLKN-QQNG 182

Query: 187 VLDPKVFEIPYDK 199
             D   F     K
Sbjct: 183 EADAAKFRFTPPK 195


>gi|238920373|ref|YP_002933888.1| outer-membrane lipoprotein carrier protein [Edwardsiella ictaluri
           93-146]
 gi|259491787|sp|C5BE92|LOLA_EDWI9 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|238869942|gb|ACR69653.1| outer membrane lipoprotein carrier protein LolA, putative
           [Edwardsiella ictaluri 93-146]
          Length = 204

 Score = 73.0 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/201 (11%), Positives = 56/201 (27%), Gaps = 16/201 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K ++    +                              + +   +F Q  +       
Sbjct: 1   MKKLLVACCVV-------SGMMSASVLASPSSDLQGRLNKVNSFHASFTQTVSTADGTPV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +GE ++ RP+ F +   SP    L+SDG  +  YN  ++  +   L     +   + 
Sbjct: 54  QQGEGELWVKRPNLFNWHMISPDESVLVSDGKTLWFYNPFVEQVTATWLNRATGNTPFML 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                    +   V    +   +  K                  +  +  ++   + S+ 
Sbjct: 114 ITRNDASDWAQYNVTQQGNTFDLVPKSAKNNLKKFTISVMPDGTINGFSAVEQDGQRSVY 173

Query: 178 KILKYKENTVLDPKVFEIPYD 198
            + + ++N  +D   F     
Sbjct: 174 TLKR-QQNGAVDAAKFRFTPP 193


>gi|301022876|ref|ZP_07186709.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 69-1]
 gi|300397338|gb|EFJ80876.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 69-1]
          Length = 204

 Score = 73.0 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/205 (10%), Positives = 63/205 (30%), Gaps = 20/205 (9%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K +         +     +         +          + +   +F Q+        
Sbjct: 1   MMKKI-------AITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAA 53

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFS 114
               +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F 
Sbjct: 54  VQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFM 113

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +I  N     Q+   +   ++  +T    +  +              +  +  ++   + 
Sbjct: 114 LIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQR 171

Query: 175 SIIKILKYKENTVLDPKVFEIPYDK 199
           S  ++   ++N  ++   F     +
Sbjct: 172 SSYQLKS-QQNGAVEAAKFTFTPPQ 195


>gi|163752529|ref|ZP_02159715.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           benthica KT99]
 gi|161327584|gb|EDP98782.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           benthica KT99]
          Length = 208

 Score = 73.0 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 30/207 (14%), Positives = 65/207 (31%), Gaps = 15/207 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            +  + ++++                              + T++  F Q          
Sbjct: 1   MRKKVTLLVMALPLMASLLVV------ADESSALRAKLEEMATLKANFSQVVTDINNKEI 54

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA--FSVIF 117
               G F +A P+KFY+  + P    +++DG+++ +YN   +  SV  L        +  
Sbjct: 55  QKGSGVFALAYPNKFYWHLTEPDESLIVADGTDVWIYNPFAEQVSVMDLNQAITASPIAL 114

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             ++     +   V S      I  K      + SV        L    + D     S  
Sbjct: 115 LVHRDEETWAQYSVTSKGDCFDIQPKSVDA-GVESVKVCFKDKTLTQMVLKDQQGNVSSF 173

Query: 178 KILKYKENTVLDPKVFEIPYDKIHNIN 204
           ++      T  +  +F+    +  +I+
Sbjct: 174 QLTDQTAITEAEMSLFKFILPEDVDID 200


>gi|330910673|gb|EGH39183.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           AA86]
          Length = 203

 Score = 73.0 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/204 (11%), Positives = 63/204 (30%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +         +     +         +          + + Q +F Q+         
Sbjct: 1   MKKI-------AITCALLSSLVASSVWADAASDLKSRLDKVSSFQASFTQKVTDGSGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F +
Sbjct: 54  QEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  N     Q+   +   ++  +T    +  +              +  +  ++   + S
Sbjct: 114 IARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
             ++   ++N  +D   F     +
Sbjct: 172 SYQLKS-QQNGAVDAAKFTFTPPQ 194


>gi|85059087|ref|YP_454789.1| outer-membrane lipoprotein carrier protein [Sodalis glossinidius
           str. 'morsitans']
 gi|123519575|sp|Q2NTZ1|LOLA_SODGM RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|84779607|dbj|BAE74384.1| outer membrane lipoprotein carrier protein LolA [Sodalis
           glossinidius str. 'morsitans']
          Length = 203

 Score = 73.0 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/174 (13%), Positives = 56/174 (32%), Gaps = 9/174 (5%)

Query: 34  QSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSPSSVSLI 87
           +           + +   +F Q   G         +GE ++ RP+ F +  ++P    L+
Sbjct: 22  EDADVLQSRLNQVNSFHASFTQRVTGAEGGAVQEGEGELWIKRPNLFNWHMTTPDESVLV 81

Query: 88  SDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRVESNNSFITIFFKDD 145
           SDG  +  YN  ++      L+    +   +              V+      ++  K D
Sbjct: 82  SDGKTLWFYNPFVEQAIANWLKNATGNTPFMLITRNSAADWGQYNVKQQGDSFSLVPKAD 141

Query: 146 FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                        +  +  +  ++   + S  ++   ++N  +D   F     K
Sbjct: 142 NGNLKQFTINVTANGTITGFTAVEQDGQRSTYQLKS-QKNGPVDDAKFHFTLPK 194


>gi|284007598|emb|CBA73188.1| outer-membrane lipoprotein carrier protein [Arsenophonus nasoniae]
          Length = 206

 Score = 73.0 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 28/201 (13%), Positives = 69/201 (34%), Gaps = 20/201 (9%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K +I + +L     I             +  +       I +    F Q+        
Sbjct: 1   MMKKLIMLGLLAISFHI-------SQVWADAAAELQMRLNKINSFHANFAQKVTSIDGDL 53

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFS 114
               +G+ ++ RP+ F +   SP    L+SDG+N+  YN  ++  +            F 
Sbjct: 54  IQQGEGQLWIKRPNLFNWHMVSPDESWLVSDGTNLWFYNPFVEQVTVTLLSEATTDTPFM 113

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +I  N+    +        ++  +T       + +       +    +  +  ++   + 
Sbjct: 114 LITRNDPQDWKRYHISQNGDDFLLTATQNKGNLKHFSITV--QPDGTIQQFTAVEQDGQM 171

Query: 175 SIIKILKYKENTVLDPKVFEI 195
           S  ++   ++N+ +D   F+ 
Sbjct: 172 SAYQLKG-QQNSQVDDDKFKF 191


>gi|16759832|ref|NP_455449.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|29142395|ref|NP_805737.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|213418911|ref|ZP_03351977.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
 gi|213428593|ref|ZP_03361343.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213581060|ref|ZP_03362886.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213650896|ref|ZP_03380949.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|289811624|ref|ZP_06542253.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Typhi str. AG3]
 gi|289830104|ref|ZP_06547535.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|16502125|emb|CAD05361.1| outer membrane lipoprotein carrier protein precursor [Salmonella
           enterica subsp. enterica serovar Typhi]
 gi|29138025|gb|AAO69586.1| outer membrane lipoprotein carrier protein precursor [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
          Length = 204

 Score = 73.0 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/205 (12%), Positives = 65/205 (31%), Gaps = 20/205 (9%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K +         +     +         +          + +   TF Q+        
Sbjct: 1   MMKKM-------AIACALLSSVVASSVWADAASSLKSRLDKVSSFHATFTQKVTDGSGAA 53

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFS 114
               +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F 
Sbjct: 54  VQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFM 113

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +I  N     Q+   + + +N  +T    +  +              +  +  ++   + 
Sbjct: 114 LIARNQASDWQQYNIKQDGDNFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQR 171

Query: 175 SIIKILKYKENTVLDPKVFEIPYDK 199
           S  ++   ++N  ++P  F     +
Sbjct: 172 SAYQLKS-QQNGAVEPSKFTFTPPQ 195


>gi|332530917|ref|ZP_08406841.1| outer membrane lipoprotein carrier protein LolA [Hylemonella
           gracilis ATCC 19624]
 gi|332039605|gb|EGI76007.1| outer membrane lipoprotein carrier protein LolA [Hylemonella
           gracilis ATCC 19624]
          Length = 250

 Score = 73.0 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/192 (12%), Positives = 61/192 (31%), Gaps = 27/192 (14%)

Query: 34  QSVKKAIEHFLSIQTMQGTFLQEDA--------------GYVMKGEFFMARPSKFYFKYS 79
             +        + ++ +  F Q                      G F   RP +F F Y+
Sbjct: 51  DGLSALSVFLQTTRSGRSDFTQVVTLPPRASEGSTRVARTRSSNGSFAFQRPGRFRFVYA 110

Query: 80  SPSSVSLISDGSNIAVYNAKLDTWSVYPL----RYMAFSVIFSNNQHVIQESIQRVESN- 134
           +P S ++++DG  + +++  L+  +V            ++I   +     ++   + ++ 
Sbjct: 111 APLSQTIVADGKTLWLHDEDLNQVTVRSQAGALDDTPAALIAGASDLRTLQASYELANDG 170

Query: 135 --NSFITIFFKDDFMGNMISVTF------DRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
             +  + +                           L  ++I+DS  + S++   + + N 
Sbjct: 171 ARDGLLWVRATPKAREGQTQQLRVGLRAVSPTQVELGAFEILDSFGQRSLLTFSRMQVNA 230

Query: 187 VLDPKVFEIPYD 198
            L    F     
Sbjct: 231 NLPADTFRFTPP 242


>gi|229587232|ref|YP_002845733.1| Outer membrane lipoprotein-sorting protein LolA [Rickettsia africae
           ESF-5]
 gi|228022282|gb|ACP53990.1| Outer membrane lipoprotein-sorting protein LolA [Rickettsia africae
           ESF-5]
          Length = 212

 Score = 73.0 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 32/197 (16%), Positives = 82/197 (41%), Gaps = 6/197 (3%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKG 64
            K +  ++I++ +      +  +      ++ +   +   I+++   F QED+ G ++KG
Sbjct: 1   MKKIFFLIIIYLF---VNSSLTFGADDKTAISELKTYLRKIKSVAIDFTQEDSYGKIVKG 57

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
           +  + +P  F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N+H  
Sbjct: 58  KLLIHKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENTFNFLLEDNEHFD 117

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMIS-VTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
           ++ +     N   I+       +    S +TF++ + ++   KI +       I   K  
Sbjct: 118 KDFVFEAVINARNISKITIYHTLTEKRSEITFNKATQQIEALKIFE-DNNIVTITFDKIA 176

Query: 184 ENTVLDPKVFEIPYDKI 200
           +       +F+I   +I
Sbjct: 177 KVQKFSDDLFKIKNPEI 193


>gi|126174374|ref|YP_001050523.1| outer membrane lipoprotein carrier protein LolA [Shewanella baltica
           OS155]
 gi|153000735|ref|YP_001366416.1| outer membrane lipoprotein carrier protein LolA [Shewanella baltica
           OS185]
 gi|217973364|ref|YP_002358115.1| outer membrane lipoprotein carrier protein LolA [Shewanella baltica
           OS223]
 gi|166230497|sp|A3D4J1|LOLA_SHEB5 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|166230498|sp|A6WNG4|LOLA_SHEB8 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|254809232|sp|B8EET4|LOLA_SHEB2 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|125997579|gb|ABN61654.1| outer membrane lipoprotein carrier protein LolA [Shewanella baltica
           OS155]
 gi|151365353|gb|ABS08353.1| outer membrane lipoprotein carrier protein LolA [Shewanella baltica
           OS185]
 gi|217498499|gb|ACK46692.1| outer membrane lipoprotein carrier protein LolA [Shewanella baltica
           OS223]
          Length = 208

 Score = 73.0 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 29/198 (14%), Positives = 64/198 (32%), Gaps = 15/198 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K  +  V+L                     ++  +  +   +++  F Q          
Sbjct: 1   MKKRLCAVLLASPLLF------SAAVFADDAQQLRDKLIGTASLKADFKQTVTDVNKKVI 54

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G F +A P++FY+  + P    +++DG ++ +YN   +   +        +  +  
Sbjct: 55  QTGSGIFALAYPNQFYWHLTQPDESQIVADGKDLWIYNPFAEEVVIMDFAEAINASPIAL 114

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             ++     S   V        I  K      ++SV     + +L N+ + D     S  
Sbjct: 115 LVHRDDATWSQYSVTKQQDCYEIKPKAIDS-GILSVKVCFKNAQLANFNVADDKGNLSQF 173

Query: 178 KILKYKENTVLDPKVFEI 195
            +   +  T  D  +F  
Sbjct: 174 DLSNQQAITDKDKALFSF 191


>gi|325858495|ref|ZP_08172599.1| outer membrane lipoprotein carrier protein LolA [Prevotella
           denticola CRIS 18C-A]
 gi|325482992|gb|EGC85981.1| outer membrane lipoprotein carrier protein LolA [Prevotella
           denticola CRIS 18C-A]
          Length = 208

 Score = 72.6 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 28/209 (13%), Positives = 74/209 (35%), Gaps = 20/209 (9%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DA 58
           + K ++  ++L  +       +A    + +  ++       ++TMQ  F+Q       + 
Sbjct: 1   MMKRLL--LVLMAFFIATASVSAQSAGEARIRQQIEAAAAGMRTMQCDFVQTKYLRMLND 58

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI------------AVYNAKLDTWSVY 106
             V +G  +  +  K  ++Y+SP S + + +G  +               +      +  
Sbjct: 59  RMVSRGRMYYQQRDKLRWEYTSPYSYAFVLNGPRVLISKGSRNDVINVNQSKFFKEIARI 118

Query: 107 PLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWK 166
            +  +    +       +  S    E          +   M   I + F R    +   +
Sbjct: 119 MMNSVVGKALNDRRDFKVALSSSAAEYVAVLYPQQKQMQQMFQKIVLHFSRQHAMVAKVE 178

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEI 195
           +++     ++I++   K N+ ++ KVF +
Sbjct: 179 LVEKRGDRTVIEMKNVKVNSPVNAKVFSV 207


>gi|94265270|ref|ZP_01289029.1| Outer membrane lipoprotein carrier protein LolA [delta
           proteobacterium MLMS-1]
 gi|93454251|gb|EAT04567.1| Outer membrane lipoprotein carrier protein LolA [delta
           proteobacterium MLMS-1]
          Length = 237

 Score = 72.6 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 19/179 (10%), Positives = 51/179 (28%), Gaps = 18/179 (10%)

Query: 38  KAIEHFLSIQTMQGTFLQED------AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGS 91
           +  E + +  + +  F Q             +G     +P    ++Y  P    L+ DG 
Sbjct: 51  RLQETYDATDSFRADFRQRTAVPMSRRQREGEGSVIFKKPHLMRWEYEKPERQVLVGDGE 110

Query: 92  NIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVES------------NNSFIT 139
            + +Y A+ +   +  +     S +         + ++  E              +    
Sbjct: 111 QVRMYFARSNQMMIQQVEDYLESDVTYAFFSGSGDLLRDFEVAAVPPGEALAEPGHQLRL 170

Query: 140 IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           +          + +  +  SY +    I+D     + +     + +  L    +     
Sbjct: 171 LPRDIHPQVEYLDILVEPESYLIRRLDIVDHFGSVTTLIFSNIELDPELAADFYRFEPP 229


>gi|240851532|ref|ZP_04752283.1| outer-membrane lipoprotein carrier protein precursor
           [Actinobacillus minor 202]
 gi|240310050|gb|EER48342.1| outer-membrane lipoprotein carrier protein precursor
           [Actinobacillus minor 202]
          Length = 220

 Score = 72.6 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 25/202 (12%), Positives = 60/202 (29%), Gaps = 12/202 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK-- 63
            K ++   +           A       Q+V +       +      F Q       K  
Sbjct: 8   MKQIMKKSLFGLALFSL---AGSAFADAQAVAELQNRLDKVSQYSADFDQTVRSSKGKQI 64

Query: 64  ----GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G+F + RP+ F     SP    ++SDG+N+  Y+  +   +V  ++    +   + 
Sbjct: 65  QSGQGKFQVKRPNLFRMDTKSPQENLIVSDGANLWFYDPFVSQVTVNTVQDAVNNTPFVL 124

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             + +        V  N     +  K               +  +  +  ++   + ++ 
Sbjct: 125 LTSNNKSHWDQYDVTQNMDSFVLKPKSKKSSLKQFDVRIDANGVMKGFSTIERDGQSNLY 184

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            +        +   +F+    K
Sbjct: 185 VLRNITT-ANVSSDLFKFSVPK 205


>gi|168801427|ref|ZP_02826434.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC508]
 gi|189376439|gb|EDU94855.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC508]
          Length = 203

 Score = 72.6 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/204 (11%), Positives = 62/204 (30%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +         +     +         +          + +   +F Q+         
Sbjct: 1   MKKI-------AITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F +
Sbjct: 54  QEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  N     Q+   +   ++  +T    +  +              +  +  ++   + S
Sbjct: 114 IARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
             ++   ++N  +D   F     +
Sbjct: 172 SYQLKS-QKNGAVDAAKFTFTPPQ 194


>gi|34581074|ref|ZP_00142554.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262459|gb|EAA25963.1| unknown [Rickettsia sibirica 246]
          Length = 212

 Score = 72.6 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 32/197 (16%), Positives = 81/197 (41%), Gaps = 6/197 (3%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKG 64
            K +  ++I++ +      +  +      ++ +   +   I+++   F QED+ G ++KG
Sbjct: 1   MKKIFFLIIIYLF---VNSSLTFGADDKTAISELKTYLRKIKSVAIDFTQEDSYGKIVKG 57

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
           +  + +P  F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N+H  
Sbjct: 58  KLLIHKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENTFNFLLEDNEHFD 117

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMIS-VTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
           ++ +     N   I+       +    S +TF+  + ++   KI +       I   K  
Sbjct: 118 KDFVFEAVINARNISKITIYHTLTEKRSEITFNNATQQIEALKIFE-DNNIVTITFDKIA 176

Query: 184 ENTVLDPKVFEIPYDKI 200
           +       +F+I   +I
Sbjct: 177 KVQKFSDDLFKIKNPEI 193


>gi|238651108|ref|YP_002916966.1| hypothetical protein RPR_07545 [Rickettsia peacockii str. Rustic]
 gi|238625206|gb|ACR47912.1| hypothetical protein RPR_07545 [Rickettsia peacockii str. Rustic]
          Length = 212

 Score = 72.6 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 83/197 (42%), Gaps = 6/197 (3%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKG 64
            K +  ++I++ +      + A+      ++ +   +   I+++   F QED+ G ++KG
Sbjct: 1   MKKIFFLIIIYLF---VNSSLAFGADDKTAILELKTYLRKIKSVAIDFTQEDSYGKIVKG 57

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
           +  + +P  F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N+H  
Sbjct: 58  KLLIHKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENTFNFLLEDNEHFD 117

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMIS-VTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
           ++ +     N   I+       +    S +TF++ + ++   KI +       I   K  
Sbjct: 118 KDFVFEAVINARNISKITIYHTLTEKRSEITFNKATQQIEALKIFE-DNNIVTITFDKIA 176

Query: 184 ENTVLDPKVFEIPYDKI 200
           +       +F+I   +I
Sbjct: 177 KVQKFSDDLFKIKNPEI 193


>gi|293433188|ref|ZP_06661616.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           B088]
 gi|291324007|gb|EFE63429.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           B088]
          Length = 203

 Score = 72.6 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/204 (11%), Positives = 62/204 (30%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +         +     +         +          + +   +F Q+         
Sbjct: 1   MKKI-------AITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F +
Sbjct: 54  QEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  N     Q+   +   ++  +T    +  +              +  +  ++   + S
Sbjct: 114 IARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINV--GRDGTIHQFTAVEQDDQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
             ++   ++N  +D   F     +
Sbjct: 172 SYQLKS-QQNGAVDAAKFTFTPPQ 194


>gi|262274500|ref|ZP_06052311.1| outer membrane lipoprotein carrier protein LolA [Grimontia hollisae
           CIP 101886]
 gi|262221063|gb|EEY72377.1| outer membrane lipoprotein carrier protein LolA [Grimontia hollisae
           CIP 101886]
          Length = 198

 Score = 72.6 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/179 (12%), Positives = 58/179 (32%), Gaps = 10/179 (5%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSP 81
            P       ++       + +   +F Q             +G+  + RP+ F ++  +P
Sbjct: 12  APAVFANPQQELNTRLSKLNSFTASFEQTVTSPDGDVISEGEGKLAVKRPNLFNWETVTP 71

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRVESNNSFIT 139
               LISDG  +  Y+  ++  +   L         +     +    +   V+      T
Sbjct: 72  DENYLISDGKTLWYYSPFIEQVTAMWLDDATSQTPFVLLTRNNPDDWNNYNVKQEGDTFT 131

Query: 140 IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           +  K+        V+  +   ++  + +++   + S  ++   + N +     F     
Sbjct: 132 LSPKEASNHGEFVVSV-KPDGKITEFAVVEQDGQQSRFELENVQ-NVLPAASTFTFTIP 188


>gi|58038536|ref|YP_190500.1| Outer-membrane lipoprotein carrier protein [Gluconobacter oxydans
           621H]
 gi|58000950|gb|AAW59844.1| Outer-membrane lipoprotein carrier protein [Gluconobacter oxydans
           621H]
          Length = 197

 Score = 72.6 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/176 (13%), Positives = 67/176 (38%), Gaps = 7/176 (3%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLI 87
           P  +   V +   +   +Q +Q  FLQ         G F    P      Y +P  + L+
Sbjct: 23  PAAEQDDVHRIEAYLNGVQGLQAAFLQHGPDAGESAGRFSY-IPGHLRLDYVAPHPMELV 81

Query: 88  SDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNS---FITIFFKD 144
           +   ++ + +      +   LR+    ++         +       +      I++   D
Sbjct: 82  AGDGHLVLDDPATGAVTHLSLRHNPLGLLLKYPIRFDGDVQVTDVRHGDGSLQISVAQAD 141

Query: 145 DFMGNMISVTFDRLSYR--LLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           +    ++++ F  ++ +  L+  + +D+ + + ++++   ++   + P VF  P +
Sbjct: 142 NPSQGLLTIQFSEVNGQLGLIGLQGVDARQHHFVVELSAVQQGVAIAPSVFTPPAE 197


>gi|167041405|gb|ABZ06157.1| putative Outer membrane lipoprotein carrier protein LolA
           [uncultured marine microorganism HF4000_006O13]
          Length = 212

 Score = 72.6 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 31/201 (15%), Positives = 68/201 (33%), Gaps = 11/201 (5%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV------MK 63
           + V    F + I      +    ++S     ++   + ++Q  F Q             +
Sbjct: 4   LKVCASIFATLISLLAFDFTYASEESSFNVNDYLNEMLSLQANFKQTIFSPTNDVIDYSE 63

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT----WSVYPLRYMAFSVIFSN 119
           G F + +P K  + ++ PS   +      I+ Y+A L+           +    +++ +N
Sbjct: 64  GSFLLKKPGKIMWHFTVPSIKKITVQEQKISTYDANLNQVVIVPFSDRYQSSLANILLNN 123

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMGN-MISVTFDRLSYRLLNWKIMDSSRRYSIIK 178
           +  +    I    +N +  ++        N    +    +   L   K+ D+S +   I 
Sbjct: 124 DSLMSYYQIHSETTNKNAYSVILVQKNSNNLFTRIKITIVEMLLTEIKLWDASGQSIGIS 183

Query: 179 ILKYKENTVLDPKVFEIPYDK 199
                 N  L    FE  + K
Sbjct: 184 FDDVIINAPLADAFFEFSFPK 204


>gi|88608557|ref|YP_506586.1| hypothetical protein NSE_0710 [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600726|gb|ABD46194.1| conserved hypothetical protein [Neorickettsia sennetsu str.
           Miyayama]
          Length = 171

 Score = 72.6 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/167 (14%), Positives = 59/167 (35%), Gaps = 6/167 (3%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQ-EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLIS 88
            +   +  + + +  S++T+  TF+Q    G +  G  F+A P KF   Y       +++
Sbjct: 3   ASCALANAELVSYLASLRTLCATFVQYNPDGTLSTGTLFLAVPHKFRIDYHKEGVSVVMN 62

Query: 89  DGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMG 148
            G          ++ S +  +     +  S        ++ + + + S   ++       
Sbjct: 63  KGMMTYRDATLKESRSFFLGKSDPLLLAIS-----DLGALHKYKQSISGELLYLGRSSKN 117

Query: 149 NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
               +        +      D S++ + + +     N  LD  +F+I
Sbjct: 118 KKYVLVLSHSPAEIREILFEDDSKQVTRMVLSDVCYNADLDRHIFDI 164


>gi|67459755|ref|YP_247379.1| hypothetical protein RF_1363 [Rickettsia felis URRWXCal2]
 gi|67005288|gb|AAY62214.1| unknown [Rickettsia felis URRWXCal2]
          Length = 207

 Score = 72.6 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 82/196 (41%), Gaps = 9/196 (4%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKG 64
            K +  ++I  F +++  F A        ++ +   +  +I+++   F QED+ G ++KG
Sbjct: 1   MKKIFLIIICVFINSVVAFGA----DDKTTISELKTYLHTIKSVAIDFTQEDSYGKIVKG 56

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
           +  + +P  F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N+  +
Sbjct: 57  KLLIHKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENTFNFLLEDNKDFV 116

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
            ES+    + +         +       +TF++ + ++   KI +       I   K  +
Sbjct: 117 FESVINERNISKITIYHTLTEK---RSEITFNKATKQIEALKIFE-DNNIVTITFDKIAK 172

Query: 185 NTVLDPKVFEIPYDKI 200
                  +F++   +I
Sbjct: 173 VQKFSDDLFKLKNPEI 188


>gi|189028885|sp|Q5PGI4|LOLA_SALPA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
          Length = 203

 Score = 72.6 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/204 (13%), Positives = 65/204 (31%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +         +     +         +V         + +   TF Q+         
Sbjct: 1   MKKM-------AIACALLSSVVASSVWADAVSSLKSRLDKVSSFHATFTQKVTDGSGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F +
Sbjct: 54  QEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  N     Q+   + + +N  +T    +  +              +  +  ++   + S
Sbjct: 114 IARNQASDWQQYNIKQDGDNFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
             ++   ++N  +DP  F     +
Sbjct: 172 AYQLKS-QQNGAVDPSKFTFTPPQ 194


>gi|24213836|ref|NP_711317.1| outer membrane lipoprotein-sorting protein [Leptospira interrogans
           serovar Lai str. 56601]
 gi|45658387|ref|YP_002473.1| outer membrane lipoprotein carrier protein [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
 gi|24194674|gb|AAN48335.1| outer membrane lipoprotein-sorting protein [Leptospira interrogans
           serovar Lai str. 56601]
 gi|45601630|gb|AAS71110.1| outer membrane lipoprotein carrier protein [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
          Length = 257

 Score = 72.6 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 29/221 (13%), Positives = 72/221 (32%), Gaps = 28/221 (12%)

Query: 3   FLLYKSVIGVVILFFYSA---IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTF-LQEDA 58
           FL+ K++I    + F +    +    A    +  + VK+  + F  + + +  F +Q  +
Sbjct: 20  FLMKKTIILSFFILFLALEPSLLAQPAHNWNSPSEVVKQVKKKFSDLNSYKADFQIQTVS 79

Query: 59  GYVMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD-------------- 101
               K   G     +  +  ++++ PS   ++SDG  + +Y A+L+              
Sbjct: 80  NKKSKNMKGVCLYKKGGRIRYQFNEPSGDEIVSDGKTLYIYIARLNAVGKQDLTLNKSNK 139

Query: 102 ----TWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMIS---VT 154
                 +            +      I++     +    +  +  +            + 
Sbjct: 140 SGPIFSNFTDEGLSRIFRKYHYKFDSIEQPQTSSKDGRKYFVLNLEQREKIGGFETMLLY 199

Query: 155 FDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
            D  +Y +      D   + + I+    + N  L+   F  
Sbjct: 200 VDAQTYFIQKAVASDGRGKETTIEFSNLEINPDLEDGQFNF 240


>gi|68171853|ref|ZP_00545185.1| similar to Outer membrane lipoprotein-sorting protein [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88658500|ref|YP_507838.1| hypothetical protein ECH_1053 [Ehrlichia chaffeensis str. Arkansas]
 gi|67998722|gb|EAM85442.1| similar to Outer membrane lipoprotein-sorting protein [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88599957|gb|ABD45426.1| conserved hypothetical protein [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 193

 Score = 72.2 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 32/187 (17%), Positives = 75/187 (40%), Gaps = 3/187 (1%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED--AGYVMKGEFF 67
           +   I + Y  I  F + +  + +   ++ + +F +I + +  F+Q       +  G  F
Sbjct: 1   MKTKIAYIYFFIVYFVSIHAYSTETIKEELLSYFSAIHSFKAEFVQTSSANNDIQHGMVF 60

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           M +P    + Y  P+  S+I  G  I+ Y+ +L+ +S   +     +++ S+ + +    
Sbjct: 61  MKKPGLLKWDYYPPTPASIIMHGRTISYYDKELEEYSYSIINNPIINLLSSDIKDIKDII 120

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
                + +S   I  +D     +  + F+     ++   I  S    + IK    + N  
Sbjct: 121 FLNTSTTDSKKVITIQDQKTALLADIIFNTNPITIVGLNIA-SPDSITYIKFYNIQNNIT 179

Query: 188 LDPKVFE 194
           +    F+
Sbjct: 180 IKDTEFK 186


>gi|300722521|ref|YP_003711811.1| periplasmic chaperone [Xenorhabdus nematophila ATCC 19061]
 gi|297629028|emb|CBJ89613.1| periplasmic chaperone effects translocation of lipoproteins from
           inner membrane to outer membrane [Xenorhabdus
           nematophila ATCC 19061]
          Length = 203

 Score = 72.2 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 20/201 (9%), Positives = 59/201 (29%), Gaps = 16/201 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM--- 62
            K ++                +       + +        + +   +F Q          
Sbjct: 1   MKKLM-------LIGCLMMGVSVSSAWANATQDLQGRLGKVNSFHASFTQTVTSNEGANI 53

Query: 63  ---KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +GE ++ RP+ F +  ++P    L+SDG  +  YN  ++  +   L+    +   + 
Sbjct: 54  QKGEGELWIKRPNLFNWHMTTPDESVLVSDGKTLWFYNPFVEQVTANWLKDATGNTPFML 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                       ++  + +   +   +                 +  +   +   + S  
Sbjct: 114 IARNDPADWKQYKIAQDGNHFELTPNNVNGNLKHFSITVTPEGTIQKFTATEQDGQKSTY 173

Query: 178 KILKYKENTVLDPKVFEIPYD 198
           ++   ++N+  D   F+    
Sbjct: 174 QLQG-QQNSSADADKFKFTVP 193


>gi|160875434|ref|YP_001554750.1| outer membrane lipoprotein carrier protein LolA [Shewanella baltica
           OS195]
 gi|189028559|sp|A9L272|LOLA_SHEB9 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|160860956|gb|ABX49490.1| outer membrane lipoprotein carrier protein LolA [Shewanella baltica
           OS195]
 gi|315267624|gb|ADT94477.1| outer membrane lipoprotein carrier protein LolA [Shewanella baltica
           OS678]
          Length = 208

 Score = 72.2 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 29/198 (14%), Positives = 64/198 (32%), Gaps = 15/198 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K  +  V+L                     ++  +  +   +++  F Q          
Sbjct: 1   MKKRLCAVLLASPLLF------SAAVFADDAQQLRDKLIGTASLKADFKQTVTDVNKKVI 54

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G F +A P++FY+  + P    +++DG ++ +YN   +   +        +  +  
Sbjct: 55  QTGSGIFALAYPNQFYWHLTQPDESQIVADGKDLWIYNPFAEEVVIMDFAEAINASPIAL 114

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             ++     S   V        I  K      ++SV     + +L N+ + D     S  
Sbjct: 115 LVHRDDATWSQYAVTKQQDCYEIKPKAIDS-GILSVKVCFKNAQLANFNVADDKGNLSQF 173

Query: 178 KILKYKENTVLDPKVFEI 195
            +   +  T  D  +F  
Sbjct: 174 DLSNQQAITDKDKALFSF 191


>gi|170769218|ref|ZP_02903671.1| outer membrane lipoprotein carrier protein LolA [Escherichia
           albertii TW07627]
 gi|170121870|gb|EDS90801.1| outer membrane lipoprotein carrier protein LolA [Escherichia
           albertii TW07627]
          Length = 203

 Score = 72.2 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/204 (11%), Positives = 63/204 (30%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +         +     +         +          + +   +F Q+         
Sbjct: 1   MKKI-------AITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F +
Sbjct: 54  QEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  N     Q+   +   ++  +T    +  +              +  +  ++   + S
Sbjct: 114 IARNQSSDWQQYNIKQNGDDFILTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
             ++   ++N  +DP  F     +
Sbjct: 172 SYQLKS-QQNGAVDPAKFTFTPPQ 194


>gi|33597978|ref|NP_885621.1| outer-membrane lipoprotein carrier protein [Bordetella
           parapertussis 12822]
 gi|47117180|sp|Q7W543|LOLA_BORPA RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|33574407|emb|CAE38745.1| putative exported protein [Bordetella parapertussis]
          Length = 210

 Score = 72.2 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 22/174 (12%), Positives = 56/174 (32%), Gaps = 12/174 (6%)

Query: 37  KKAIEHFLSIQTMQGTFLQED------AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDG 90
           ++      +++   G+F Q              G F   RP KF +    P    ++SDG
Sbjct: 31  EQLDTFVATVKGATGSFKQSTVSPQGATQPTQSGTFAFQRPGKFKWAVQLPYEQLIVSDG 90

Query: 91  SNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDF 146
             +  Y+  L   +V  +         +++F   Q     ++  +   +    +  K   
Sbjct: 91  KQVFQYDPDLAQVTVRQVDQAIGTSPAAILFGAGQLGQAFAVSALPDRDGLQWLRAKPRN 150

Query: 147 MG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                  V       +    +++D+  + + +++        +    F+    +
Sbjct: 151 ADAGFSQVDIGLRDNQPARIELVDAFGQTTRVELSNLLPG-AVPASEFQFTPPQ 203


>gi|56413987|ref|YP_151062.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|56128244|gb|AAV77750.1| outer membrane lipoprotein carrier protein precursor [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
          Length = 200

 Score = 72.2 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 26/194 (13%), Positives = 63/194 (32%), Gaps = 13/194 (6%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMA 69
              +     +         +V         + +   TF Q+            +G+ ++ 
Sbjct: 1   MAIACALLSSVVASSVWADAVSSLKSRLDKVSSFHATFTQKVTDGSGAAVQEGQGDLWVK 60

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQ 125
           RP+ F +  + P    L+SDG  +  YN  ++  +            F +I  N     Q
Sbjct: 61  RPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQASDWQ 120

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +   + + +N  +T    +  +              +  +  ++   + S  ++   ++N
Sbjct: 121 QYNIKQDGDNFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQRSAYQLKS-QQN 177

Query: 186 TVLDPKVFEIPYDK 199
             +DP  F     +
Sbjct: 178 GAVDPSKFTFTPPQ 191


>gi|91793100|ref|YP_562751.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           denitrificans OS217]
 gi|91715102|gb|ABE55028.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           denitrificans OS217]
          Length = 218

 Score = 72.2 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/205 (13%), Positives = 70/205 (34%), Gaps = 14/205 (6%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITK--DQSVKKAIEHFLSIQTMQGTFLQEDAG------Y 60
           +    +          +A    T        K       + ++   F Q+          
Sbjct: 1   MFKGFLSSLCVTALGASALLTSTACVADDAAKLRGKLAQVDSLHAAFSQQVTDINNKLIQ 60

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSVI 116
             +G F +A PSKFY+    P    +++DG+++ VYN   +  +V  +         +++
Sbjct: 61  QGQGVFALAYPSKFYWHLVEPDESLIVADGTDLWVYNPFAEEVTVMDVSQAVEASPIALL 120

Query: 117 FSNNQHVIQESIQRVES--NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
              ++           S   ++            N+++V+      +L ++ + DS    
Sbjct: 121 VHRDEETWSLYHVEQASATGDTSCFNILPKTLKANVVAVSVCFKGKQLTDFNLTDSQGNL 180

Query: 175 SIIKILKYKENTVLDPKVFEIPYDK 199
           S   +   ++    + ++F+    +
Sbjct: 181 SRFALSAQRQVKSDEIQLFKFALPE 205


>gi|110804892|ref|YP_688412.1| outer-membrane lipoprotein carrier protein [Shigella flexneri 5
           str. 8401]
 gi|145698236|ref|NP_415411.2| chaperone for lipoproteins [Escherichia coli str. K-12 substr.
           MG1655]
 gi|157158652|ref|YP_001462089.1| outer-membrane lipoprotein carrier protein [Escherichia coli
           E24377A]
 gi|157160414|ref|YP_001457732.1| outer-membrane lipoprotein carrier protein [Escherichia coli HS]
 gi|168756982|ref|ZP_02781989.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC4401]
 gi|168762975|ref|ZP_02787982.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC4501]
 gi|168787319|ref|ZP_02812326.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC869]
 gi|170020707|ref|YP_001725661.1| outer-membrane lipoprotein carrier protein [Escherichia coli ATCC
           8739]
 gi|170080549|ref|YP_001729869.1| chaperone for lipoproteins [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170684020|ref|YP_001744279.1| outer-membrane lipoprotein carrier protein [Escherichia coli
           SMS-3-5]
 gi|187733443|ref|YP_001880911.1| outer-membrane lipoprotein carrier protein [Shigella boydii CDC
           3083-94]
 gi|187776223|ref|ZP_02801265.2| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC4196]
 gi|188025258|ref|ZP_02777149.2| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC4113]
 gi|188495917|ref|ZP_03003187.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           53638]
 gi|189010699|ref|ZP_02808808.2| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC4076]
 gi|189403356|ref|ZP_02794891.2| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC4486]
 gi|191167617|ref|ZP_03029428.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           B7A]
 gi|191172146|ref|ZP_03033690.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           F11]
 gi|193064624|ref|ZP_03045703.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           E22]
 gi|193070750|ref|ZP_03051685.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           E110019]
 gi|194428359|ref|ZP_03060900.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           B171]
 gi|194438716|ref|ZP_03070803.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           101-1]
 gi|195939554|ref|ZP_03084936.1| outer-membrane lipoprotein carrier protein [Escherichia coli
           O157:H7 str. EC4024]
 gi|208815436|ref|ZP_03256615.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC4045]
 gi|208822270|ref|ZP_03262589.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC4042]
 gi|209397900|ref|YP_002269564.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC4115]
 gi|217324237|ref|ZP_03440321.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. TW14588]
 gi|238900149|ref|YP_002925945.1| chaperone for lipoproteins [Escherichia coli BW2952]
 gi|253774080|ref|YP_003036911.1| outer-membrane lipoprotein carrier protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254792091|ref|YP_003076928.1| outer-membrane lipoprotein carrier protein [Escherichia coli
           O157:H7 str. TW14359]
 gi|256020981|ref|ZP_05434846.1| outer-membrane lipoprotein carrier protein [Shigella sp. D9]
 gi|256023408|ref|ZP_05437273.1| outer-membrane lipoprotein carrier protein [Escherichia sp.
           4_1_40B]
 gi|293404198|ref|ZP_06648192.1| lolA [Escherichia coli FVEC1412]
 gi|293414173|ref|ZP_06656822.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           B185]
 gi|298379979|ref|ZP_06989584.1| outer-membrane lipoprotein carrier protein [Escherichia coli
           FVEC1302]
 gi|301024406|ref|ZP_07188093.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 196-1]
 gi|306812653|ref|ZP_07446846.1| outer-membrane lipoprotein carrier protein [Escherichia coli NC101]
 gi|307137519|ref|ZP_07496875.1| outer-membrane lipoprotein carrier protein [Escherichia coli H736]
 gi|307311722|ref|ZP_07591362.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           W]
 gi|309784008|ref|ZP_07678652.1| outer membrane lipocarrier protein LolA [Shigella dysenteriae 1617]
 gi|312969041|ref|ZP_07783248.1| outer membrane lipocarrier protein LolA [Escherichia coli 2362-75]
 gi|312971018|ref|ZP_07785197.1| outer membrane lipocarrier protein LolA [Escherichia coli 1827-70]
 gi|331667265|ref|ZP_08368130.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           TA271]
 gi|331682400|ref|ZP_08383019.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           H299]
 gi|47117712|sp|P61316|LOLA_ECOLI RecName: Full=Outer-membrane lipoprotein carrier protein; AltName:
           Full=P20; Flags: Precursor
 gi|47117713|sp|P61317|LOLA_ECOL6 RecName: Full=Outer-membrane lipoprotein carrier protein; AltName:
           Full=P20; Flags: Precursor
 gi|47117714|sp|P61318|LOLA_ECO57 RecName: Full=Outer-membrane lipoprotein carrier protein; AltName:
           Full=P20; Flags: Precursor
 gi|47117715|sp|P61319|LOLA_SHIFL RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|123147315|sp|Q0T8N1|LOLA_SHIF8 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|166990714|sp|A7ZJW0|LOLA_ECO24 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|166990715|sp|A7ZYJ5|LOLA_ECOHS RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|189028550|sp|B1IWN2|LOLA_ECOLC RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|226737654|sp|B1LJX2|LOLA_ECOSM RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229485827|sp|B5YT26|LOLA_ECO5E RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229485828|sp|B1X831|LOLA_ECODH RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229485842|sp|B2TUI7|LOLA_SHIB3 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|259491786|sp|C4ZQ17|LOLA_ECOBW RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|110614440|gb|ABF03107.1| outer-membrane lipoprotein carrier protein precursor [Shigella
           flexneri 5 str. 8401]
 gi|145693108|gb|AAC73977.2| chaperone for lipoproteins [Escherichia coli str. K-12 substr.
           MG1655]
 gi|157066094|gb|ABV05349.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           HS]
 gi|157080682|gb|ABV20390.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           E24377A]
 gi|169755635|gb|ACA78334.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           ATCC 8739]
 gi|169888384|gb|ACB02091.1| chaperone for lipoproteins [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170521738|gb|ACB19916.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           SMS-3-5]
 gi|187430435|gb|ACD09709.1| outer membrane lipoprotein carrier protein LolA [Shigella boydii
           CDC 3083-94]
 gi|187768383|gb|EDU32227.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC4196]
 gi|188013949|gb|EDU52071.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC4113]
 gi|188491116|gb|EDU66219.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           53638]
 gi|188998920|gb|EDU67906.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC4076]
 gi|189355932|gb|EDU74351.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC4401]
 gi|189361168|gb|EDU79587.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC4486]
 gi|189366819|gb|EDU85235.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC4501]
 gi|189372639|gb|EDU91055.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC869]
 gi|190902378|gb|EDV62116.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           B7A]
 gi|190907673|gb|EDV67268.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           F11]
 gi|192927681|gb|EDV82296.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           E22]
 gi|192955943|gb|EDV86411.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           E110019]
 gi|194413574|gb|EDX29855.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           B171]
 gi|194422348|gb|EDX38348.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           101-1]
 gi|208732084|gb|EDZ80772.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC4045]
 gi|208737755|gb|EDZ85438.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC4042]
 gi|209159300|gb|ACI36733.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC4115]
 gi|217320458|gb|EEC28882.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. TW14588]
 gi|238860137|gb|ACR62135.1| chaperone for lipoproteins [Escherichia coli BW2952]
 gi|253325124|gb|ACT29726.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254591491|gb|ACT70852.1| chaperone for lipoproteins [Escherichia coli O157:H7 str. TW14359]
 gi|260449963|gb|ACX40385.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           DH1]
 gi|291428784|gb|EFF01809.1| lolA [Escherichia coli FVEC1412]
 gi|291434231|gb|EFF07204.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           B185]
 gi|294492212|gb|ADE90968.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           IHE3034]
 gi|298279677|gb|EFI21185.1| outer-membrane lipoprotein carrier protein [Escherichia coli
           FVEC1302]
 gi|299880413|gb|EFI88624.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           MS 196-1]
 gi|305853416|gb|EFM53855.1| outer-membrane lipoprotein carrier protein [Escherichia coli NC101]
 gi|306908277|gb|EFN38776.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           W]
 gi|307552733|gb|ADN45508.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           ABU 83972]
 gi|307627679|gb|ADN71983.1| outer-membrane lipoprotein carrier protein [Escherichia coli UM146]
 gi|308928151|gb|EFP73614.1| outer membrane lipocarrier protein LolA [Shigella dysenteriae 1617]
 gi|310336779|gb|EFQ01946.1| outer membrane lipocarrier protein LolA [Escherichia coli 1827-70]
 gi|312286443|gb|EFR14356.1| outer membrane lipocarrier protein LolA [Escherichia coli 2362-75]
 gi|312945414|gb|ADR26241.1| outer-membrane lipoprotein carrier protein [Escherichia coli O83:H1
           str. NRG 857C]
 gi|313650197|gb|EFS14609.1| outer membrane lipocarrier protein LolA [Shigella flexneri 2a str.
           2457T]
 gi|315060176|gb|ADT74503.1| chaperone for lipoproteins [Escherichia coli W]
 gi|315619203|gb|EFU99782.1| outer membrane lipocarrier protein LolA [Escherichia coli 3431]
 gi|320175332|gb|EFW50438.1| Outer membrane lipoprotein carrier protein LolA [Shigella
           dysenteriae CDC 74-1112]
 gi|320180608|gb|EFW55537.1| Outer membrane lipoprotein carrier protein LolA [Shigella boydii
           ATCC 9905]
 gi|320183170|gb|EFW58028.1| Outer membrane lipoprotein carrier protein LolA [Shigella flexneri
           CDC 796-83]
 gi|320192622|gb|EFW67263.1| Outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. EC1212]
 gi|320196613|gb|EFW71236.1| Outer membrane lipoprotein carrier protein LolA [Escherichia coli
           WV_060327]
 gi|320202286|gb|EFW76857.1| Outer membrane lipoprotein carrier protein LolA [Escherichia coli
           EC4100B]
 gi|320637761|gb|EFX07553.1| lipoprotein chaperone [Escherichia coli O157:H7 str. G5101]
 gi|320642885|gb|EFX12086.1| lipoprotein chaperone [Escherichia coli O157:H- str. 493-89]
 gi|320648342|gb|EFX16997.1| lipoprotein chaperone [Escherichia coli O157:H- str. H 2687]
 gi|320654180|gb|EFX22248.1| lipoprotein chaperone [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320659804|gb|EFX27360.1| lipoprotein chaperone [Escherichia coli O55:H7 str. USDA 5905]
 gi|320664273|gb|EFX31424.1| lipoprotein chaperone [Escherichia coli O157:H7 str. LSU-61]
 gi|323159516|gb|EFZ45496.1| outer membrane lipocarrier protein LolA [Escherichia coli E128010]
 gi|323165352|gb|EFZ51139.1| outer membrane lipocarrier protein LolA [Shigella sonnei 53G]
 gi|323172137|gb|EFZ57775.1| outer membrane lipocarrier protein LolA [Escherichia coli LT-68]
 gi|323175487|gb|EFZ61082.1| outer membrane lipocarrier protein LolA [Escherichia coli 1180]
 gi|323185144|gb|EFZ70509.1| outer membrane lipocarrier protein LolA [Escherichia coli 1357]
 gi|323190713|gb|EFZ75982.1| outer membrane lipocarrier protein LolA [Escherichia coli RN587/1]
 gi|323379267|gb|ADX51535.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           KO11]
 gi|323937997|gb|EGB34259.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           E1520]
 gi|323942807|gb|EGB38972.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           E482]
 gi|323947320|gb|EGB43328.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           H120]
 gi|323953399|gb|EGB49265.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           H252]
 gi|323958198|gb|EGB53907.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           H263]
 gi|323962939|gb|EGB58512.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           H489]
 gi|323967138|gb|EGB62562.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           M863]
 gi|323969607|gb|EGB64894.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           TA007]
 gi|323976722|gb|EGB71810.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           TW10509]
 gi|324116104|gb|EGC10028.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           E1167]
 gi|326338213|gb|EGD62042.1| Outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. 1125]
 gi|326346190|gb|EGD69928.1| Outer membrane lipoprotein carrier protein LolA [Escherichia coli
           O157:H7 str. 1044]
 gi|327253679|gb|EGE65308.1| outer membrane lipocarrier protein LolA [Escherichia coli STEC_7v]
 gi|331065621|gb|EGI37514.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           TA271]
 gi|331080031|gb|EGI51210.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           H299]
 gi|332342280|gb|AEE55614.1| outer membrane lipocarrier protein LolA [Escherichia coli UMNK88]
 gi|332759805|gb|EGJ90108.1| outer membrane lipocarrier protein LolA [Shigella flexneri 4343-70]
 gi|332760553|gb|EGJ90842.1| outer membrane lipocarrier protein LolA [Shigella flexneri 2747-71]
 gi|332762946|gb|EGJ93196.1| outer membrane lipocarrier protein LolA [Shigella flexneri K-671]
 gi|332768069|gb|EGJ98255.1| outer membrane lipocarrier protein LolA [Shigella flexneri 2930-71]
 gi|333006694|gb|EGK26193.1| outer membrane lipocarrier protein LolA [Shigella flexneri VA-6]
 gi|333006989|gb|EGK26484.1| outer membrane lipocarrier protein LolA [Shigella flexneri K-218]
 gi|333008795|gb|EGK28255.1| outer membrane lipocarrier protein LolA [Shigella flexneri K-272]
 gi|333020989|gb|EGK40247.1| outer membrane lipocarrier protein LolA [Shigella flexneri K-304]
          Length = 203

 Score = 72.2 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 23/204 (11%), Positives = 62/204 (30%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +         +     +         +          + +   +F Q+         
Sbjct: 1   MKKI-------AITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F +
Sbjct: 54  QEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  N     Q+   +   ++  +T    +  +              +  +  ++   + S
Sbjct: 114 IARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
             ++   ++N  +D   F     +
Sbjct: 172 SYQLKS-QQNGAVDAAKFTFTPPQ 194


>gi|226330733|ref|ZP_03806251.1| hypothetical protein PROPEN_04653 [Proteus penneri ATCC 35198]
 gi|225201528|gb|EEG83882.1| hypothetical protein PROPEN_04653 [Proteus penneri ATCC 35198]
          Length = 202

 Score = 72.2 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 25/201 (12%), Positives = 61/201 (30%), Gaps = 17/201 (8%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV---- 61
            K V+  V             +       + +   +    + + Q  F Q          
Sbjct: 1   MKKVLFAVCAITLI-------SSQAAWADARQDLQQRLNKVNSFQANFSQTVTSNEGTLI 53

Query: 62  --MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +G   + RP  F ++ ++P   +LISDG  +  YN  ++  +   L     +   + 
Sbjct: 54  QKGEGNLKVQRPDLFNWQMTAPDESTLISDGKTLWFYNPFVEQVTATWLESATTNTPFML 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                  +     V+       +  K +      ++T    + ++  +   +   + S  
Sbjct: 114 IARNDSKEWQNYEVKQTGDRFELTPKVENNLKHFTITV-LPNGQIQQFAATEQDGQVSNY 172

Query: 178 KILKYKENTVLDPKVFEIPYD 198
           ++   +    +D   F     
Sbjct: 173 QLT-AQTAAPIDASAFRFTPP 192


>gi|317486700|ref|ZP_07945517.1| outer membrane lipoprotein carrier protein LolA [Bilophila
           wadsworthia 3_1_6]
 gi|316922083|gb|EFV43352.1| outer membrane lipoprotein carrier protein LolA [Bilophila
           wadsworthia 3_1_6]
          Length = 238

 Score = 72.2 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 16/176 (9%), Positives = 53/176 (30%), Gaps = 14/176 (7%)

Query: 38  KAIEHFLSIQTMQGTFLQ------EDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGS 91
           +  + + S+Q+    F Q        +    +G     +P +  ++  +P +  L+    
Sbjct: 44  EMQKKYESMQSFTAEFTQRLVHQESGSEETRQGTLAFQKPLRVRWETKAPHAELLVITDK 103

Query: 92  NIAVYNAKLDTWSV------YPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD 145
           ++  Y    +          +  R +   +   +            + N   +   +  D
Sbjct: 104 DVWDYLPDEELAYQYSPEVVHDSRSIIQVITGQSRLDKDFTVEAEPDDNGLAVLRLYPKD 163

Query: 146 FMGN--MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                    +  D+ +  +   +I+D     + + +     +  +    F+    +
Sbjct: 164 PSPQLVEALLWVDKGTKLIKKAQILDFYGNTNEVALTSLTPDASIKAGTFQFTPPQ 219


>gi|161614809|ref|YP_001588774.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167550367|ref|ZP_02344124.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|168230854|ref|ZP_02655912.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|168236870|ref|ZP_02661928.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|168240811|ref|ZP_02665743.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|168466545|ref|ZP_02700407.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|168822939|ref|ZP_02834939.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|194445389|ref|YP_002040160.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194448212|ref|YP_002044954.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194472822|ref|ZP_03078806.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194735424|ref|YP_002114013.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197250077|ref|YP_002145879.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197264922|ref|ZP_03164996.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|198243173|ref|YP_002214885.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|200390006|ref|ZP_03216617.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204929937|ref|ZP_03220958.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205358098|ref|ZP_02575793.2| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205360680|ref|ZP_02685526.2| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|238913264|ref|ZP_04657101.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|21759261|sp|Q8ZQD4|LOLA_SALTY RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|189028557|sp|A9N7X9|LOLA_SALPB RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229485837|sp|B5F144|LOLA_SALA4 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229485838|sp|B5FQ34|LOLA_SALDC RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229485839|sp|B4TD22|LOLA_SALHS RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229485840|sp|B4T126|LOLA_SALNS RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|229485848|sp|B4TRS3|LOLA_SALSV RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|161364173|gb|ABX67941.1| hypothetical protein SPAB_02561 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404052|gb|ACF64274.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194406516|gb|ACF66735.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194459186|gb|EDX48025.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194710926|gb|ACF90147.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|195631050|gb|EDX49636.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197213780|gb|ACH51177.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197243177|gb|EDY25797.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|197290136|gb|EDY29493.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|197937689|gb|ACH75022.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|199602451|gb|EDZ00997.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204320931|gb|EDZ06132.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205324546|gb|EDZ12385.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205327465|gb|EDZ14229.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205334643|gb|EDZ21407.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|205340137|gb|EDZ26901.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|205340755|gb|EDZ27519.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|205347716|gb|EDZ34347.1| outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|312911949|dbj|BAJ35923.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|320085198|emb|CBY94984.1| Outer-membrane lipoprotein carrier protein Flags: Precursor
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|321223285|gb|EFX48354.1| Outer membrane lipoprotein carrier protein LolA [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|322616393|gb|EFY13302.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322619643|gb|EFY16518.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322622661|gb|EFY19506.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322628574|gb|EFY25361.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322634945|gb|EFY31674.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322637037|gb|EFY33740.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322641602|gb|EFY38239.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322644443|gb|EFY40983.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322649587|gb|EFY46018.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322654111|gb|EFY50434.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322663500|gb|EFY59702.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322670236|gb|EFY66376.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322671472|gb|EFY67594.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322676828|gb|EFY72895.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322682753|gb|EFY78772.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322686432|gb|EFY82414.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|323199757|gb|EFZ84846.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323202198|gb|EFZ87252.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323209021|gb|EFZ93958.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323222451|gb|EGA06825.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323226866|gb|EGA11049.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323240780|gb|EGA24822.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323243097|gb|EGA27117.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323247419|gb|EGA31375.1| lipoprotein chaperone [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323250913|gb|EGA34790.1| lipoprotein chaperone [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323256444|gb|EGA40178.1| lipoprotein chaperone [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323263110|gb|EGA46652.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323267976|gb|EGA51455.1| lipoprotein chaperone [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323270718|gb|EGA54158.1| lipoprotein chaperone [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 203

 Score = 72.2 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 26/204 (12%), Positives = 64/204 (31%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +         +     +         +          + +   TF Q+         
Sbjct: 1   MKKM-------AIACALLSSVVASSVWADAASSLKSRLDKVSSFHATFTQKVTDGSGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F +
Sbjct: 54  QEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  N     Q+   + + +N  +T    +  +              +  +  ++   + S
Sbjct: 114 IARNQASDWQQYNIKQDGDNFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
             ++   ++N  +DP  F     +
Sbjct: 172 AYQLKS-QQNGAVDPSKFTFTPPQ 194


>gi|33593455|ref|NP_881099.1| outer-membrane lipoprotein carrier protein [Bordetella pertussis
           Tohama I]
 gi|47117176|sp|Q7VW06|LOLA_BORPE RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|33572811|emb|CAE42744.1| putative exported protein [Bordetella pertussis Tohama I]
 gi|332382864|gb|AEE67711.1| outer-membrane lipoprotein carrier protein [Bordetella pertussis
           CS]
          Length = 210

 Score = 72.2 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 22/174 (12%), Positives = 56/174 (32%), Gaps = 12/174 (6%)

Query: 37  KKAIEHFLSIQTMQGTFLQEDAGYVM------KGEFFMARPSKFYFKYSSPSSVSLISDG 90
           ++      +++   G+F Q              G F   RP KF +    P    ++SDG
Sbjct: 31  EQLDTFVATVKGATGSFKQSTVSPQGATQPAQSGTFAFQRPGKFKWAVQLPYEQLIVSDG 90

Query: 91  SNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDF 146
             +  Y+  L   +V  +         +++F   Q     ++  +   +    +  K   
Sbjct: 91  KQVFQYDPDLAQVTVRQVDQAIGTSPAAILFGAGQLSQAFAVSALPDRDGLQWLRAKPRN 150

Query: 147 MG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                  V       +    +++D+  + + +++        +    F+    +
Sbjct: 151 ADAGFSQVDIGLRDNQPARIELVDAFGQTTRVELSNLLPG-AVPASEFQFTPPQ 203


>gi|332091099|gb|EGI96189.1| outer membrane lipocarrier protein LolA [Shigella dysenteriae
           155-74]
          Length = 203

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 23/204 (11%), Positives = 63/204 (30%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +         +     +         +          + +   +F Q+         
Sbjct: 1   MKKI-------AITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F +
Sbjct: 54  QEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  N     Q+   +   ++  +T    +  +           +  +  +  ++   + S
Sbjct: 114 IARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGCDGT--IHQFSAVEQDDQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
             ++   ++N  +D   F     +
Sbjct: 172 SYQLKS-QQNGAVDAAKFTFTPPQ 194


>gi|33602884|ref|NP_890444.1| outer-membrane lipoprotein carrier protein [Bordetella
           bronchiseptica RB50]
 gi|47117181|sp|Q7WCM5|LOLA_BORBR RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|33577326|emb|CAE35883.1| putative exported protein [Bordetella bronchiseptica RB50]
          Length = 210

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 22/174 (12%), Positives = 56/174 (32%), Gaps = 12/174 (6%)

Query: 37  KKAIEHFLSIQTMQGTFLQEDAGYVM------KGEFFMARPSKFYFKYSSPSSVSLISDG 90
           ++      +++   G+F Q              G F   RP KF +    P    ++SDG
Sbjct: 31  EQLDTFVATVKGATGSFKQSTVSPQGATQPAQSGTFAFQRPGKFKWAVQLPYEQLIVSDG 90

Query: 91  SNIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDF 146
             +  Y+  L   +V  +         +++F   Q     ++  +   +    +  K   
Sbjct: 91  KQVFQYDPDLAQVTVRQVDQAIGTSPAAILFGAGQLGQAFAVSALPDRDGLQWLRAKPRN 150

Query: 147 MG-NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                  V       +    +++D+  + + +++        +    F+    +
Sbjct: 151 ADAGFSQVDIGLRDNQPARIELVDAFGQTTRVELSNLLPG-AVPASEFQFTPPQ 203


>gi|284920744|emb|CBG33807.1| outer membrane lipoprotein carrier protein [Escherichia coli 042]
          Length = 203

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 23/204 (11%), Positives = 62/204 (30%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +         +     +         +          + +   +F Q+         
Sbjct: 1   MKKI-------AITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F +
Sbjct: 54  QEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  N     Q+   +   ++  +T    +  +              +  +  ++   + S
Sbjct: 114 IARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
             ++   ++N  +D   F     +
Sbjct: 172 SYQLKS-QQNGTVDAAKFTFTPPQ 194


>gi|163801974|ref|ZP_02195870.1| outer-membrane lipoprotein carrier protein precursor [Vibrio sp.
           AND4]
 gi|159174115|gb|EDP58923.1| outer-membrane lipoprotein carrier protein precursor [Vibrio sp.
           AND4]
          Length = 208

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 21/201 (10%), Positives = 49/201 (24%), Gaps = 11/201 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +  V +  F + +  F+            +  +           F Q+         
Sbjct: 1   MKKLFSVKL--FSALVLSFSLFSTAHAASPKDEFNKRLSMNDGFSADFSQQVISPEGETV 58

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIF 117
              KG   +ARPS F +  + P    L+S+G  +  Y+  ++                + 
Sbjct: 59  MEGKGTVEIARPSLFRWSTTLPDENLLVSNGKTLWYYSPFIEQVSIYWQEQATEQTPFVL 118

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                       ++       T+                     +  + +++   +  + 
Sbjct: 119 LTRNRASDWDNYKISQKGDQFTLIPTALDSTQGQFQISIDAKGVVKGFNVVEQDGQKGLF 178

Query: 178 KILKYKENTVLDPKVFEIPYD 198
                K         F     
Sbjct: 179 TFNNVKLGKP-KADRFTFTIP 198


>gi|86156517|ref|YP_463302.1| outer membrane lipoprotein carrier protein LolA [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85773028|gb|ABC79865.1| outer membrane lipoprotein carrier protein LolA [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 228

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 18/171 (10%), Positives = 50/171 (29%), Gaps = 9/171 (5%)

Query: 38  KAIEHFLSIQTMQGTFLQED------AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGS 91
           K    +   + ++  F Q              G   + +P    + Y  P+  ++   GS
Sbjct: 47  KVQAFYERTRDLEARFRQTYVYAGFGRRQTSSGTLRVKKPGMMRWDYEKPAPKTVAVKGS 106

Query: 92  NIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVE---SNNSFITIFFKDDFMG 148
            +  Y  + +   V      +             + ++  +        + +  K+    
Sbjct: 107 RLVQYEPEENQAYVDEAFDSSAMSAAVTFLLGKGDLLREFDVSLDGAGALLLRPKEADPR 166

Query: 149 NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                       ++   +++D +   + I+    + N  L    FE+   +
Sbjct: 167 VESIALTVAADGQVTATRVVDGAGNANEIRFEDVRRNVGLPDAAFEVKLPR 217


>gi|296116140|ref|ZP_06834758.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295977246|gb|EFG84006.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 207

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 20/179 (11%), Positives = 65/179 (36%), Gaps = 7/179 (3%)

Query: 27  AYPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVS 85
           +  +++   + +   +      +   F+Q    G    G+ +   P +    Y++P+++ 
Sbjct: 30  SATLSQKDEITRVEHYLNDTHGLGAHFVQTWPDGGKGDGKLYYD-PGRLRLDYTTPAAMK 88

Query: 86  LISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVES---NNSFITIFF 142
           L +   ++   + + D+ +   L +    ++     H+    +        N+  I++  
Sbjct: 89  LTAANGHLVFIDPRRDSVTRMSLGHQPLGLLLQQPVHLDGAIVVTAVQHGTNSLQISMAR 148

Query: 143 KDDFMGNMISVTFDR--LSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            D     ++++ F        L+  ++ D  R++  + +            +F +   K
Sbjct: 149 SDSPSQGLLTLGFSDIAGKLSLIAIEMTDVERQHIRLDLDGAHTGPAWPDDLFSLNTSK 207


>gi|320539582|ref|ZP_08039247.1| chaperone for lipoproteins [Serratia symbiotica str. Tucson]
 gi|320030341|gb|EFW12355.1| chaperone for lipoproteins [Serratia symbiotica str. Tucson]
          Length = 203

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 29/200 (14%), Positives = 65/200 (32%), Gaps = 20/200 (10%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----- 60
            K ++    L           A       + +        + +    F Q          
Sbjct: 1   MKKLLVACCLLSGF-------ASTSVLADATQDLQNRLAKVNSFHAHFSQTVTSSDGAAV 53

Query: 61  -VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFSV 115
               GE ++ RP+ F +  +SP    LISDG  +  YN  ++  +   L+       F +
Sbjct: 54  QQGAGELWIKRPNLFNWHMTSPDESVLISDGQTLWFYNPFVEQVTATWLKNATGKTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  NN +  ++   + + ++  +T       +           S  + ++  ++   + S
Sbjct: 114 ITRNNANDWKQYQVKQKGDDFELTPKSSSGNLKQFAITV--THSGTIRSFAAVEQDGQRS 171

Query: 176 IIKILKYKENTVLDPKVFEI 195
              +   +++   D   F  
Sbjct: 172 TYVLKS-QQDVSADATKFTF 190


>gi|262394649|ref|YP_003286503.1| outer membrane lipoprotein carrier protein LolA [Vibrio sp. Ex25]
 gi|262338243|gb|ACY52038.1| outer membrane lipoprotein carrier protein LolA [Vibrio sp. Ex25]
          Length = 208

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 22/200 (11%), Positives = 52/200 (26%), Gaps = 11/200 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K      +  F + +   +            +  +     +     F Q+         
Sbjct: 1   MKKRFSAKL--FSALVLSVSFFSAANAASPKDELNKRLAMNEGFSADFSQQVISPEGETV 58

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIF 117
              +G   +ARPS F +  + P    L+SDG  +  Y+  ++                + 
Sbjct: 59  MEGEGTVEIARPSLFRWSTTFPDENLLVSDGKTLWYYSPFIEQVSIYWQEQATEQTPFVL 118

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                       ++    +  T+                     +  + +++   +  + 
Sbjct: 119 LTRNRASDWDNYKISQKGNEFTLIPTAIDSTQGQFQINIDAKGVVKGFNVIEQDGQKGLF 178

Query: 178 KILKYKEN-TVLDPKVFEIP 196
                K     +D   F IP
Sbjct: 179 TFSNVKLGKPKVDRFTFTIP 198


>gi|332704126|ref|ZP_08424214.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           africanus str. Walvis Bay]
 gi|332554275|gb|EGJ51319.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           africanus str. Walvis Bay]
          Length = 216

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 25/207 (12%), Positives = 61/207 (29%), Gaps = 18/207 (8%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K     +   F   +   +A      ++  ++  + + +++  +  F QE         
Sbjct: 1   MKRFFIALGAVFILVVVSSSAQS----EEITRRIQQQYETLKGFKAGFTQELTNAATGEV 56

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP-----LRYMAFS 114
              +G     +PS   ++   P    LI   + +  Y +  +    YP            
Sbjct: 57  EKRRGTIAFMQPSLIRWETVEPEKELLIVGENAVWDYFSDDNLVIKYPLAQVLNSKTMIR 116

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMIS---VTFDRLSYRLLNWKIMDSS 171
            +    +     ++      +  I I          +    +  D  +Y + +  +MD  
Sbjct: 117 FLSGKARFEEDFAVANQGEESGLIKIRLDPKEPEPSLVLAYIWLDPKTYLIRSVLLMDFY 176

Query: 172 RRYSIIKILKYKENTVLDPKVFEIPYD 198
              + + +   + N VL    F     
Sbjct: 177 GNANQVNLRDLELNPVLSRSYFHFTPP 203


>gi|324113812|gb|EGC07787.1| outer membrane lipoprotein carrier protein LolA [Escherichia
           fergusonii B253]
 gi|332088849|gb|EGI93961.1| outer membrane lipocarrier protein LolA [Shigella boydii 5216-82]
          Length = 203

 Score = 71.8 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 23/204 (11%), Positives = 62/204 (30%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +         +     +         +          + +   +F Q+         
Sbjct: 1   MKKI-------AITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F +
Sbjct: 54  QEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKNATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  N     Q+   +   ++  +T    +  +              +  +  ++   + S
Sbjct: 114 IARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
             ++   ++N  +D   F     +
Sbjct: 172 SYQLKS-QQNGAVDAAKFTFTPPQ 194


>gi|304397060|ref|ZP_07378939.1| outer membrane lipoprotein carrier protein LolA [Pantoea sp. aB]
 gi|308186246|ref|YP_003930377.1| Outer-membrane lipoprotein carrier protein precursor [Pantoea
           vagans C9-1]
 gi|304355209|gb|EFM19577.1| outer membrane lipoprotein carrier protein LolA [Pantoea sp. aB]
 gi|308056756|gb|ADO08928.1| Outer-membrane lipoprotein carrier protein precursor [Pantoea
           vagans C9-1]
          Length = 203

 Score = 71.5 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 26/193 (13%), Positives = 65/193 (33%), Gaps = 13/193 (6%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM------KGEFFMAR 70
             +       +       +     +    + +   +F Q+            +GE ++ R
Sbjct: 5   VIALGLLATFSSASVLADASSDLQQRLNKVSSFHASFTQKVTDSSGANVQDGEGELWVKR 64

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQHVIQE 126
           PS F +  ++P    +ISDG ++  YN  ++  +            F +I  N  +  ++
Sbjct: 65  PSLFNWHMTAPDESIIISDGKSLWFYNPFVEQATVSLLQNATSNTPFMLIARNQSNDWKQ 124

Query: 127 SIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
              + + +N  +T    D  +           +     +  ++   + S  ++   ++N 
Sbjct: 125 YNIKQQGDNFELTPKNSDGNLKQFTIQVTSSGTIN--RFSAIEQDGQRSDYQLKS-QQNG 181

Query: 187 VLDPKVFEIPYDK 199
            + P  F     K
Sbjct: 182 AISPDKFTFTPPK 194


>gi|260776358|ref|ZP_05885253.1| outer membrane lipoprotein carrier protein LolA [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607581|gb|EEX33846.1| outer membrane lipoprotein carrier protein LolA [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 198

 Score = 71.5 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 25/202 (12%), Positives = 50/202 (24%), Gaps = 21/202 (10%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGY-- 60
            K +  +  L F                    +  +           F Q      G   
Sbjct: 1   MKKLAALFFLSFSVI------------AAPKDELGQRLQLTDGFSADFSQQLISPEGEML 48

Query: 61  -VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIF 117
              +G+  +ARPS F +  +SP    L+SDG ++  Y+  ++                + 
Sbjct: 49  TEGEGKVEIARPSLFRWTTTSPDENVLVSDGESLWYYSPFIEQVSIYWQEQATEQTPFVL 108

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                       +V       T+                     +  + +++   + S  
Sbjct: 109 LTRNRASDWENYKVSQQGDVFTLVPTAVDTNQGQFKLEIDGKGAVKGFSVIEQDGQKSTF 168

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
           K    K         F     +
Sbjct: 169 KFNNIKL-AKPSADRFTFTIPE 189


>gi|161503913|ref|YP_001571025.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865260|gb|ABX21883.1| hypothetical protein SARI_02003 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 204

 Score = 71.5 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 21/203 (10%), Positives = 60/203 (29%), Gaps = 16/203 (7%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K +         +     +         +          + +   +F Q+        
Sbjct: 1   MMKKM-------AIACALLSSVVVSSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAA 53

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VI 116
               +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +   L+    +   +
Sbjct: 54  VQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFM 113

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
                         ++ +     +  K                  +  +  ++   + S 
Sbjct: 114 LIARNQSSDWQQYNIKQDGDNFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSA 173

Query: 177 IKILKYKENTVLDPKVFEIPYDK 199
            ++   ++N  +DP  F     +
Sbjct: 174 YQLKS-QQNGAVDPSKFTFTPPQ 195


>gi|332097218|gb|EGJ02201.1| outer membrane lipocarrier protein LolA [Shigella boydii 3594-74]
 gi|333020321|gb|EGK39587.1| outer membrane lipocarrier protein LolA [Shigella flexneri K-227]
          Length = 207

 Score = 71.5 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 22/194 (11%), Positives = 60/194 (30%), Gaps = 13/194 (6%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMA 69
              +     +         +          + +   +F Q+            +G+ ++ 
Sbjct: 8   IAITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVK 67

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQ 125
           RP+ F +  + P    L+SDG  +  YN  ++  +            F +I  N     Q
Sbjct: 68  RPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQ 127

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +   +   ++  +T    +  +              +  +  ++   + S  ++   ++N
Sbjct: 128 QYNIKQNGDDFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQRSSYQLKS-QQN 184

Query: 186 TVLDPKVFEIPYDK 199
             +D   F     +
Sbjct: 185 GAVDAAKFTFTPPQ 198


>gi|311280199|ref|YP_003942430.1| outer membrane lipoprotein carrier protein LolA [Enterobacter
           cloacae SCF1]
 gi|308749394|gb|ADO49146.1| outer membrane lipoprotein carrier protein LolA [Enterobacter
           cloacae SCF1]
          Length = 203

 Score = 71.5 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 24/204 (11%), Positives = 61/204 (29%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +         +     +         +          + +   +F Q+         
Sbjct: 1   MKKI-------AITCALLTSFVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGNAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F +
Sbjct: 54  QDGQGDLWVKRPNLFNWHMTQPDESVLVSDGKTLWFYNPFVEQATATWLKDATSNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  N     Q+   +   ++  +T       +              +  +  ++   + S
Sbjct: 114 IARNQSSDWQQYNIKQNGDDFVLTPKGSSGNLKQFTINV--GRDGTIHQFSAVEQDEQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
             ++   ++N  +D   F     K
Sbjct: 172 SYQLKS-QQNGAVDASKFSFTPPK 194


>gi|153002969|ref|YP_001377294.1| outer membrane lipoprotein carrier protein LolA [Anaeromyxobacter
           sp. Fw109-5]
 gi|152026542|gb|ABS24310.1| outer membrane lipoprotein carrier protein LolA [Anaeromyxobacter
           sp. Fw109-5]
          Length = 207

 Score = 71.5 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 22/178 (12%), Positives = 52/178 (29%), Gaps = 9/178 (5%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQEDA------GYVMKGEFFMARPSKFYFKYSSPSSV 84
              Q  +K    +   + ++  F Q           V  G   + +P    + Y +P+  
Sbjct: 18  DAGQLARKVQTFYERTRDLEARFQQTYTYSGFGRRQVSAGTLKVKKPGMMRWDYETPAPK 77

Query: 85  SLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRV---ESNNSFITIF 141
           ++   GS +  +  + +   V                    +  +           + + 
Sbjct: 78  TVAVKGSRLVQFEPEENQAYVDERFDATAMSAAVTFLLGKGDLAREFGLSTDGTGALVLR 137

Query: 142 FKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            K++                +   +++D +   + I+  K K N  L    FE+   K
Sbjct: 138 PKEEDPRVESIALTVGPDGEVRATRVVDGAGNVNEIRFEKVKRNAGLPDGAFEVKLPK 195


>gi|298530194|ref|ZP_07017596.1| outer membrane lipoprotein carrier protein LolA
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509568|gb|EFI33472.1| outer membrane lipoprotein carrier protein LolA
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 206

 Score = 71.5 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 42/206 (20%), Positives = 77/206 (37%), Gaps = 21/206 (10%)

Query: 9   VIGVVILFFYSAIFPFNA--AYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGY 60
           +I   +  F   + PF             ++K  E   SIQT+ G+F+Q+      D   
Sbjct: 1   MIKSALALFVFILMPFTGWGKDQSIPADVLEKLHEIHDSIQTVSGSFVQKKHLDVFDQTL 60

Query: 61  VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-FSVIFSN 119
           V +G F + RP +  + Y  PS     SDG  +  ++ +       PL      SVI   
Sbjct: 61  VSRGSFAIDRPGRIRWAYEEPSVFGFSSDGLQVRRWSEESGMSQSAPLSRDPVLSVIVDQ 120

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD------------FMGNMISVTFDRLSYRLLNWKI 167
                   +Q +E + S      +               + + + ++FD  S  +   +I
Sbjct: 121 MLAWSTMDLQAIEDHFSLTLAESEPMVLELEPEAKELRDIISKVLISFDSTSTHIEKIRI 180

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVF 193
           ++     + I+  +   N  LD ++F
Sbjct: 181 LEHDSDRTNIRFEEVSLNQDLDHELF 206


>gi|170726828|ref|YP_001760854.1| outer membrane lipoprotein carrier protein LolA [Shewanella woodyi
           ATCC 51908]
 gi|229485841|sp|B1KG52|LOLA_SHEWM RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|169812175|gb|ACA86759.1| outer membrane lipoprotein carrier protein LolA [Shewanella woodyi
           ATCC 51908]
          Length = 208

 Score = 71.1 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 31/201 (15%), Positives = 64/201 (31%), Gaps = 15/201 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            +  +  ++L              +               I T++  F Q          
Sbjct: 1   MRKTLTALMLSLPLLT------PHMAFADESSVLKAKLTEIATLKAKFEQTVTDINNKQI 54

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G F +A P++FY+  ++P    +++DG+++ +YN   +  SV  L     +  +  
Sbjct: 55  QKGSGIFALAYPNQFYWHLTAPDESLIVADGTDVWIYNPFAEEVSVMDLNQAISASPIAL 114

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             ++     S   V S+N    I  K      + SV        L    + D     S  
Sbjct: 115 LVHRDEETWSQYSVTSDNGCFNIKPKSIDA-GVESVKVCFDDKTLTEMVLQDQQGNVSQF 173

Query: 178 KILKYKENTVLDPKVFEIPYD 198
            + +       +  +F+    
Sbjct: 174 TLSEQTAIDDAERAMFKFTVP 194


>gi|94268730|ref|ZP_01291268.1| Outer membrane lipoprotein carrier protein LolA [delta
           proteobacterium MLMS-1]
 gi|93451486|gb|EAT02317.1| Outer membrane lipoprotein carrier protein LolA [delta
           proteobacterium MLMS-1]
          Length = 237

 Score = 71.1 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 19/179 (10%), Positives = 51/179 (28%), Gaps = 18/179 (10%)

Query: 38  KAIEHFLSIQTMQGTFLQED------AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGS 91
           +  E + +  + +  F Q             +G     +P    ++Y  P    L+ DG 
Sbjct: 51  RLQETYDATGSFRADFRQRTAVPMSRRQREGEGSVIFKKPHLMRWEYEKPERQVLVGDGE 110

Query: 92  NIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVES------------NNSFIT 139
            + +Y A+ +   +  +     S +         + ++  E              +    
Sbjct: 111 QVRMYFARSNQMMIQEVEDYLESDVTYAFFSGSGDLLRDFEVAAVPPGEALAEPGHQLRL 170

Query: 140 IFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           +          + +  +  SY +    I+D     + +     + +  L    +     
Sbjct: 171 LPRDIHPQVEYLDILVEPESYLIRRLDIVDHFGSVTTLIFSNIELDPELAADFYRFEPP 229


>gi|319776485|ref|YP_004138973.1| outer-membrane lipoprotein carrier protein [Haemophilus influenzae
           F3047]
 gi|319897262|ref|YP_004135457.1| outer-membrane lipoprotein carrier protein [Haemophilus influenzae
           F3031]
 gi|329123992|ref|ZP_08252539.1| outer membrane lipoprotein carrier protein LolA [Haemophilus
           aegyptius ATCC 11116]
 gi|317432766|emb|CBY81131.1| outer-membrane lipoprotein carrier protein [Haemophilus influenzae
           F3031]
 gi|317451076|emb|CBY87309.1| outer-membrane lipoprotein carrier protein [Haemophilus influenzae
           F3047]
 gi|327467417|gb|EGF12915.1| outer membrane lipoprotein carrier protein LolA [Haemophilus
           aegyptius ATCC 11116]
          Length = 205

 Score = 71.1 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 19/174 (10%), Positives = 51/174 (29%), Gaps = 9/174 (5%)

Query: 34  QSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSPSSVSLI 87
            +  +       +  +   F+Q              G+  + RP+ F  +  +P    +I
Sbjct: 23  DAASELQMRLAKVDVLSAEFVQTVTSGSGKNVQQGSGKLQIKRPNLFRMETKTPQETQII 82

Query: 88  SDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRVESNNSFITIFFKDD 145
           SDG  +  Y+  +   +   ++    +   +   +          V   +    +     
Sbjct: 83  SDGKTLWFYDPFVQQVTAQWVKNAVNNTPFVLLTSNDNSHWHQYTVTQQSDTFVLKPTLS 142

Query: 146 FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                        +  L N+   +   + ++  +     N  L   +F+   +K
Sbjct: 143 TSNIKQFDIRVDANGILRNFSTTEKDGQTNLYVLRNI-TNQTLSDSLFQFKPEK 195


>gi|119774908|ref|YP_927648.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           amazonensis SB2B]
 gi|189028558|sp|A1S6H2|LOLA_SHEAM RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|119767408|gb|ABL99978.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           amazonensis SB2B]
          Length = 203

 Score = 71.1 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 30/204 (14%), Positives = 73/204 (35%), Gaps = 22/204 (10%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY---- 60
           + KS++ +       A+F              K+ +     +Q ++  F Q+        
Sbjct: 1   MKKSIVVLFSAVLPFAVF----------ADDAKELVSKLDVMQGIKANFSQKVTDQNGKL 50

Query: 61  --VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY----MAFS 114
                G   M +P  FY+  ++P    +++  +++ VYN   +  S+  +         +
Sbjct: 51  IQEGSGVIAMHQPDAFYWHLTAPDESLIVAKDNSVWVYNPFAEEVSILDMEDILKASPMA 110

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           ++   ++    E     + +   IT     +   + +SV F   +  L + ++ D+    
Sbjct: 111 LLVHRDEKRWNEYQIDRKGSCFDITPRQGVESAVDTVSVCFANNT--LSDIRLTDAQGST 168

Query: 175 SIIKILKYKENTVLDPKVFEIPYD 198
           S   + +    T  D  +F+    
Sbjct: 169 SHFSLSEQAAVTDADESLFQFQIP 192


>gi|327393323|dbj|BAK10745.1| outer-membrane lipoprotein carrier protein precursor LolA [Pantoea
           ananatis AJ13355]
          Length = 203

 Score = 71.1 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 23/191 (12%), Positives = 58/191 (30%), Gaps = 9/191 (4%)

Query: 17  FYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMAR 70
             +               +     +    + +   +F Q+            +GE ++ R
Sbjct: 5   VIALGLLAALGSASAFADASSDLQQRLNKVNSFHASFTQKVTDGSGANVQDGEGELWVKR 64

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESI 128
           PS F +  ++P    ++SDG ++  YN  ++  +V  L+    +   +            
Sbjct: 65  PSLFNWHMTAPDESVIVSDGKSLWFYNPFVEQATVSLLKNATSNTPFMLIARNQSSDWQQ 124

Query: 129 QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
             V+       +  K                  +  +  ++   + S  ++   ++N  +
Sbjct: 125 YNVKQQGDKFELTPKKSDGNLKQFTIDVTPDGTINQFSAVEQDGQRSNYQLKS-QKNGPI 183

Query: 189 DPKVFEIPYDK 199
            P  F     K
Sbjct: 184 SPDKFTFTPPK 194


>gi|45435902|gb|AAS61459.1| putative outer-membrane lipoproteins carrier protein [Yersinia
           pestis biovar Microtus str. 91001]
          Length = 189

 Score = 71.1 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 27/182 (14%), Positives = 60/182 (32%), Gaps = 13/182 (7%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------VMKGEFFMARPSKFYFKYSSP 81
                  +          + +   +F Q             +GE ++ RP+ F +  +SP
Sbjct: 3   SASALADASTDLQNRLSKVNSFHASFSQAVTSSDGAVVQEGEGELWVKRPNLFNWHMTSP 62

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQESIQRVESNNSF 137
               LISDG  +  YN  ++  +            F +I  NN    ++   + + ++  
Sbjct: 63  DESVLISDGETLWFYNPFVEQATATWLKNATGNTPFMLITRNNPDDWKQYNVKQKGDDFE 122

Query: 138 ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
           +T       +           S  + ++  ++   + S   +   +  +V+D   F    
Sbjct: 123 LTPKSASGNLKQFAISV--TPSGTIKSFTAVEQDGQRSAYTLKSQQS-SVVDASKFTFTP 179

Query: 198 DK 199
            K
Sbjct: 180 PK 181


>gi|290473947|ref|YP_003466821.1| periplasmic chaperone effects translocation of lipoproteins from
           inner membrane to outer membrane [Xenorhabdus bovienii
           SS-2004]
 gi|289173254|emb|CBJ80029.1| periplasmic chaperone effects translocation of lipoproteins from
           inner membrane to outer membrane [Xenorhabdus bovienii
           SS-2004]
          Length = 202

 Score = 71.1 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 23/202 (11%), Positives = 63/202 (31%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY----- 60
            K ++                +       + +        + +   +F+Q          
Sbjct: 1   MKKLM-------LIGCLMMGVSVGTAWADASQDLQGRLGKVNSFHASFIQTVTSSDGSAI 53

Query: 61  -VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +G+ ++ RP+ F +  ++P    L+SDG  +  YN  ++  +   L+  A +   + 
Sbjct: 54  QNGEGQLWVKRPNLFNWHMTAPDESVLVSDGKTLWFYNPFVEQVTANWLKDAAGNTPFML 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                        V  N +   +   +                 +  +  ++   + S  
Sbjct: 114 IARNDSADWKQYNVVQNGNNFELTPSNANGNLKHFSITVTPEGTIQKFTAVEQDGQKSAY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
           ++   ++NT +D   F+    +
Sbjct: 174 QLKG-QQNTRVDESKFKFTMPE 194


>gi|58617571|ref|YP_196770.1| hypothetical protein ERGA_CDS_08440 [Ehrlichia ruminantium str.
           Gardel]
 gi|58417183|emb|CAI28296.1| Hypothetical protein ERGA_CDS_08440 [Ehrlichia ruminantium str.
           Gardel]
          Length = 204

 Score = 71.1 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 76/188 (40%), Gaps = 3/188 (1%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV--MKGEF 66
           +  + +L     I    +    T +     ++ +F +I++ +  F+Q  +       G  
Sbjct: 9   IFCLAVLLNSYYICNAYSINTKTDNTVKTNSLTYFDAIRSFKADFMQISSSEDIPRYGYV 68

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE 126
            M +P    + Y  P+ VS++  G+ I+ Y+ +L+ +S   +      ++ S+ +++   
Sbjct: 69  LMKKPGLLKWDYYPPTPVSIVIKGTTISYYDRELEEYSYTIVNNPIIGLLSSDIKNISTI 128

Query: 127 SIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
               +++ N+   +   D        V F+     ++   I++     + I+      N 
Sbjct: 129 DFINIDTVNNQKIVTLHDKKSDLYAEVIFNTDPITIVGLNILNP-DSKTSIQFYNISSNI 187

Query: 187 VLDPKVFE 194
            +D + F+
Sbjct: 188 PIDKREFK 195


>gi|322421530|ref|YP_004200753.1| outer membrane lipoprotein carrier protein LolA [Geobacter sp. M18]
 gi|320127917|gb|ADW15477.1| outer membrane lipoprotein carrier protein LolA [Geobacter sp. M18]
          Length = 204

 Score = 71.1 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/183 (12%), Positives = 57/183 (31%), Gaps = 19/183 (10%)

Query: 30  ITKDQSVKKAIEHFLSIQTMQGTFLQED------AGYVMKGEFFMARPSKFYFKYSSPSS 83
               Q ++       S++T+   F+QE            KG F+ A+P +  ++ ++P  
Sbjct: 22  PASPQLLESLERSAGSVKTLSSDFVQEKHLSMFKNVMTSKGRFYFAKPDQLRWELTAPVC 81

Query: 84  VSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFK 143
              +  G     ++ +      + +       + S        S          IT+  +
Sbjct: 82  SGFVLKGDKGRRWHERTGRTESFQISQEPVMKLVSEQLFAWARSDFAWLKKEYRITVLQE 141

Query: 144 DD-------------FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
                             + + + F      + + ++ +    ++ I+ +    N  L  
Sbjct: 142 SPVSLRLEPRSAATAGFLHHLQIGFSADGRYVRSVELHEKDGDFTRIRFVNTSVNRQLPA 201

Query: 191 KVF 193
            +F
Sbjct: 202 DIF 204


>gi|57239533|ref|YP_180669.1| hypothetical protein Erum8060 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579517|ref|YP_197729.1| hypothetical protein ERWE_CDS_08530 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161612|emb|CAH58540.1| putative exported protein [Ehrlichia ruminantium str. Welgevonden]
 gi|58418143|emb|CAI27347.1| Hypothetical protein ERWE_CDS_08530 [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 204

 Score = 70.7 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/188 (14%), Positives = 76/188 (40%), Gaps = 3/188 (1%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV--MKGEF 66
           +  + +L     I    +    T +     ++ +F ++++ +  F+Q  +       G  
Sbjct: 9   IFCLAVLLNSYYICNAYSINTKTDNTVKTNSLTYFDAVRSFKADFMQISSSEDIPRYGYV 68

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQE 126
            M +P    + Y  P+ VS++  G+ I+ Y+ +L+ +S   +      ++ S+ +++   
Sbjct: 69  LMKKPGLLKWDYYPPTPVSIVIKGTTISYYDRELEEYSYTIVNNPIIGLLSSDIKNISTI 128

Query: 127 SIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENT 186
               +++ N+   +   D        V F+     ++   I++     + I+      N 
Sbjct: 129 DFINIDTVNNQKIVTLHDKKSDLYAEVIFNTDPITIVGLNILNP-DSKTSIQFYNISSNI 187

Query: 187 VLDPKVFE 194
            +D + F+
Sbjct: 188 PIDKREFK 195


>gi|220915227|ref|YP_002490531.1| outer membrane lipoprotein carrier protein LolA [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219953081|gb|ACL63465.1| outer membrane lipoprotein carrier protein LolA [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 226

 Score = 70.7 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 54/171 (31%), Gaps = 9/171 (5%)

Query: 38  KAIEHFLSIQTMQGTFLQ--EDAG----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGS 91
           K    +   + ++  F Q    AG        G   + +P    + Y  P++ ++   GS
Sbjct: 45  KVQAFYERTRDLEARFRQAYTYAGFGRRQTSSGTLRVKKPGMMRWDYEKPAAKTVAVKGS 104

Query: 92  NIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVE---SNNSFITIFFKDDFMG 148
            +  Y  + +   V      +             + ++  +     +  + +  K+    
Sbjct: 105 RLVQYEPEENQAYVDEAFDSSAMSAAVTFLLGKGDLLREFDVSLDGSGALLLRPKESDPR 164

Query: 149 NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                       ++   +++D +   + I+    + N  L    FE+   +
Sbjct: 165 VESIALTVAADGQVTATRVVDGAGNANEIRFEDVRRNVGLPDAAFEVKLPR 215


>gi|197120516|ref|YP_002132467.1| outer membrane lipoprotein carrier protein LolA [Anaeromyxobacter
           sp. K]
 gi|196170365|gb|ACG71338.1| outer membrane lipoprotein carrier protein LolA [Anaeromyxobacter
           sp. K]
          Length = 226

 Score = 70.7 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 54/171 (31%), Gaps = 9/171 (5%)

Query: 38  KAIEHFLSIQTMQGTFLQ--EDAG----YVMKGEFFMARPSKFYFKYSSPSSVSLISDGS 91
           K    +   + ++  F Q    AG        G   + +P    + Y  P++ ++   GS
Sbjct: 45  KVQAFYERTRDLEARFRQAYTYAGFGRRQTSSGTLRVKKPGMMRWDYEKPAAKTVAVKGS 104

Query: 92  NIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVE---SNNSFITIFFKDDFMG 148
            +  Y  + +   V      +             + ++  +     +  + +  K+    
Sbjct: 105 RLVQYEPEENQAYVDEAFDSSAMSAAVTFLLGKGDLLREFDVSLDGSGALLLRPKESDPR 164

Query: 149 NMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                       ++   +++D +   + I+    + N  L    FE+   +
Sbjct: 165 VESIALTVAADGQVTATRVVDGAGNANEIRFEDVRRNVGLPDAAFEVKLPR 215


>gi|157146421|ref|YP_001453740.1| outer-membrane lipoprotein carrier protein [Citrobacter koseri ATCC
           BAA-895]
 gi|157083626|gb|ABV13304.1| hypothetical protein CKO_02180 [Citrobacter koseri ATCC BAA-895]
          Length = 204

 Score = 70.7 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/205 (10%), Positives = 62/205 (30%), Gaps = 20/205 (9%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K +         +               +          + +   +F Q+        
Sbjct: 1   MMKKI-------AITCALLSGFVVSSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAA 53

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFS 114
               +G+ ++ RP+ F +  + P    L+SDG  +  +N  ++  +            F 
Sbjct: 54  VQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFFNPFVEQATATWLKDATGNTPFM 113

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           +I  N     Q+   +   ++  +T       +              +  +  ++   + 
Sbjct: 114 LIARNQSSDWQQYNIKQNGDDFVLTPKSSSGNLKQFTINV--GRDGTIHQFSAVEQDDQR 171

Query: 175 SIIKILKYKENTVLDPKVFEIPYDK 199
           S  ++   ++N+ +D   F     +
Sbjct: 172 SSYQLKS-QQNSAVDASKFTFTPPQ 195


>gi|90413224|ref|ZP_01221219.1| hypothetical outer membrane lipoproteins carrier protein
           [Photobacterium profundum 3TCK]
 gi|90325776|gb|EAS42234.1| hypothetical outer membrane lipoproteins carrier protein
           [Photobacterium profundum 3TCK]
          Length = 205

 Score = 70.7 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/204 (14%), Positives = 64/204 (31%), Gaps = 16/204 (7%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM- 62
           ++ K++IG         +               ++       +      F Q+       
Sbjct: 1   MIKKAMIG-------LFLAAPLVLSSAAWANPQQELSSRLSLVNAFSANFDQKVVSPEGD 53

Query: 63  -----KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--V 115
                KG+  + RP+ F +   +P    L+SDG  +  Y+  ++  +   L+        
Sbjct: 54  VLVEGKGDVTIKRPNLFRWNTVTPDENLLVSDGKTLWYYSPFIEQVTAMWLKDATEQTPF 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           +          +   V   +   T+  KD        V     S  + N+ +++   + S
Sbjct: 114 VLLTRNSASDWANYNVAQTSDTFTLTPKDTTSTMGKFVVTVAKSGEVRNFSVVEQDGQRS 173

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
             K  ++ +  V    +F     K
Sbjct: 174 NFKFRQFSK-QVPKANLFTFTPPK 196


>gi|254496576|ref|ZP_05109444.1| truncated outer membrane lipoprotein carrier protein [Legionella
           drancourtii LLAP12]
 gi|254354200|gb|EET12867.1| truncated outer membrane lipoprotein carrier protein [Legionella
           drancourtii LLAP12]
          Length = 146

 Score = 70.7 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/139 (15%), Positives = 51/139 (36%), Gaps = 5/139 (3%)

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----FSVIFSNN 120
             + RP +F ++   P +  +I+DG  I VY+  L+  +V   +          +   ++
Sbjct: 1   MALERPGRFRWQTKEPMAQLMIADGQRIWVYDTDLEQVTVKKQQKGLGGTAALFLSGYDD 60

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
                 ++ +  S N             N   +        L+  ++ D   + + +++ 
Sbjct: 61  TVTRDFTVSQSGSGNELSFDLKSKSAKANFQRIRLMFRQNLLVGLELFDQLGQVTTVQLS 120

Query: 181 KYKENTVLDPKVFEIPYDK 199
           + K N  L   +F+    K
Sbjct: 121 QAKLNPKLAAALFQFKPPK 139


>gi|293409269|ref|ZP_06652845.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           B354]
 gi|331662306|ref|ZP_08363229.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           TA143]
 gi|291469737|gb|EFF12221.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           B354]
 gi|331060728|gb|EGI32692.1| outer membrane lipoprotein carrier protein LolA [Escherichia coli
           TA143]
          Length = 203

 Score = 70.7 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/204 (10%), Positives = 62/204 (30%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +         +     +         +          + +   +F Q+         
Sbjct: 1   MKKI-------AITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F +
Sbjct: 54  QEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  N     Q+   +   ++  +T    +  +              +  +  ++   + S
Sbjct: 114 IARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
             ++   ++N  ++   F     +
Sbjct: 172 SYQLKS-QQNGAVEAAKFTFTPPQ 194


>gi|268590185|ref|ZP_06124406.1| outer membrane lipoprotein carrier protein LolA [Providencia
           rettgeri DSM 1131]
 gi|291314465|gb|EFE54918.1| outer membrane lipoprotein carrier protein LolA [Providencia
           rettgeri DSM 1131]
          Length = 206

 Score = 70.7 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/202 (12%), Positives = 62/202 (30%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K ++              +         + +   E    + + Q +F Q+         
Sbjct: 1   MKKMM-------LLGALALSLHIGQVLADASQDLQERLNKVNSFQASFSQKVTSPEGDLV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G+ ++ RP+ F +  +SP    L+SDG ++  YN  ++  +V  L         + 
Sbjct: 54  QEGVGDLWLERPNLFNWNMTSPDESVLVSDGKDLWFYNPFVEQVTVTNLADATQDTPFLL 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                        +    +   +  K                  +  +  ++   + S  
Sbjct: 114 ITRNDPKDWKQYSIIQQGNTFDLKPKQTNGTLKRFSITVSPEGTIEQFSAVEQDGQTSAY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
           ++ + ++N  +D   F+    K
Sbjct: 174 QLKE-QKNGRVDASKFKFTVPK 194


>gi|213162239|ref|ZP_03347949.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|21759259|sp|Q8Z813|LOLA_SALTI RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
          Length = 203

 Score = 70.7 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/204 (12%), Positives = 64/204 (31%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +         +     +         +          + +   TF Q+         
Sbjct: 1   MKKM-------AIACALLSSVVASSVWADAASSLKSRLDKVSSFHATFTQKVTDGSGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F +
Sbjct: 54  QEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  N     Q+   + + +N  +T    +  +              +  +  ++   + S
Sbjct: 114 IARNQASDWQQYNIKQDGDNFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
             ++   ++N  ++P  F     +
Sbjct: 172 AYQLKS-QQNGAVEPSKFTFTPPQ 194


>gi|242239685|ref|YP_002987866.1| outer-membrane lipoprotein carrier protein [Dickeya dadantii
           Ech703]
 gi|242131742|gb|ACS86044.1| outer membrane lipoprotein carrier protein LolA [Dickeya dadantii
           Ech703]
          Length = 204

 Score = 70.3 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 64/204 (31%), Gaps = 17/204 (8%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY--- 60
           +L K ++   +L         +         +          + +    F Q+ +G    
Sbjct: 1   MLKKWLMAGCLL--------SSVISGAALADAAGDLQSRLSKVNSFHAGFTQKVSGSDGG 52

Query: 61  ---VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--V 115
                +GE ++ RP+ F +K ++P    L+SDG  +  YN  ++  +   ++    +   
Sbjct: 53  TVQEGQGELWVKRPNLFNWKTTAPDESLLVSDGKTLWFYNPFVEQATATWVKDATGNTPF 112

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I          S   V  N     +  +                  +  +   +   + S
Sbjct: 113 ILITRNDPKDWSKYNVTRNGDDFQLVPRAASGNLKQFAISVTGDGTIKGFTATEQDGQRS 172

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
           +  +   ++N  +D   F     K
Sbjct: 173 VYTLKN-QQNGDVDSAKFHFTPPK 195


>gi|319943869|ref|ZP_08018150.1| outer membrane lipoprotein carrier protein LolA [Lautropia
           mirabilis ATCC 51599]
 gi|319743102|gb|EFV95508.1| outer membrane lipoprotein carrier protein LolA [Lautropia
           mirabilis ATCC 51599]
          Length = 232

 Score = 70.3 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/182 (13%), Positives = 53/182 (29%), Gaps = 12/182 (6%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQE-------DAGYVMKGEFFMARPSKFYFKYSSP 81
              + Q + +            GTF+Q               G F  ARP  F ++   P
Sbjct: 44  TAAQGQGIAQLRRFATRTPAATGTFVQTQLAGGGRGGAARSSGSFAFARPGNFRWEIDKP 103

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQESIQRVESNNSF 137
               +++DG  +  Y+  L   +V      ++    +V+F          +  V   N  
Sbjct: 104 DPQLIVTDGKKLYFYDEGLRQVTVREASEAIQATPAAVLFGVGDLDEAFKLSEVGQYNGV 163

Query: 138 -ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
                           +         +  +++D+  + +  +  K   N  +  + F   
Sbjct: 164 AWVEAVPRSADSGFDRIRIGMRDGLPVVMEVVDAFGQINRFEFSKLATNERIPAERFHFK 223

Query: 197 YD 198
             
Sbjct: 224 VP 225


>gi|24373859|ref|NP_717902.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           oneidensis MR-1]
 gi|47117231|sp|Q8EER2|LOLA_SHEON RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|24348270|gb|AAN55346.1|AE015672_2 outer membrane lipoprotein carrier protein LolA [Shewanella
           oneidensis MR-1]
          Length = 206

 Score = 70.3 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/190 (11%), Positives = 59/190 (31%), Gaps = 13/190 (6%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMA 69
              + +               K+  E     ++++  F Q              G F +A
Sbjct: 4   LLCAVLLSPLLYSNAVLADDAKQLRETLTGTESLKADFKQTVTDVNKKVIQSGAGVFALA 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAK----LDTWSVYPLRYMAFSVIFSNNQHVIQ 125
            P++FY+  ++P    +++DG ++ +YN      +       +     +++   +     
Sbjct: 64  HPNQFYWHLTAPDESKIVADGKDLWIYNPFAEEVVIMDFTQAITASPIALLVHRDDATWS 123

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +     + +   I           + +V        L  + ++D     S   +      
Sbjct: 124 QYAVTKKQDCYEI---KPKATDAGISAVNVCFNKGTLNKFNVLDDKGNLSQFDLSNQHSI 180

Query: 186 TVLDPKVFEI 195
           +  D  +F+ 
Sbjct: 181 STGDKALFKF 190


>gi|146328695|ref|YP_001209396.1| LolA family outer membrane lipoprotein carrier protein
           [Dichelobacter nodosus VCS1703A]
 gi|146232165|gb|ABQ13143.1| LolA family outer membrane lipoprotein carrier protein
           [Dichelobacter nodosus VCS1703A]
          Length = 230

 Score = 70.3 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/221 (13%), Positives = 64/221 (28%), Gaps = 26/221 (11%)

Query: 5   LYKSVIGVVILFFYSAIFPFNA------AYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA 58
           + K    + +L  ++A            +     +   +    +    + +  +F Q  A
Sbjct: 1   MNKKWFFMGLLLTFTAQAQLFQTAEQTQSPAPKAETRARDLASYLDETRDLHASFTQLVA 60

Query: 59  GY----VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS 114
                    GE ++A+  KF++ Y  P    +IS+G  +  Y+  L+  SV     +   
Sbjct: 61  NKGRYNQSSGEMWLAKSGKFFWDYQYPERQKIISNGKIVYQYDIDLEQISVRKRDELVGD 120

Query: 115 VIFS----------------NNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRL 158
           +                     Q+     +     N   +             SV     
Sbjct: 121 IAMKVLSGETKLASAFRTKIIAQNKAPVELMPYIKNQGTVYQLLPKTEQNAYDSVWIAMQ 180

Query: 159 SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
              +    I       +++   + + N  +  + FE    K
Sbjct: 181 GGDISALMIDAGRGAKTVLAFHQLERNQNIPAQKFEFTPPK 221


>gi|319426381|gb|ADV54455.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           putrefaciens 200]
          Length = 208

 Score = 70.3 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 61/192 (31%), Gaps = 7/192 (3%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFM 68
           L     +               ++     ++  +++  F Q              G   +
Sbjct: 4   LLCAVMLTSPLLYSTAVFADDAQQLRNTLVNTASLKADFKQTVIDVNKKVIQTGSGILAL 63

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI 128
           A P++FY+  +SP    +++DG ++ +YN   +   +        +   +   H    + 
Sbjct: 64  AHPNQFYWHLTSPDESQIVADGKDLWIYNPFAEEVVIMDFAEAINASPIALLVHRDDTTW 123

Query: 129 QRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
            +                    +++V+    + +L  + ++D     S   +   K  T 
Sbjct: 124 SQYSVTKKQDCYDIRPKAIDSGIVTVSVCFKNSQLTKFNVLDDKGNLSQFDLSNQKVITT 183

Query: 188 LDPKVFEIPYDK 199
            D  +F+    +
Sbjct: 184 EDKALFKFVLPE 195


>gi|206577823|ref|YP_002239456.1| outer membrane lipoprotein carrier protein LolA [Klebsiella
           pneumoniae 342]
 gi|288936306|ref|YP_003440365.1| outer membrane lipoprotein carrier protein LolA [Klebsiella
           variicola At-22]
 gi|290510639|ref|ZP_06550009.1| outer membrane lipoprotein carrier protein LolA [Klebsiella sp.
           1_1_55]
 gi|229485832|sp|B5XYA1|LOLA_KLEP3 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|206566881|gb|ACI08657.1| outer membrane lipoprotein carrier protein LolA [Klebsiella
           pneumoniae 342]
 gi|288891015|gb|ADC59333.1| outer membrane lipoprotein carrier protein LolA [Klebsiella
           variicola At-22]
 gi|289777355|gb|EFD85353.1| outer membrane lipoprotein carrier protein LolA [Klebsiella sp.
           1_1_55]
          Length = 203

 Score = 69.9 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/194 (11%), Positives = 58/194 (29%), Gaps = 13/194 (6%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMA 69
              +               +          + +   +F Q+            +G+ ++ 
Sbjct: 4   LAITCALLSGMVVSQVWADAASDLKSRLDKVSSFHASFTQKVTDGSGNAVQDGQGDLWVK 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQ 125
           RP+ F +  + P    L+SDG  +  YN  ++  +            F +I  N     Q
Sbjct: 64  RPNLFNWHMTQPDESVLVSDGKTLWFYNPFVEQATATWLKDATSNTPFMLIARNQSSDWQ 123

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +   +   ++  +T       +              +  +  ++   + S  ++   ++N
Sbjct: 124 QYNIKQNGDDFVLTPKSGSGNLKQFTINV--GRDGTIHQFSAVEQDDQRSSYQLKS-QQN 180

Query: 186 TVLDPKVFEIPYDK 199
             +D   F     K
Sbjct: 181 GAVDASKFTFTPPK 194


>gi|332704755|ref|ZP_08424843.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           africanus str. Walvis Bay]
 gi|332554904|gb|EGJ51948.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio
           africanus str. Walvis Bay]
          Length = 204

 Score = 69.9 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/207 (11%), Positives = 63/207 (30%), Gaps = 22/207 (10%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAG 59
            ++ I   + F    + P +   P   +  +    +    I ++   F+Q       D  
Sbjct: 1   MRARILFTLAFLLLWVAPVS---PSDNEAVLDGLRKAAKDIHSVSADFVQRKKLEMFDEV 57

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
            + KG   + +P +  ++Y  P +      G     +N  +     + +R      +  +
Sbjct: 58  MISKGRLALVKPDRLRWEYLEPVASGFALKGGKGRRWNEMIGRMDDFDIRQDPVMQVIVD 117

Query: 120 NQHVIQESIQRVESNNSFITIFFKDD-------------FMGNMISVTFDRLSYRLLNWK 166
                  +     S +  + +   +                   I++ +      +   +
Sbjct: 118 QLLAWTNADLERMSRDFTLEVAGSEPVQLVLRPRVPAVGGFIERIAIRYAADKRSIQRVE 177

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVF 193
           +M+     + +     + NT L   +F
Sbjct: 178 VMEPGGDSTQLDFQDVRINTPLAEDLF 204


>gi|283784713|ref|YP_003364578.1| outer membrane lipoprotein carrier protein [Citrobacter rodentium
           ICC168]
 gi|282948167|emb|CBG87734.1| outer membrane lipoprotein carrier protein [Citrobacter rodentium
           ICC168]
          Length = 203

 Score = 69.9 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/204 (11%), Positives = 62/204 (30%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +         +            +  +          + +   +F Q+         
Sbjct: 1   MKKI-------AITCALLSGFVVSSVQADAAGDLKSRLDKVSSFHASFTQKVTDGSGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +            F +
Sbjct: 54  QEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  N     Q+   R   ++  +T    +  +              +  +  ++   + S
Sbjct: 114 IARNQSSDWQQYNIRQNGDDFVLTPKTGNGNLKQFTINV--GRDGTIHQFSAVEQDDQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
             ++   ++N  +D   F     +
Sbjct: 172 SYQLKS-QQNGAVDAAKFTFTPPQ 194


>gi|304413556|ref|ZP_07395029.1| outer-membrane lipoprotein carrier protein [Candidatus Regiella
           insecticola LSR1]
 gi|304284399|gb|EFL92792.1| outer-membrane lipoprotein carrier protein [Candidatus Regiella
           insecticola LSR1]
          Length = 214

 Score = 69.9 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/192 (15%), Positives = 62/192 (32%), Gaps = 9/192 (4%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMA 69
            F+                + +        + +   TF Q+             GE ++ 
Sbjct: 15  LFFCHAIVIGFMSTPVWADARQNLQTRLAKVNSFYATFSQQVTSAEGDVVQQGAGELWIK 74

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQES 127
           RP+ F +  +SP    LISDG  +  Y   ++  +   L+    +   I     ++    
Sbjct: 75  RPNLFNWHITSPDESVLISDGETLWFYTPLVEQATATWLKDATDNTPFILMTRNNLNDWR 134

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
              V+  N    +  K               S  +  + +++ S + S  ++   ++NT 
Sbjct: 135 QYNVKQQNDDFELTPKKAKGNLEKFTISVTTSGMIKTFTLIEQSGQRSAYRLQD-QKNTE 193

Query: 188 LDPKVFEIPYDK 199
           +D   F     K
Sbjct: 194 VDMSKFTFTLPK 205


>gi|90407804|ref|ZP_01215981.1| outer-membrane lipoprotein carrier protein precursor [Psychromonas
           sp. CNPT3]
 gi|90311069|gb|EAS39177.1| outer-membrane lipoprotein carrier protein precursor [Psychromonas
           sp. CNPT3]
          Length = 203

 Score = 69.9 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/201 (15%), Positives = 66/201 (32%), Gaps = 15/201 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K VI V++ F + +I P             +   E    ++ +   F Q  +       
Sbjct: 1   MKKVILVLLSFLFFSITP-------AHADDSQILQEKLAKLKIINAHFSQVVSNADGKVI 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G   + RP KF +  ++P    ++S+G  + +Y+  ++  ++  L         + 
Sbjct: 54  NESIGTLSVLRPGKFIWHVTAPDEQMIVSNGLLMWIYDPFIEQVTILNLDDTITETPFVL 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                  Q     V       T+    D       +     S  +  + I+D   + S  
Sbjct: 114 LAGNASEQWKYYNVVQKGDQFTLTSNRDTDSERYFIFEFSKSGEISKFMIVDEQGQRSAF 173

Query: 178 KILKYKENTVLDPKVFEIPYD 198
            ++ +     L+  +FE    
Sbjct: 174 TLVPFALKAPLNVSMFEFIIP 194


>gi|170717513|ref|YP_001784605.1| outer-membrane lipoprotein carrier protein [Haemophilus somnus
           2336]
 gi|189028552|sp|B0UU06|LOLA_HAES2 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|168825642|gb|ACA31013.1| outer membrane lipoprotein carrier protein LolA [Haemophilus somnus
           2336]
          Length = 204

 Score = 69.9 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/202 (12%), Positives = 59/202 (29%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K  + +  L              +T   +V +       I  +   + Q+         
Sbjct: 1   MKKYLNLTALLLVGI-------SNVTWANAVNELQNRLNKIDVLSADYTQQVTDAQGKKI 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G+  + RP+ F     +P    +I+DG  +  Y+  ++  +   +         + 
Sbjct: 54  QQGSGKIQLKRPNLFRMDNETPQESQIIADGKTLWFYDPFVEQVTANWVEDTLSDTPFVL 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             + +        VE  +    I  K                  L N+  ++   + ++ 
Sbjct: 114 LTSNNPSHWQQYIVEQKSDTFIIKPKSKKSTIKQFNIRIEKDGVLKNFSTIEKDGQSNLY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            + K   N  L+  +F     K
Sbjct: 174 ILRKI-TNPALNDAIFTFTLPK 194


>gi|113460957|ref|YP_719024.1| outer-membrane lipoprotein carrier protein [Haemophilus somnus
           129PT]
 gi|123031352|sp|Q0I3Q2|LOLA_HAES1 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|112823000|gb|ABI25089.1| outer membrane lipoprotein carrier protein precursor [Haemophilus
           somnus 129PT]
          Length = 204

 Score = 69.9 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/202 (12%), Positives = 60/202 (29%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K  + +  L              +T   +V +       I  +   + Q+         
Sbjct: 1   MKKYLNLTALLLVGI-------SNVTWANAVNELQNRLNKIDVLSADYTQQVTDAQGKKI 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G+  + RP+ F     +P    +I+DG  +  Y+  ++  +   +         + 
Sbjct: 54  QQGSGKIQLKRPNLFRMDNETPQESQIIADGKTLWFYDPFVEQVTANWVEDTLSDTPFVL 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
             + +        VE  +    I  K                  L N+  +++  + ++ 
Sbjct: 114 LTSNNPSHWQQYIVEQKSDTFIIKPKSKKSTIKQFNIRIEKDGVLKNFSTIENDGQSNLY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
            + K   N  L+  +F     K
Sbjct: 174 ILRKI-TNPALNDAIFTFTLPK 194


>gi|158520397|ref|YP_001528267.1| outer membrane lipoprotein carrier protein LolA [Desulfococcus
           oleovorans Hxd3]
 gi|158509223|gb|ABW66190.1| outer membrane lipoprotein carrier protein LolA [Desulfococcus
           oleovorans Hxd3]
          Length = 229

 Score = 69.9 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/209 (11%), Positives = 57/209 (27%), Gaps = 18/209 (8%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFL---SIQTMQGTFLQEDAGY---- 60
            VI +  L   +       A        V++ +          T    F Q         
Sbjct: 7   KVITLACLLCVTLWIGLAGAQASDMQLPVEEILSRVEARYDCDTFAADFFQTSTLKAMDI 66

Query: 61  --VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-----F 113
               +G     RP++F + Y  P    +ISDG  + ++    +  +V     +       
Sbjct: 67  TDTAEGSVLFKRPNRFRWSYEKPEKQYIISDGDRLWIFKPDENQVTVGSAPALFGDGRGA 126

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMIS----VTFDRLSYRLLNWKIMD 169
           S      +      I      +    +         M      +  +  ++ +   + ++
Sbjct: 127 SFFTDIKRLRTDYEIGLSPDTDGETYMLKLAPKKKTMDVAAIYLVVNADTFEVTAVETVN 186

Query: 170 SSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           +    + I+    + +      +F     
Sbjct: 187 AYDDATRIEFTNRRFDLPAADTLFVFDIP 215


>gi|288928778|ref|ZP_06422624.1| outer membrane lipoprotein carrier protein LolA [Prevotella sp.
           oral taxon 317 str. F0108]
 gi|288329762|gb|EFC68347.1| outer membrane lipoprotein carrier protein LolA [Prevotella sp.
           oral taxon 317 str. F0108]
          Length = 208

 Score = 69.9 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 32/208 (15%), Positives = 77/208 (37%), Gaps = 18/208 (8%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAG 59
              ++ +++LF         A      D+ ++K  E     +++Q +F Q          
Sbjct: 1   MNYILSIILLFVPLIGHAQTAVSGAKADEMMQKVGEVAQKTKSLQCSFTQTKTLKMLSQK 60

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY------------NAKLDTWSVYP 107
            V KG    ++PSK  ++Y+SP   + I +G+ + +             N      +   
Sbjct: 61  MVSKGRMCYSQPSKLRWQYTSPYQYTFILNGTKVLMKSAQRKDVIDAAKNKVFREITGIM 120

Query: 108 LRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKI 167
           L  +    +    +   Q  +   +       +  +   M +++ +TFD         ++
Sbjct: 121 LSSVTGECLTDKQRFKTQMFVDGDKWIAQLTPLKKEMKQMFSLLVITFDSKQLIATTVEM 180

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVFEI 195
            +     + I++ + K+N  +  + F+I
Sbjct: 181 REKGGDNTRIELHQVKKNAAVSDEEFKI 208


>gi|51474032|ref|YP_067789.1| hypothetical protein RT0853 [Rickettsia typhi str. Wilmington]
 gi|51460344|gb|AAU04307.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 213

 Score = 69.9 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/193 (14%), Positives = 72/193 (37%), Gaps = 3/193 (1%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFM 68
           +  ++          +       +  + +   +  +I+++   F QED+ G ++KG+  +
Sbjct: 1   MKKILFLIIICFCLSSIKAYSNNNIHLSEFKNYLRTIKSVAIDFTQEDSYGKIVKGKLLI 60

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI 128
            +P  F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N+   ++ +
Sbjct: 61  QKPYNFRCNYYPPFPLVIIGTKNFVSIYDYDMEQVSRINRSENIFNFLLEDNEDYDKDFV 120

Query: 129 QRVESNNSFI-TIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
                N   I  I            +TF++   ++   KI +       I   K  +   
Sbjct: 121 LESIINKGNIVNITIYHSKTEKRSEITFNKNIKQIEKLKIFE-DHNMVTITFDKITKVRK 179

Query: 188 LDPKVFEIPYDKI 200
               +F+    +I
Sbjct: 180 FSDDLFKFKNPEI 192


>gi|212709767|ref|ZP_03317895.1| hypothetical protein PROVALCAL_00815 [Providencia alcalifaciens DSM
           30120]
 gi|212687578|gb|EEB47106.1| hypothetical protein PROVALCAL_00815 [Providencia alcalifaciens DSM
           30120]
          Length = 206

 Score = 69.5 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/202 (12%), Positives = 64/202 (31%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K ++              +         + +   +    + + Q +F Q+         
Sbjct: 1   MKKMM-------LLGALALSLNVGQVLADASQDLQDRLSKVNSFQASFSQKVTSPEGDLI 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G+ ++ RP+ F +  +SP    L+SDG N+  YN  ++  +V  L         + 
Sbjct: 54  QEGVGDLWIERPNLFNWNMTSPDESVLVSDGKNLWFYNPFVEQVTVTNLADATQDTPFLL 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
               +        +    +   +  K                  +  +  ++   + S  
Sbjct: 114 LTRNNPQDWKQYSIVQQGNTFDLKPKQTNGTLKSFSITVNPQGTIEKFAAVEQDGQTSAY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
           ++ + ++N  +DP  F+    K
Sbjct: 174 QLKQ-QKNGPVDPSKFKFTVPK 194


>gi|152969480|ref|YP_001334589.1| outer-membrane lipoprotein carrier protein [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|238893952|ref|YP_002918686.1| outer-membrane lipoprotein carrier protein [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262041006|ref|ZP_06014227.1| outer membrane lipoprotein carrier protein LolA [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
 gi|329998192|ref|ZP_08303004.1| outer membrane lipoprotein carrier protein LolA [Klebsiella sp. MS
           92-3]
 gi|166230492|sp|A6T6Y8|LOLA_KLEP7 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|150954329|gb|ABR76359.1| outer-membrane lipoprotein carrier protein precursor [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|238546268|dbj|BAH62619.1| outer-membrane lipoprotein carrier protein precursor [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|259041641|gb|EEW42691.1| outer membrane lipoprotein carrier protein LolA [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
 gi|328538807|gb|EGF64882.1| outer membrane lipoprotein carrier protein LolA [Klebsiella sp. MS
           92-3]
          Length = 203

 Score = 69.5 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/194 (11%), Positives = 57/194 (29%), Gaps = 13/194 (6%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------GEFFMA 69
              +               +          + +   +F Q+             G+ ++ 
Sbjct: 4   LAITCALLSGMVVSQVWADAASDLKSRLDKVSSFHASFTQKVTDGSGNAVQDGQGDLWVK 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQ 125
           RP+ F +  + P    L+SDG  +  YN  ++  +            F +I  N     Q
Sbjct: 64  RPNLFNWHMTQPDESVLVSDGKTLWFYNPFVEQATATWLKDATSNTPFMLIARNQSSDWQ 123

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +   +   ++  +T       +              +  +  ++   + S  ++   ++N
Sbjct: 124 QYNIKQNGDDFVLTPKSGSGNLKQFTINV--GRDGTIHQFSAVEQDDQRSSYQLKS-QQN 180

Query: 186 TVLDPKVFEIPYDK 199
             +D   F     K
Sbjct: 181 GAVDAAKFTFTPPK 194


>gi|95929534|ref|ZP_01312276.1| outer membrane lipoprotein carrier protein LolA [Desulfuromonas
           acetoxidans DSM 684]
 gi|95134231|gb|EAT15888.1| outer membrane lipoprotein carrier protein LolA [Desulfuromonas
           acetoxidans DSM 684]
          Length = 212

 Score = 69.5 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/202 (11%), Positives = 61/202 (30%), Gaps = 19/202 (9%)

Query: 12  VVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------VMKGE 65
           + +       FP         ++   +       +QT+   F+QE             G 
Sbjct: 6   IRLCLILMVFFPAMVVAQPLPEEMADEIRHSAAEVQTLSSQFVQEKFLSMFAETLTSNGR 65

Query: 66  FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQ 125
           F+  RP +  ++ + P     + +G +   ++ ++D    + L       + +       
Sbjct: 66  FYYQRPDQLRWELTEPVGSGFVLNGDHGERWHERVDGSEPFRLEDDPAMSLIAEQLFAWA 125

Query: 126 ESIQRVESNNSFITI-------------FFKDDFMGNMISVTFDRLSYRLLNWKIMDSSR 172
            +  R    +  I +               +     + + + F   +  +   +I +   
Sbjct: 126 RADLRWLQEHYQIELIGVEPICLRLTPPEGQGRAFLDHLLIQFSDSAAYVTEVEIHEHDG 185

Query: 173 RYSIIKILKYKENTVLDPKVFE 194
            Y+ I+      N  L   +F 
Sbjct: 186 DYTRIRFSHTDVNAPLTGTLFT 207


>gi|258621725|ref|ZP_05716756.1| outer-membrane lipoprotein carrier protein precursor [Vibrio
           mimicus VM573]
 gi|258585956|gb|EEW10674.1| outer-membrane lipoprotein carrier protein precursor [Vibrio
           mimicus VM573]
          Length = 198

 Score = 69.5 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/186 (13%), Positives = 52/186 (27%), Gaps = 9/186 (4%)

Query: 22  FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGY---VMKGEFFMARPSKFY 75
                              E     +    TF Q      G       G+  +ARPS F 
Sbjct: 5   LALLFCSFSAIAAPKDTLSERLAMSEGFSATFNQQVLSPEGKVILTGNGKVDIARPSLFR 64

Query: 76  FKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRVES 133
           ++  +P    L+SDG+ +  ++  ++  ++Y           +              VE 
Sbjct: 65  WETETPDENLLVSDGTTLWHFDPFVEQVTLYRAEEALEQTPFVLLTRNKASDWDAYHVEE 124

Query: 134 NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
                T+                     +  +K+++   + S     K K+    +  +F
Sbjct: 125 KGDVFTLTPTALDSNQGRFQITISDKGVVQGFKVIEQDGQQSEFTFSKVKQ-QKPNASLF 183

Query: 194 EIPYDK 199
                K
Sbjct: 184 NYKVPK 189


>gi|258626329|ref|ZP_05721176.1| outer-membrane lipoprotein carrier protein precursor [Vibrio
           mimicus VM603]
 gi|258581381|gb|EEW06283.1| outer-membrane lipoprotein carrier protein precursor [Vibrio
           mimicus VM603]
          Length = 198

 Score = 69.5 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 26/186 (13%), Positives = 52/186 (27%), Gaps = 9/186 (4%)

Query: 22  FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGY---VMKGEFFMARPSKFY 75
                              E     +    TF Q      G       G   +ARPS F 
Sbjct: 5   LALLFCSFSAIAAPKDTLSERLAMSEGFSATFNQQVLSPEGKVIITGHGTVDIARPSLFR 64

Query: 76  FKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRVES 133
           ++  +P    L+SDG+++  ++  ++  ++Y           +              VE 
Sbjct: 65  WETQAPDENLLVSDGTSLWHFDPFVEQVTLYRAEEALEQTPFVLLTRNKASDWDAYHVEE 124

Query: 134 NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
                T+                     +  +K+++   + S     K K+    +  +F
Sbjct: 125 KGDVFTLTPTALDSNQGRFQITISDKGVVQGFKVIEQDGQQSEFTFSKVKQ-QKPNASLF 183

Query: 194 EIPYDK 199
                K
Sbjct: 184 NYKVPK 189


>gi|226226596|ref|YP_002760702.1| outer-membrane lipoprotein carrier protein precursor [Gemmatimonas
           aurantiaca T-27]
 gi|226089787|dbj|BAH38232.1| outer-membrane lipoprotein carrier protein precursor [Gemmatimonas
           aurantiaca T-27]
          Length = 230

 Score = 69.5 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 34/219 (15%), Positives = 62/219 (28%), Gaps = 20/219 (9%)

Query: 1   MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY 60
           M      SV+  V     +A+   +     T D S ++  + +    T++  F Q+    
Sbjct: 4   MTMTSRPSVVMAVTAACVAALMTTSVGAQGTADASYERVAKAWAGTHTLRADFEQKITNP 63

Query: 61  V------MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----- 109
           +       KG F   RP K    ++ P+   ++ DG  + VY        V  L      
Sbjct: 64  LLARTVNSKGVFLQERPGKLSITFTQPAGDRIVGDGKWLWVYLPSSAPGQVLKLPADADG 123

Query: 110 ---YMAFSVIFSNNQHVIQESIQRVESNNSF------ITIFFKDDFMGNMISVTFDRLSY 160
                  S +    +     S       +        +              +  D    
Sbjct: 124 AIVADLLSQLLDTPKKAFTISGGESSPVDGRAARRVQLIPKAAGTAPFQKAVLWLDEKDP 183

Query: 161 RLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           R L  +++D       I +  +     L    F     K
Sbjct: 184 RPLRVQVVDGQGVDRTITLTTWSPEATLPADAFRFNVPK 222


>gi|312171937|emb|CBX80194.1| Outer-membrane lipoprotein carrier protein precursor [Erwinia
           amylovora ATCC BAA-2158]
          Length = 203

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/194 (12%), Positives = 62/194 (31%), Gaps = 13/194 (6%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMA 69
              S               +     +    +++   TF Q+            +GE ++ 
Sbjct: 4   LIISCCLLATFTAAGAWADAASDLQQRLDKVKSFHATFNQKVTDASGSSVQDGEGEMWVQ 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQHVIQ 125
           RP+ F +  ++P    LI+DG  +  YN  ++  S            F +I  N     +
Sbjct: 64  RPNLFNWHMTAPDESILIADGKTLWFYNPFVEQVSASLLKDATSNTPFMLIARNQASDWK 123

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +     + ++  +T    D  +           +  +  +  ++   + S   +   ++N
Sbjct: 124 QYHVAQKGDDFSLTPKSADGNLKQFTINV--AQNGTINQFSAIEQDGQRSSYALKS-QQN 180

Query: 186 TVLDPKVFEIPYDK 199
             +    F+    +
Sbjct: 181 GPISADKFKFTPPE 194


>gi|292487819|ref|YP_003530694.1| outer-membrane lipoprotein carrier protein [Erwinia amylovora
           CFBP1430]
 gi|292899047|ref|YP_003538416.1| outer membrane lipoprotein carrier protein [Erwinia amylovora ATCC
           49946]
 gi|291198895|emb|CBJ46005.1| outer membrane lipoprotein carrier protein [Erwinia amylovora ATCC
           49946]
 gi|291553241|emb|CBA20286.1| Outer-membrane lipoprotein carrier protein precursor [Erwinia
           amylovora CFBP1430]
          Length = 203

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/194 (12%), Positives = 62/194 (31%), Gaps = 13/194 (6%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMA 69
              S               +     +    +++   TF Q+            +GE ++ 
Sbjct: 4   LIISCCLLATFTAAGAWADAASDLQQRLDKVKSFHATFNQKVTDASGSSVQDGEGEIWVQ 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQHVIQ 125
           RP+ F +  ++P    LI+DG  +  YN  ++  S            F +I  N     +
Sbjct: 64  RPNLFNWHMTAPDESILIADGKTLWFYNPFVEQVSASLLKDATSNTPFMLIARNQASDWK 123

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +     + ++  +T    D  +           +  +  +  ++   + S   +   ++N
Sbjct: 124 QYHVAQKGDDFSLTPKSADGNLKQFTINV--AQNGTINQFSAIEQDGQRSSYALKS-QQN 180

Query: 186 TVLDPKVFEIPYDK 199
             +    F+    +
Sbjct: 181 GPISADKFKFTPPE 194


>gi|157965024|ref|YP_001499848.1| Outer membrane lipoprotein-sorting protein LolA [Rickettsia
           massiliae MTU5]
 gi|157844800|gb|ABV85301.1| Outer membrane lipoprotein-sorting protein LolA [Rickettsia
           massiliae MTU5]
          Length = 226

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 32/197 (16%), Positives = 85/197 (43%), Gaps = 6/197 (3%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKG 64
            K +  ++I++ +      + A+ +    ++ +   +  +I+++   F QED+   ++KG
Sbjct: 15  MKKIFFLIIIYLF---VNSSLAFGVDDKTAISELKTYLRTIKSVAIDFTQEDSYSKIVKG 71

Query: 65  EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVI 124
           +  + +P  F + Y  P  + +I   + +++Y+  ++  S        F+ +  +N+H  
Sbjct: 72  KLLIHKPYNFRYNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENTFNFLLEDNEHFD 131

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMIS-VTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
           ++ I     N   I+       +    S +TF++ + ++   KI +       I   K  
Sbjct: 132 KDFIFESVINERNISKITIYHTLTEKRSEITFNKATQQIEALKIFE-DNNIVTITFDKIA 190

Query: 184 ENTVLDPKVFEIPYDKI 200
           +       +F++   +I
Sbjct: 191 KVQKFSDDLFKLKNPEI 207


>gi|254252992|ref|ZP_04946310.1| Outer membrane lipoprotein-sorting protein [Burkholderia dolosa
           AUO158]
 gi|124895601|gb|EAY69481.1| Outer membrane lipoprotein-sorting protein [Burkholderia dolosa
           AUO158]
          Length = 145

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 41/137 (29%), Gaps = 5/137 (3%)

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAFSVIFSNNQH 122
            +RP KF + Y  P    L +DG  + VY+  L+  +   L        A  +  SN+  
Sbjct: 2   FSRPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLNGALGASPAAILFGSNDLD 61

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
                    E                    +     +  L   ++ D     +++     
Sbjct: 62  KSYTLRDAGEKGGIEWLEMQPKAQDTQFQRIGIGFRNGTLAAMELHDVFGNVTLLTFTNI 121

Query: 183 KENTVLDPKVFEIPYDK 199
           + N  L    F+    K
Sbjct: 122 QTNPPLKSDTFKFVVPK 138


>gi|15604694|ref|NP_221212.1| hypothetical protein RP864 [Rickettsia prowazekii str. Madrid E]
 gi|7388445|sp|Q9ZCA2|Y864_RICPR RecName: Full=Uncharacterized protein RP864; Flags: Precursor
 gi|3861389|emb|CAA15288.1| unknown [Rickettsia prowazekii]
 gi|292572528|gb|ADE30443.1| Outer membrane lipoprotein-sorting protein LolA [Rickettsia
           prowazekii Rp22]
          Length = 213

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 27/193 (13%), Positives = 71/193 (36%), Gaps = 3/193 (1%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA-GYVMKGEFFM 68
           +  ++          +       +  + +   +  +I+++   F QED+ G ++KG+  +
Sbjct: 1   MKKILFLTVICFCLSSIKAYANNNIHLSEFKNYLRTIKSVAIDFTQEDSYGKIVKGKLLI 60

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI 128
            +P  F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N    ++ +
Sbjct: 61  QKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRISPSENIFNFLLEDNVDFDKDFV 120

Query: 129 QRVESN-NSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
                N  +   I            +TF++   ++   KI +       I   K  +   
Sbjct: 121 FESVINKGNIFNITIYHTRTEKRSEITFNKNIKQIEKLKIFE-DHNIVTITFDKITKVQK 179

Query: 188 LDPKVFEIPYDKI 200
               +F+    +I
Sbjct: 180 FSDDLFKFKNPEI 192


>gi|291288231|ref|YP_003505047.1| outer membrane lipoprotein carrier protein LolA [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290885391|gb|ADD69091.1| outer membrane lipoprotein carrier protein LolA [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 197

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/195 (12%), Positives = 65/195 (33%), Gaps = 16/195 (8%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-----AG 59
           + K ++  ++L     +            ++ ++ +    ++Q+    F+Q         
Sbjct: 1   MKKLILTYMVLMLTFFV---------AHSRTAEEVVAALSTVQSYTADFVQSTEIEGFGE 51

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
            V  G+ F+    +  + YS P     + D  ++  Y+++     V  L   A   +   
Sbjct: 52  DVYSGKIFINISKQAMWDYSKPYRQFYLFDKDSMNYYDSETKQLIVQKLDPSANVFMRLM 111

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
                      V   N  +T+         + ++ F   +  +      D +   + ++ 
Sbjct: 112 LNPADIRKDFDVSFENGRLTL--SPIGDIGLSTIVFTVENDTVKGISTKDQNGNNTSVEF 169

Query: 180 LKYKENTVLDPKVFE 194
              K++  +   VF+
Sbjct: 170 KNIKKDIAIPSSVFK 184


>gi|237730856|ref|ZP_04561337.1| outer-membrane lipoprotein carrier protein [Citrobacter sp. 30_2]
 gi|283833816|ref|ZP_06353557.1| outer membrane lipoprotein carrier protein LolA [Citrobacter
           youngae ATCC 29220]
 gi|226906395|gb|EEH92313.1| outer-membrane lipoprotein carrier protein [Citrobacter sp. 30_2]
 gi|291070483|gb|EFE08592.1| outer membrane lipoprotein carrier protein LolA [Citrobacter
           youngae ATCC 29220]
          Length = 203

 Score = 69.1 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 21/194 (10%), Positives = 60/194 (30%), Gaps = 13/194 (6%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMA 69
              +     +         +          + +   +F Q+            +G+ ++ 
Sbjct: 4   IAITCALLSSFVVSSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVK 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQ 125
           RP+ F +  + P    L+SDG  +  +N  ++  +            F +I  N     Q
Sbjct: 64  RPNLFNWHMTQPDESILVSDGKTLWFFNPFVEQATATWLKDATGNTPFMLIARNQASDWQ 123

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +   +   ++  +T       +              +  +  ++   + S  ++   ++N
Sbjct: 124 QYNIKQNGDDFVLTPKTSSGNLKQFTINV--GRDGTIHQFSAVEQDDQRSSYQLKS-QQN 180

Query: 186 TVLDPKVFEIPYDK 199
             ++P  F     +
Sbjct: 181 GAIEPSKFTFTPPQ 194


>gi|54308356|ref|YP_129376.1| outer-membrane lipoprotein carrier protein [Photobacterium
           profundum SS9]
 gi|81615315|sp|Q6LT02|LOLA_PHOPR RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|46912784|emb|CAG19574.1| hypothetical outer membrane lipoproteins carrier protein
           [Photobacterium profundum SS9]
          Length = 200

 Score = 69.1 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 56/192 (29%), Gaps = 9/192 (4%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM------KGEFFMA 69
                +               ++       +      F Q+            KG+  + 
Sbjct: 1   MIGLFLAAPLVLSSAVWANPQQELSSRLSLVNAFSANFDQKVVSPEGDVLVEGKGDVTIK 60

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQES 127
           RP+ F +   +P    L+SDG  +  Y+  ++  +   L+        +           
Sbjct: 61  RPNLFRWNTVTPDENLLVSDGKTLWYYSPFIEQVTAMWLKDATEQTPFVLLTRNSASDWD 120

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
              V   +   T+  KD        V     +  + N+ +++   + S  K  ++ +  V
Sbjct: 121 NYNVAQTSDTFTLTPKDTTSTMGKFVVTVAKTGEVRNFSVVEQDGQRSNFKFRQFSK-QV 179

Query: 188 LDPKVFEIPYDK 199
               +F     K
Sbjct: 180 PKANIFTFTPPK 191


>gi|262171857|ref|ZP_06039535.1| outer membrane lipoprotein carrier protein LolA [Vibrio mimicus
           MB-451]
 gi|261892933|gb|EEY38919.1| outer membrane lipoprotein carrier protein LolA [Vibrio mimicus
           MB-451]
          Length = 198

 Score = 68.8 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 26/186 (13%), Positives = 51/186 (27%), Gaps = 9/186 (4%)

Query: 22  FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGY---VMKGEFFMARPSKFY 75
                              E     +    TF Q      G       G   +ARPS F 
Sbjct: 5   LALLFCSFSAIAAPKDTLSERLAMSEGFSATFNQQVLSPEGKVIITGHGTVDIARPSLFR 64

Query: 76  FKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRVES 133
           ++  +P    L+SDG+ +  ++  ++  ++Y           +              VE 
Sbjct: 65  WETQAPDENLLVSDGTTLWHFDPFVEQVTLYRAEEALEQTPFVLLTRNKASDWDAYHVEE 124

Query: 134 NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
                T+                     +  +K+++   + S     K K+    +  +F
Sbjct: 125 KGDVFTLTPTALDSNQGRFQITISDKGIVQGFKVIEQDGQQSEFTFSKVKQ-QKPNASLF 183

Query: 194 EIPYDK 199
                K
Sbjct: 184 NYKVPK 189


>gi|149190993|ref|ZP_01869254.1| outer-membrane lipoprotein carrier protein precursor [Vibrio
           shilonii AK1]
 gi|148835127|gb|EDL52103.1| outer-membrane lipoprotein carrier protein precursor [Vibrio
           shilonii AK1]
          Length = 205

 Score = 68.8 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 24/202 (11%), Positives = 50/202 (24%), Gaps = 14/202 (6%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K  + +  L F +  F   A          ++  +          TF Q+         
Sbjct: 1   MKKWLTLAALSFSTLGFSALAT-----ATPQQELSDRLQLNDGFSATFTQKVTSPEGEVV 55

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIF 117
              +G   ++RPS F +  + P    L+SDG+N+  Y+  ++                + 
Sbjct: 56  MEGEGNVEISRPSMFRWVTTMPDENVLVSDGNNLWYYSPFIEQVSIYNQEQATEQTPFVL 115

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                        V       T+                     +  + +++   +    
Sbjct: 116 LTRNRASDWDNYNVNQKGDVFTLIPTAVDSTQGQFQINIDSKGIVHGFNVIEQDGQKGTF 175

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
                K         F      
Sbjct: 176 AFDNIKVGKP-SADRFTFVIPN 196


>gi|253990318|ref|YP_003041674.1| outer-membrane lipoprotein carrier protein [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253781768|emb|CAQ84931.1| outer-membrane lipoprotein carrier protein precursor (p20)
           [Photorhabdus asymbiotica]
          Length = 203

 Score = 68.8 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 22/192 (11%), Positives = 61/192 (31%), Gaps = 9/192 (4%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMA 69
                    + +       + +   +    + +   +F Q             +G+ ++ 
Sbjct: 4   LILMGCLMASISVTSVWANASRNLQDRLGKVSSFHASFTQTVTSNDGTTIQEGEGQLWVK 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQES 127
           RP+ F +  +SP    L+SDG  +  YN  ++  +   L+    +   +        + S
Sbjct: 64  RPNLFNWHMTSPDESVLVSDGKTLWFYNPFVEQVTATWLKDATGNTPFMLITRNDAKEWS 123

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
             ++    +   +   +                 +  +  ++   + S  ++   ++NT 
Sbjct: 124 QYKIIQKGNDFKLTPNNANGNLKRFFITVTADGTIQKFSAVEQDGQKSTYQLKG-QQNTY 182

Query: 188 LDPKVFEIPYDK 199
           +D   F     K
Sbjct: 183 VDAAKFSFTLPK 194


>gi|261339229|ref|ZP_05967087.1| hypothetical protein ENTCAN_05463 [Enterobacter cancerogenus ATCC
           35316]
 gi|288319084|gb|EFC58022.1| outer membrane lipoprotein carrier protein LolA [Enterobacter
           cancerogenus ATCC 35316]
          Length = 203

 Score = 68.8 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 20/202 (9%), Positives = 59/202 (29%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +         +     +         +          + +   +F Q+         
Sbjct: 1   MKKI-------AIACALLTSFVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGNAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +G+ ++ RP+ F +  + P    L+SDG  +  YN  ++  +   L+    +   + 
Sbjct: 54  QEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFML 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                        ++       +  K +             +  +  +  ++   + S  
Sbjct: 114 IARNQASDWQQYNIKQTGDEFVLTPKGNNGNLKQFTINVSSNGTINQFGAVEQDDQRSSY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
           ++   ++N  +D   F     +
Sbjct: 174 QLKS-QQNGAVDASKFTFTPPQ 194


>gi|37525549|ref|NP_928893.1| outer-membrane lipoprotein carrier protein [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|47117160|sp|Q7N6E9|LOLA_PHOLL RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|36784977|emb|CAE13895.1| outer-membrane lipoproteins carrier protein precursor (P20)
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 203

 Score = 68.8 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 60/192 (31%), Gaps = 9/192 (4%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMA 69
                         +    + +   E    + +   +F Q             +G+ ++ 
Sbjct: 4   LILIGCLMAGMNINVAWANASQNLQERLGKVNSFHASFTQTVTSDDGATIQEGEGQLWVK 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQES 127
           RP+ F +  +SP    L+SDG  +  YN  ++  +   L+    +   +        + S
Sbjct: 64  RPNLFNWHMTSPDESVLVSDGKTLWFYNPFVEQVTANWLKDATGNTPFMLITRNDAKEWS 123

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
             ++    +   +   +                 +  +  ++   + S  ++   ++NT 
Sbjct: 124 QYKISQQGNDFELTPNNVTGNLKRFSITVTTDGTIQKFSAIEQDGQKSAYQLKG-QQNTH 182

Query: 188 LDPKVFEIPYDK 199
           +D   F     K
Sbjct: 183 VDAAKFSFTLPK 194


>gi|119945375|ref|YP_943055.1| outer membrane lipoprotein carrier protein LolA [Psychromonas
           ingrahamii 37]
 gi|189028556|sp|A1SVE1|LOLA_PSYIN RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|119863979|gb|ABM03456.1| outer membrane lipoprotein carrier protein LolA [Psychromonas
           ingrahamii 37]
          Length = 205

 Score = 68.8 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 25/194 (12%), Positives = 66/194 (34%), Gaps = 8/194 (4%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEF 66
            I+   S +     +  ++     +   E       +   F Q      G +    +G  
Sbjct: 3   KIVIVISILLTSFLSSAVSAATDSQLLKEKLAKFSFINAEFSQQVSSPEGKILDDSQGML 62

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVI 124
            ++RP KF ++   P    ++SDG  + +Y+  ++  ++  L         I  +  +  
Sbjct: 63  AISRPGKFRWEVLMPEEELIVSDGQTMWMYSPFIEQVTLLNLSDAIQGTPFILLSGANES 122

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           Q +  +V   N    +      + +   +     S ++  + ++++  + S  K+     
Sbjct: 123 QWADYQVNKVNDQFIVKNIAGTVQDRSFIFEFNKSSQVSKFVVIEALGQRSEFKLSHKVL 182

Query: 185 NTVLDPKVFEIPYD 198
           +       F+    
Sbjct: 183 SKPWVEGFFDFSIP 196


>gi|120598816|ref|YP_963390.1| outer membrane lipoprotein carrier protein LolA [Shewanella sp.
           W3-18-1]
 gi|166230502|sp|A1RJJ1|LOLA_SHESW RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|120558909|gb|ABM24836.1| outer membrane lipoprotein carrier protein LolA [Shewanella sp.
           W3-18-1]
          Length = 208

 Score = 68.8 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 61/192 (31%), Gaps = 7/192 (3%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFM 68
           L     +               ++     ++  +++  F Q              G   +
Sbjct: 4   LLCAVMLTSPLLYSTAVFADDAQQLRNTLVNTASLKTDFKQTVTDVNKKVIQTGSGILAL 63

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI 128
           A P++FY+  +SP    +++DG ++ +YN   +   +        +   +   H    + 
Sbjct: 64  AHPNQFYWHLTSPDESQIVADGKDLWIYNPFAEEVVIMDFAEAINASPIALLVHRDDTTW 123

Query: 129 QRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
            +                    +++V+    + +L  + ++D     S   +   K  T 
Sbjct: 124 SQYSVTKKQDCYDIRPKAIDSGIVTVSVCFKNSQLTKFNVLDDKGNLSQFDLSNQKVITT 183

Query: 188 LDPKVFEIPYDK 199
            D  +F+    +
Sbjct: 184 EDKALFKFVLPE 195


>gi|94986510|ref|YP_594443.1| Outer membrane lipoprotein-sorting protein [Lawsonia
           intracellularis PHE/MN1-00]
 gi|94730759|emb|CAJ54121.1| Outer membrane lipoprotein-sorting protein [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 249

 Score = 68.4 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 30/213 (14%), Positives = 66/213 (30%), Gaps = 17/213 (7%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSV-KKAIEHFLSIQTMQGTFLQEDAGYVM 62
           +  K  +  +ILFF + IF         +   + K+  + + SI+    TF QE      
Sbjct: 18  MSQKFSMLQLILFFLTFIFYSYITDSYAESIPIVKELQQSYQSIKNFSATFTQELTHQES 77

Query: 63  K------GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVI 116
                  G+ F  +P    ++ ++P    L+ + + +  Y    +    Y    +  S  
Sbjct: 78  GSKETRIGKLFFKKPLLVRWETNTPHEELLLINTNAVWDYLPDENLVYKYSTDIVKDSTS 137

Query: 117 FSNNQHVIQESIQRVESNNSFI----------TIFFKDDFMGNMISVTFDRLSYRLLNWK 166
                       +      +                +         +  ++ S  +   +
Sbjct: 138 IIQVITGQVRLDKNFSIIENNNNNNNELIFLKLYPKEPTTQMVEAFLWINKKSLLIHKVQ 197

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
            +D     + I  +    NT +D  +F+    K
Sbjct: 198 SIDFYGNTNTITFINITPNTHIDNNIFQFTPPK 230


>gi|163783604|ref|ZP_02178593.1| hypothetical protein HG1285_08341 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881097|gb|EDP74612.1| hypothetical protein HG1285_08341 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 206

 Score = 68.4 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 26/198 (13%), Positives = 66/198 (33%), Gaps = 17/198 (8%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEF 66
           +I+F    + P  A          K+  +    +++++  F+Q+          + KG F
Sbjct: 3   LIVFVLLFLTPLIAVSSTF-----KELEDKLKDVKSVRVVFVQKTRYSWYPKPELSKGVF 57

Query: 67  FMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT------WSVYPLRYMAFSVIFSNN 120
           +  +  KF  +Y+ P  V ++S+G  I + N +          +       +        
Sbjct: 58  YAMKDGKFRIEYTYPDEVVMVSNGKEIIILNKEDREAIIDSVENNTSPVIESLFFFSKPL 117

Query: 121 QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180
             V +   +  +     + +  K                  +   +++DS    + ++ +
Sbjct: 118 SEVFEPVGELEKKGLKVLILKPKRKDENIKEVYVELDKDLEVRRIRVVDSEDTQTTVEFI 177

Query: 181 KYKENTVLDPKVFEIPYD 198
             ++N      +F I   
Sbjct: 178 DIRKNFKPSAGLFRIELP 195


>gi|116328780|ref|YP_798500.1| Outer membrane lipoprotein-sorting protein [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
 gi|116121524|gb|ABJ79567.1| Outer membrane lipoprotein-sorting protein [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
          Length = 236

 Score = 68.4 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 28/219 (12%), Positives = 68/219 (31%), Gaps = 28/219 (12%)

Query: 5   LYKSVIGVVILFFYSA---IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTF-LQEDAGY 60
           + K++I    + F           A    +  + VK+  + F  + + +  F +Q  +  
Sbjct: 1   MKKTIILSFYILFLVLEPAFLAQPAHNWNSPSEVVKQVKKKFNDLSSYKANFQIQTVSNK 60

Query: 61  VMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD---------------- 101
             K   G     +  +  +++S PS   ++SDG  + +Y A+L+                
Sbjct: 61  KSKNMRGVCLYKKGGRIRYQFSDPSGDEIVSDGKTLYIYIARLNAVGKQDLTLNKSNKSG 120

Query: 102 --TWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMIS---VTFD 156
               S            +      I++     +    +  +  +            +  D
Sbjct: 121 PIFSSFTDEGLSRIFRKYHYKFDSIEQPQTSSKDGRKYFVLNLEQREKIGGFETMLLYVD 180

Query: 157 RLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
             +Y +      D   + + ++    + N  L+   F  
Sbjct: 181 AETYFIQKAVASDGRGKETTVEFSNLEINPDLEDGQFNF 219


>gi|87122211|ref|ZP_01078094.1| outer-membrane lipoprotein carrier protein precursor [Marinomonas
           sp. MED121]
 gi|86162531|gb|EAQ63813.1| outer-membrane lipoprotein carrier protein precursor [Marinomonas
           sp. MED121]
          Length = 207

 Score = 68.4 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 25/204 (12%), Positives = 74/204 (36%), Gaps = 23/204 (11%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK- 63
           + + ++ ++ + F                   +   +   + + ++G F Q       + 
Sbjct: 1   MMQKIVVLLAILFSINSMAAT-----------ELLTQLLETNRNIEGEFRQVTYDEQGEQ 49

Query: 64  -----GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR----YMAFS 114
                G F +A P++F +   +P    +IS+G  I +++  L+  +  PL         +
Sbjct: 50  LQANEGVFLLAEPNRFVWDTITPFPQRIISNGEWITIWDVDLEQATQKPLEGALGNSPAA 109

Query: 115 VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRY 174
           ++      V+            F     ++  + + ++++F +    +    I DS  + 
Sbjct: 110 LLGQPANEVLPHYNISQLGEQRFRLEPKEEVDLFSTLTLSFRQN--AIEAMSIQDSLGQT 167

Query: 175 SIIKILKYKENTVLDPKVFEIPYD 198
           ++I+    + +  +    F++   
Sbjct: 168 TVIEFKNVESHDGVADGNFQVDLP 191


>gi|254246063|ref|ZP_04939384.1| Outer membrane lipoprotein-sorting protein [Burkholderia
           cenocepacia PC184]
 gi|124870839|gb|EAY62555.1| Outer membrane lipoprotein-sorting protein [Burkholderia
           cenocepacia PC184]
          Length = 145

 Score = 68.4 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 24/137 (17%), Positives = 41/137 (29%), Gaps = 5/137 (3%)

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAFSVIFSNNQH 122
            ARP KF + Y  P    L +DG  + VY+  L+  +   L        A  +  SN+  
Sbjct: 2   FARPGKFIWTYQKPYQQVLQADGDKLYVYDRDLNQVTERKLNGALGASPAAILFGSNDLD 61

Query: 123 VIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
                    E                    +     +  L   ++ D     +++     
Sbjct: 62  KNYTLRDAGEKGGIEWLEMLPKAQDTQFQRIGIGFRNGTLAAMELHDVFGNVTLLTFTNI 121

Query: 183 KENTVLDPKVFEIPYDK 199
           + N  L    F+    K
Sbjct: 122 QTNPPLKGDTFKFVVPK 138


>gi|269139543|ref|YP_003296244.1| outer membrane lipoprotein-sorting protein [Edwardsiella tarda
           EIB202]
 gi|267985204|gb|ACY85033.1| outer membrane lipoprotein-sorting protein [Edwardsiella tarda
           EIB202]
 gi|304559432|gb|ADM42096.1| Outer membrane lipoprotein carrier protein LolA [Edwardsiella tarda
           FL6-60]
          Length = 204

 Score = 68.4 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 23/201 (11%), Positives = 55/201 (27%), Gaps = 16/201 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K ++    +                              + +   +F Q  +       
Sbjct: 1   MKKLLVACCVV-------SGMMSASALASPSSDLQGRLNKVNSFHASFTQTVSAADGTPV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +GE ++ RP+ F +   SP    L+SDG  +  YN  ++  +   L     +   + 
Sbjct: 54  QQGEGELWVKRPNLFNWHMISPDESVLVSDGKTLWFYNPFVEQVTATWLNRATGNTPFML 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                    +   V        +  K                  +  +  ++   + S+ 
Sbjct: 114 ITRNDASDWAQYNVTQKGDTFDLMPKSAKNNLKKFTISVMPDGTINGFSAVEQDGQRSVY 173

Query: 178 KILKYKENTVLDPKVFEIPYD 198
            + + ++N  +D   F     
Sbjct: 174 TLKR-QQNGAVDAAKFRFTPP 193


>gi|229525719|ref|ZP_04415124.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           bv. albensis VL426]
 gi|229339300|gb|EEO04317.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           bv. albensis VL426]
          Length = 198

 Score = 68.4 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 26/186 (13%), Positives = 51/186 (27%), Gaps = 9/186 (4%)

Query: 22  FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGY---VMKGEFFMARPSKFY 75
                              E     +    TF Q      G       G+  +ARPS   
Sbjct: 5   LALLFCSFSAIAAPKDTLSERLAMSEGFSATFNQQVLSPEGKVILTGNGKVDIARPSLLR 64

Query: 76  FKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRVES 133
           ++  +P    L+SDG+ +  ++  ++  ++Y           +              VE 
Sbjct: 65  WETETPDENLLVSDGTTLWHFDPFVEQVTLYRAEEALEQTPFVLLTRNKASDWDAYHVEE 124

Query: 134 NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
                T+                     +  +K+++   + S     K K+    +  VF
Sbjct: 125 KGDVFTLTPTALDSNQGRFQITISEKGVVQGFKVIEQDGQQSEFTFSKVKQ-QKPNASVF 183

Query: 194 EIPYDK 199
                K
Sbjct: 184 NYKVPK 189


>gi|146293106|ref|YP_001183530.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           putrefaciens CN-32]
 gi|166230500|sp|A4Y6Z8|LOLA_SHEPC RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|145564796|gb|ABP75731.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           putrefaciens CN-32]
          Length = 208

 Score = 68.4 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 61/192 (31%), Gaps = 7/192 (3%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFM 68
           L     +               ++     ++  +++  F Q              G   +
Sbjct: 4   LLCAVMLTSPLLYSTAVFADDAQQLRNTLVNTASLKTDFKQTVTDVNKKVIQTGSGILAL 63

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI 128
           A P++FY+  +SP    +++DG ++ +YN   +   +        +   +   H    + 
Sbjct: 64  AHPNQFYWHLTSPDESQIVADGKDLWIYNPFAEEVVIMDFAEAINASPIALLVHRDDTTW 123

Query: 129 QRVESNNSF-ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
            +                    +++V+    + +L  + ++D     S   +   K  T 
Sbjct: 124 SQYSVTKKQDCYDIRPKAIDSGIVTVSVCFKNSQLTKFNVLDDKGNISQFDLSNQKVITT 183

Query: 188 LDPKVFEIPYDK 199
            D  +F+    +
Sbjct: 184 EDKALFKFVLPE 195


>gi|157804255|ref|YP_001492804.1| transcription elongation factor GreA [Rickettsia canadensis str.
           McKiel]
 gi|157785518|gb|ABV74019.1| transcription elongation factor GreA [Rickettsia canadensis str.
           McKiel]
          Length = 213

 Score = 68.0 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 24/192 (12%), Positives = 67/192 (34%), Gaps = 1/192 (0%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED-AGYVMKGEFFM 68
           +  ++      +F  +          + +   +  +I+++   F QED    + KG+  +
Sbjct: 1   MKKILFLAVIFVFVNSITVYANDHTVILELKTYLRTIKSVAIDFTQEDSKNNIAKGKLLI 60

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI 128
            +P  F   Y  P  + +I   + +++Y+  ++  S        F+ +  +N++  +  +
Sbjct: 61  RKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQVSRINRSENIFNFLLEDNENFDRYFV 120

Query: 129 QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
                N   I        +    S      + + +    +  +     I   K  +    
Sbjct: 121 FESVINEGNIFKITIYHTLTEKRSEIIFNKATKQIELLKIFENNNIVTITFDKIAKVQKF 180

Query: 189 DPKVFEIPYDKI 200
              +F++   +I
Sbjct: 181 SDDLFKLKNPEI 192


>gi|261210731|ref|ZP_05925023.1| outer membrane lipoprotein carrier protein LolA [Vibrio sp. RC341]
 gi|260840216|gb|EEX66796.1| outer membrane lipoprotein carrier protein LolA [Vibrio sp. RC341]
          Length = 198

 Score = 68.0 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 53/186 (28%), Gaps = 9/186 (4%)

Query: 22  FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGY---VMKGEFFMARPSKFY 75
                              E     +    TF Q      G    +  G+  +ARPS F 
Sbjct: 5   LALLFCSFSAIAAPKDTLSERLAMSEGFSATFNQQVLSPEGKVILIGNGKVDIARPSLFR 64

Query: 76  FKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRVES 133
           ++  +P    L+SDG+ +  ++  ++  ++Y           +              VE 
Sbjct: 65  WETETPDENLLVSDGTTLWHFDPFVEQVTLYRAEEALEQTPFVLLTRNKASDWDAYHVEE 124

Query: 134 NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
                T+                     +  +K+++   + S     K K+    +  VF
Sbjct: 125 KGDVFTLTPTALDSNQGRFQITISEKGVVQGFKVIEQDGQQSEFTFSKVKQ-QKPNASVF 183

Query: 194 EIPYDK 199
                K
Sbjct: 184 NYKVPK 189


>gi|114778012|ref|ZP_01452912.1| LolA [Mariprofundus ferrooxydans PV-1]
 gi|114551618|gb|EAU54171.1| LolA [Mariprofundus ferrooxydans PV-1]
          Length = 222

 Score = 68.0 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 26/211 (12%), Positives = 51/211 (24%), Gaps = 19/211 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITK---------DQSVKKAIEHFLSIQTMQGTFLQE 56
            + +I  ++      I   +AA    +          Q          S +     F Q 
Sbjct: 1   MRKLIAALVCSALWLITTASAATVKQEWQLDGRDKGAQFANNIE-RLGSQRGFSCRFDQI 59

Query: 57  D-----AGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW---SVYPL 108
                       GE  + +P  F ++Y  P     + DG  I  Y   L      +    
Sbjct: 60  MEFSDGGNQHYSGELAVLKPGHFRWQYRKPYDQLYVGDGRVIWHYEPDLMQAERLTDLEA 119

Query: 109 RYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIM 168
                  +      +    +     +N      FK                  L+  +  
Sbjct: 120 INPVVMKLLDGRIPLSDIKVVERSYDNKLNIHRFKVQVTDAPQVWLGFSRHGDLVYIERQ 179

Query: 169 DSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           D     +++ +           K+F     +
Sbjct: 180 DLLGNRNMMHLSDCSY-VAPAEKLFSFTPPE 209


>gi|116331691|ref|YP_801409.1| Outer membrane lipoprotein-sorting protein [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
 gi|116125380|gb|ABJ76651.1| Outer membrane lipoprotein-sorting protein [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
          Length = 236

 Score = 68.0 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 28/219 (12%), Positives = 68/219 (31%), Gaps = 28/219 (12%)

Query: 5   LYKSVIGVVILFFYSA---IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTF-LQEDAGY 60
           + K++I    + F           A    +  + VK+  + F  + + +  F +Q  +  
Sbjct: 1   MKKTIILSFYILFLVLEPDFLAQPAHNWNSPSEVVKQVKKKFNDLSSYKANFQIQTVSNK 60

Query: 61  VMK---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD---------------- 101
             K   G     +  +  +++S PS   ++SDG  + +Y A+L+                
Sbjct: 61  KSKNMRGVCLYKKGGRIRYQFSDPSGDEIVSDGKTLYIYIARLNAVGKQDLTLNKSNKSG 120

Query: 102 --TWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMIS---VTFD 156
               S            +      I++     +    +  +  +            +  D
Sbjct: 121 PIFSSFTDEGLSRIFRKYHYKFDSIEQPQTSSKDGRKYFVLNLEQREKIGGFETMLLYVD 180

Query: 157 RLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
             +Y +      D   + + ++    + N  L+   F  
Sbjct: 181 AETYFIQKAVASDGRGKETTVEFSNLEINPDLEDGQFNF 219


>gi|15641120|ref|NP_230752.1| outer-membrane lipoprotein carrier protein [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121591282|ref|ZP_01678577.1| outer membrane lipoproteins carrier protein [Vibrio cholerae
           2740-80]
 gi|121726295|ref|ZP_01679585.1| outer membrane lipoproteins carrier protein [Vibrio cholerae V52]
 gi|147675332|ref|YP_001216576.1| outer-membrane lipoprotein carrier protein [Vibrio cholerae O395]
 gi|153213531|ref|ZP_01948821.1| outer membrane lipoproteins carrier protein [Vibrio cholerae 1587]
 gi|153802142|ref|ZP_01956728.1| outer membrane lipoproteins carrier protein [Vibrio cholerae MZO-3]
 gi|153816938|ref|ZP_01969605.1| outer membrane lipoproteins carrier protein [Vibrio cholerae NCTC
           8457]
 gi|153823887|ref|ZP_01976554.1| outer membrane lipoproteins carrier protein [Vibrio cholerae B33]
 gi|153824914|ref|ZP_01977581.1| outer membrane lipoproteins carrier protein [Vibrio cholerae MZO-2]
 gi|227081280|ref|YP_002809831.1| outer membrane lipoproteins carrier protein [Vibrio cholerae M66-2]
 gi|229505297|ref|ZP_04394807.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae BX
           330286]
 gi|229511033|ref|ZP_04400512.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           B33]
 gi|229515490|ref|ZP_04404949.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           TMA 21]
 gi|229518154|ref|ZP_04407598.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           RC9]
 gi|229520460|ref|ZP_04409885.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae TM
           11079-80]
 gi|229529803|ref|ZP_04419193.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           12129(1)]
 gi|229608316|ref|YP_002878964.1| outer-membrane lipoprotein carrier protein [Vibrio cholerae
           MJ-1236]
 gi|254225501|ref|ZP_04919111.1| outer membrane lipoproteins carrier protein [Vibrio cholerae V51]
 gi|254291531|ref|ZP_04962322.1| outer membrane lipoproteins carrier protein [Vibrio cholerae
           AM-19226]
 gi|254848237|ref|ZP_05237587.1| outer membrane lipoproteins carrier protein [Vibrio cholerae MO10]
 gi|255745520|ref|ZP_05419468.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholera
           CIRS 101]
 gi|262158406|ref|ZP_06029522.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           INDRE 91/1]
 gi|262170268|ref|ZP_06037955.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           RC27]
 gi|262402532|ref|ZP_06079093.1| outer membrane lipoprotein carrier protein LolA [Vibrio sp. RC586]
 gi|297578709|ref|ZP_06940637.1| outer-membrane lipoprotein carrier protein [Vibrio cholerae RC385]
 gi|298498788|ref|ZP_07008595.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           MAK 757]
 gi|9977683|sp|P57069|LOLA_VIBCH RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|172047402|sp|A5F2G9|LOLA_VIBC3 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|254809233|sp|C3LU04|LOLA_VIBCM RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|9655577|gb|AAF94266.1| outer membrane lipoproteins carrier protein [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121546866|gb|EAX57024.1| outer membrane lipoproteins carrier protein [Vibrio cholerae
           2740-80]
 gi|121631241|gb|EAX63614.1| outer membrane lipoproteins carrier protein [Vibrio cholerae V52]
 gi|124115867|gb|EAY34687.1| outer membrane lipoproteins carrier protein [Vibrio cholerae 1587]
 gi|124122335|gb|EAY41078.1| outer membrane lipoproteins carrier protein [Vibrio cholerae MZO-3]
 gi|125621971|gb|EAZ50295.1| outer membrane lipoproteins carrier protein [Vibrio cholerae V51]
 gi|126512525|gb|EAZ75119.1| outer membrane lipoproteins carrier protein [Vibrio cholerae NCTC
           8457]
 gi|126518590|gb|EAZ75813.1| outer membrane lipoproteins carrier protein [Vibrio cholerae B33]
 gi|146317215|gb|ABQ21754.1| outer membrane lipoproteins carrier protein [Vibrio cholerae O395]
 gi|149741426|gb|EDM55456.1| outer membrane lipoproteins carrier protein [Vibrio cholerae MZO-2]
 gi|150422595|gb|EDN14551.1| outer membrane lipoproteins carrier protein [Vibrio cholerae
           AM-19226]
 gi|227009168|gb|ACP05380.1| outer membrane lipoproteins carrier protein [Vibrio cholerae M66-2]
 gi|227012922|gb|ACP09132.1| outer membrane lipoproteins carrier protein [Vibrio cholerae O395]
 gi|229333577|gb|EEN99063.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           12129(1)]
 gi|229342558|gb|EEO07551.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae TM
           11079-80]
 gi|229344869|gb|EEO09843.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           RC9]
 gi|229347259|gb|EEO12219.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           TMA 21]
 gi|229350998|gb|EEO15939.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           B33]
 gi|229357520|gb|EEO22437.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae BX
           330286]
 gi|229370971|gb|ACQ61394.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           MJ-1236]
 gi|254843942|gb|EET22356.1| outer membrane lipoproteins carrier protein [Vibrio cholerae MO10]
 gi|255736595|gb|EET91992.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholera
           CIRS 101]
 gi|262021283|gb|EEY39997.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           RC27]
 gi|262029847|gb|EEY48495.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           INDRE 91/1]
 gi|262351314|gb|EEZ00447.1| outer membrane lipoprotein carrier protein LolA [Vibrio sp. RC586]
 gi|297536303|gb|EFH75136.1| outer-membrane lipoprotein carrier protein [Vibrio cholerae RC385]
 gi|297543121|gb|EFH79171.1| outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           MAK 757]
 gi|327483812|gb|AEA78219.1| Outer membrane lipoprotein carrier protein LolA [Vibrio cholerae
           LMA3894-4]
          Length = 198

 Score = 68.0 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 52/186 (27%), Gaps = 9/186 (4%)

Query: 22  FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGY---VMKGEFFMARPSKFY 75
                              E     +    TF Q      G       G+  +ARPS F 
Sbjct: 5   LALLFCSFSAIAAPKDTLSERLAMSEGFSATFNQQVLSPEGKVILTGNGKVDIARPSLFR 64

Query: 76  FKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRVES 133
           ++  +P    L+SDG+ +  ++  ++  ++Y           +              VE 
Sbjct: 65  WETETPDENLLVSDGTTLWHFDPFVEQVTLYRAEEALEQTPFVLLTRNKASDWDAYHVEE 124

Query: 134 NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
                T+                     +  +K+++   + S     K K+    +  VF
Sbjct: 125 KGDVFTLTPTALDSNQGRFQITISEKGVVQGFKVIEQDGQQSEFTFSKVKQ-QKPNASVF 183

Query: 194 EIPYDK 199
                K
Sbjct: 184 NYKVPK 189


>gi|221135428|ref|ZP_03561731.1| outer membrane lipoprotein carrier protein LolA [Glaciecola sp.
           HTCC2999]
          Length = 226

 Score = 68.0 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 22/188 (11%), Positives = 62/188 (32%), Gaps = 11/188 (5%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------VMKGEFFMARPSK 73
            +    A        +  +  +   +I ++Q TF Q              G   + +P++
Sbjct: 30  ILAASEAPLIANASLAKTELRQRLEAISSLQSTFTQTVTDEANNLIHSSSGNLVLQQPNR 89

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDT---WSVYPLRYMAFSVIFSNNQHVIQESIQR 130
            Y+    P    +I++G  +   +  ++    ++   +      ++ ++    + E    
Sbjct: 90  VYWHAQVPDETLVIANGDKVFYVDDFVEQVSIFNQADMVSDNPLMLLTSTDDKVWEQFSV 149

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
            +  +SF             +++ F +    L  + ++D+  + S   +     N  L  
Sbjct: 150 TQQADSFEVTPSSAQGQIQGLTLVFTQ--GELRAFTLLDNQAQRSEFVLSNITMNMPLPV 207

Query: 191 KVFEIPYD 198
             F+    
Sbjct: 208 SQFQYDIP 215


>gi|51245697|ref|YP_065581.1| hypothetical protein DP1845 [Desulfotalea psychrophila LSv54]
 gi|50876734|emb|CAG36574.1| unknown protein [Desulfotalea psychrophila LSv54]
          Length = 211

 Score = 68.0 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 28/207 (13%), Positives = 69/207 (33%), Gaps = 19/207 (9%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DA 58
           + K +I  + LFF        A+     +  + K  +     +     F+QE      + 
Sbjct: 1   MLKKII--LTLFFCLVASMALASEEEELNTFLHKIQQTSRQAEAFSTDFIQEKHLAMLNK 58

Query: 59  GYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFS 118
             + +G   + RP K  ++++SP   +LI +G      +++ +             V+  
Sbjct: 59  PVIFRGHLSLIRPDKLRWQFTSPLPSALIFNGEQGMRCDSEGEATPFLLSSDPVMRVVAE 118

Query: 119 NNQHVIQESIQRVESNNSF-----------ITIFFKDDFMGNMISVTFDRLSYRLLNWKI 167
              + +     ++                          + + +++ F+  S +    KI
Sbjct: 119 QLWNWLGGDYLKLSKLYRLSKMEPASLVIHFDKEGAISKILSRVTIRFNEKSLQPEQVKI 178

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVFE 194
           ++    ++ I     + N  L   +F 
Sbjct: 179 VERGGDFTRIFFKNPQLNIPLADDLFS 205


>gi|261344312|ref|ZP_05971956.1| outer membrane lipoprotein carrier protein LolA [Providencia
           rustigianii DSM 4541]
 gi|282567916|gb|EFB73451.1| outer membrane lipoprotein carrier protein LolA [Providencia
           rustigianii DSM 4541]
          Length = 206

 Score = 68.0 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 26/202 (12%), Positives = 64/202 (31%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K ++              +         + +   +    + + Q +F Q+         
Sbjct: 1   MKKMM-------LLGALALSLNVGQVLADASQDLQDRLSKVNSFQASFTQKVTSPEGDLI 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               G+ ++ RP+ F +  +SP    L+SDG N+  YN  ++  +V  L         + 
Sbjct: 54  QEGVGDLWIERPNLFNWNMTSPDESVLVSDGKNLWFYNPFVEQVTVTNLSDATQDTPFLL 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
               +        +    +   +  K                  +  +  ++   + S  
Sbjct: 114 ITRNNPQDWKQYSIIQQGNNFDLKPKQTNGTLKSFSITVNPQGTIEKFAAVEQDGQTSAY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
           ++ + ++N  +DP  F+    K
Sbjct: 174 QLKQ-QKNGAVDPSKFKFTVPK 194


>gi|188025791|ref|ZP_02959829.2| hypothetical protein PROSTU_01728 [Providencia stuartii ATCC 25827]
 gi|188020512|gb|EDU58552.1| hypothetical protein PROSTU_01728 [Providencia stuartii ATCC 25827]
          Length = 228

 Score = 67.6 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 24/202 (11%), Positives = 62/202 (30%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K ++              +         + +   +    + +   +F Q+         
Sbjct: 23  MKKMM-------LLGALALSLHIGSVLADASQDLQDRLNKVNSFHASFSQKVTSPEGDLV 75

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
               GE ++ RP+ F +  +SP    L+SDG N+  YN  ++  +V  L         + 
Sbjct: 76  QEGVGELWLQRPNLFNWNMTSPDESVLVSDGKNLWFYNPFVEQVTVTNLADATQDTPFLL 135

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
               +        +    +   +  K                  +  +  ++   + S  
Sbjct: 136 ITRNNPRDWKQYSIIQQGNTFDLKPKLSNGTLKRFSITVSPEGTIEKFSAVEQDGQTSAY 195

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
           ++ + ++N  +D + F     +
Sbjct: 196 QLKE-QKNGNVDKRKFTFTVPE 216


>gi|281357639|ref|ZP_06244126.1| hypothetical protein Vvad_PD0952 [Victivallis vadensis ATCC
           BAA-548]
 gi|281315896|gb|EFA99922.1| hypothetical protein Vvad_PD0952 [Victivallis vadensis ATCC
           BAA-548]
          Length = 209

 Score = 67.6 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 18/201 (8%), Positives = 60/201 (29%), Gaps = 18/201 (8%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYV------MKGEFFMA 69
              + +    A       Q  +K   +   ++T++  F+Q            + G   + 
Sbjct: 5   ILIALLAASTACAAPLSAQFREKLAANLGKVETVEAAFIQNRRLKSLDMTLAITGRLALE 64

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAF----------SVIFSN 119
           +  +  +    P     +     +A ++           + + +           +    
Sbjct: 65  KGKRMAWLVREPMRYMCVISEQGLAQWDGDSGEVLKLSAKRIPWLRLIYGSLSGWLSADL 124

Query: 120 NQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSY--RLLNWKIMDSSRRYSII 177
           +    + +++     +  +T      F   + +V F+      R+   +I++ +     I
Sbjct: 125 DALEKEFTVETSGERSLRLTPLDAGFFKEYVKTVEFEFGPGLDRVERLRIVEKNGDEMEI 184

Query: 178 KILKYKENTVLDPKVFEIPYD 198
                  N  +  + +++P  
Sbjct: 185 VFRDVVNNQPIPGERWQLPPP 205


>gi|254508471|ref|ZP_05120590.1| outer membrane lipoprotein carrier protein LolA [Vibrio
           parahaemolyticus 16]
 gi|219548583|gb|EED25589.1| outer membrane lipoprotein carrier protein LolA [Vibrio
           parahaemolyticus 16]
          Length = 198

 Score = 67.6 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 21/202 (10%), Positives = 50/202 (24%), Gaps = 21/202 (10%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +  ++ + F                    +  +     +     F Q+         
Sbjct: 1   MKKLAALLFMSFSVL------------AAPKDELNQRLQQTEGFSADFTQQVTSPDGDLV 48

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIF 117
              +G   ++RPS F +  + P    L+SDG ++  Y+  ++                + 
Sbjct: 49  MEGEGSVEISRPSLFRWTTTMPDENVLVSDGKSLWYYSPFIEQVSIYWQEQATEQTPFVL 108

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                        V       T+                     +  + +++   + S  
Sbjct: 109 LTRNRQSDWENYDVSQQGDVFTLVPTAVDSNQGQFKLEIDAKGAVKGFSVIEQDGQQSAF 168

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
           K       T    + F     +
Sbjct: 169 KFANIDL-TKPKAERFTFIIPQ 189


>gi|319778383|ref|YP_004129296.1| Outer membrane lipoprotein carrier protein LolA [Taylorella
           equigenitalis MCE9]
 gi|317108407|gb|ADU91153.1| Outer membrane lipoprotein carrier protein LolA [Taylorella
           equigenitalis MCE9]
          Length = 230

 Score = 67.6 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 70/220 (31%), Gaps = 30/220 (13%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSV-----------KKAIEHFLSIQTMQGTFL 54
              +   ++  F +      +                      +      ++Q+  GTF 
Sbjct: 1   MHKLSKYLLCGFIAISCFIGSTSHAQDKGEKLVFTSISVSARSQLKNFINNVQSASGTFE 60

Query: 55  QE--------------DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKL 100
           Q               +   + KGEF   RP KF +    P    ++SDGS +  Y+  L
Sbjct: 61  QSQVVLGWGAAEGQTLNTSDLQKGEFVFERPGKFAWIVKEPLEQQIVSDGSVLLQYDPDL 120

Query: 101 DTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFD 156
              +   ++        S++F N++      ++ +     +I    K    G    +   
Sbjct: 121 LQVTERDVKKAIGTSPASILFGNSKIETSFKLENLPEKEGWIRARPKQSDSGMKY-IDIH 179

Query: 157 RLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIP 196
            +        IMDS  + + IK    KE   L    F++ 
Sbjct: 180 FIDGMPTELLIMDSFDKTTSIKFTSIKEGNPLGASAFKLK 219


>gi|153828118|ref|ZP_01980785.1| outer membrane lipoproteins carrier protein [Vibrio cholerae
           623-39]
 gi|148876360|gb|EDL74495.1| outer membrane lipoproteins carrier protein [Vibrio cholerae
           623-39]
          Length = 198

 Score = 67.6 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 52/186 (27%), Gaps = 9/186 (4%)

Query: 22  FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGY---VMKGEFFMARPSKFY 75
                              E     +    TF Q      G       G+  +ARPS F 
Sbjct: 5   LALLFCSFSAIAAPKDTLSERLAMSEGFSATFNQQVLSPEGKVILTGNGKVDIARPSLFR 64

Query: 76  FKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRVES 133
           ++  +P    L+SDG+ +  ++  ++  ++Y           +              VE 
Sbjct: 65  WETETPDENLLVSDGTTLWHFDPFVEQVTLYRAEEALEQTPFVLLTRNKASDWDAYHVEE 124

Query: 134 NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
                T+                     +  +K+++   + S     K K+    +  VF
Sbjct: 125 KGDVFTLTPTALDSNQGRFQITISEKGVVQGFKVIEQDGQQSEFTFSKVKQ-QKPNASVF 183

Query: 194 EIPYDK 199
                K
Sbjct: 184 NYKVPK 189


>gi|223936662|ref|ZP_03628573.1| outer membrane lipoprotein carrier protein LolA [bacterium
           Ellin514]
 gi|223894826|gb|EEF61276.1| outer membrane lipoprotein carrier protein LolA [bacterium
           Ellin514]
          Length = 259

 Score = 67.6 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/218 (11%), Positives = 55/218 (25%), Gaps = 27/218 (12%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIE-HFL---SIQTMQGTFLQEDAG 59
           L  K++    I+F   A       +   +       +        ++QT    F Q    
Sbjct: 27  LSQKAISFRFIIFLLYAALCLLGRHAGAQGTESDALVTGWLNAQTNMQTWSADFTQVRTL 86

Query: 60  Y------VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAF 113
                     G  + A P++F ++   P     + +   + V    L     +PL     
Sbjct: 87  KSLTQPLTATGHVWFAAPNRFRWELGKPPKTIAVREADQLMVIYPLLKRAERFPLSGSQA 146

Query: 114 SVIFSNNQHVIQESIQRVESNNSFITIFFKD-----------------DFMGNMISVTFD 156
                    +     +      S   +  +                        I + F+
Sbjct: 147 GQWKDTLALLDAGFPRSRTELESRFNLLSQTTRNGVHEIVLQPKSTAARRFMPEIRIAFE 206

Query: 157 RLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
             ++ L + ++  S              N  +D   F 
Sbjct: 207 TNTFSLRSTELEFSDGSTMKNIFTNETLNPKIDDSFFN 244


>gi|114562971|ref|YP_750484.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           frigidimarina NCIMB 400]
 gi|123026351|sp|Q083B9|LOLA_SHEFN RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|114334264|gb|ABI71646.1| outer membrane lipoprotein carrier protein LolA [Shewanella
           frigidimarina NCIMB 400]
          Length = 214

 Score = 67.2 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/173 (14%), Positives = 64/173 (36%), Gaps = 12/173 (6%)

Query: 38  KAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSPSSVSLISDGS 91
           +      +I ++  TF Q+             G F +A P++FY+  + P    +++DG+
Sbjct: 28  ELRAKLSNIDSLHATFSQQVTDINSKPIQTGSGVFALAYPNQFYWHLTQPDESLIVADGA 87

Query: 92  NIAVYNAKLDTWSVYPLRY----MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFM 147
           N+ +YN   +  +V  +         +++   ++    +      + +   T F      
Sbjct: 88  NLWIYNPFAEEVTVMDVAQAVDASPMALLVHRDEATWAKYSVTKRAVSGKSTCFDIQPKK 147

Query: 148 GNMISVTFD--RLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
            N   V       + +L+ + + D     S   + + ++    +  +F+    
Sbjct: 148 LNSNVVAVSVCFEASQLVKFNLTDEQGNLSQFALTQQRKVKDNEANIFKFAVP 200


>gi|90021339|ref|YP_527166.1| periplasmic chaperone LolA [Saccharophagus degradans 2-40]
 gi|123277075|sp|Q21K25|LOLA_SACD2 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|89950939|gb|ABD80954.1| outer membrane lipoprotein carrier protein LolA [Saccharophagus
           degradans 2-40]
          Length = 208

 Score = 67.2 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/195 (14%), Positives = 64/195 (32%), Gaps = 14/195 (7%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARP 71
              +        + +   +   I       T+ G  +Q             + EF + RP
Sbjct: 6   VCLVAVTMLVATVVRADDIDALIGKLDQFNTVSGKAMQVITSADGEEIQKTESEFKILRP 65

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDT---WSVYPLRYMAFSVIFSNNQHVIQESI 128
             FY++   P    ++S+   I+VY+  L+    +    +R    S++  N   + ++  
Sbjct: 66  GYFYWRTLPPYEQIIVSNPDTISVYDPDLEQVSIYQSEKMRNSPASILSGNRSAIEKQFK 125

Query: 129 QRV-----ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
                   +  ++   + + D    +   +T      +L +  + D   + + I   K  
Sbjct: 126 VTKSGASNDKKSTSFELSYLDTANADFKKLTVTFKKDQLASIVMHDMLDQVTSITFGKVN 185

Query: 184 ENTVLDPKVFEIPYD 198
               L P  FE    
Sbjct: 186 TKAALTPAQFEFTPP 200


>gi|188534280|ref|YP_001908077.1| outer-membrane lipoprotein carrier protein [Erwinia tasmaniensis
           Et1/99]
 gi|229485829|sp|B2VC57|LOLA_ERWT9 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|188029322|emb|CAO97199.1| Outer membrane lipoproteins carrier protein [Erwinia tasmaniensis
           Et1/99]
          Length = 203

 Score = 67.2 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/194 (13%), Positives = 60/194 (30%), Gaps = 13/194 (6%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMA 69
              S       +       +     +    +++   TF Q+            +GE ++ 
Sbjct: 4   LIISCCLLATFSAAGAWADAAGDLQQRLDKVKSFHATFSQKVTDGSGTSVQDGEGEMWVQ 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQHVIQ 125
           RP+ F +   +P    LISDG  +  YN  ++  S            F +I  N     +
Sbjct: 64  RPNLFNWHMITPDESILISDGKTLWFYNPFVEQASASLLKDATSNTPFMLIARNQASDWK 123

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +     + ++  +T    D  +           +  +  +  ++   + S   +   +  
Sbjct: 124 QYHVAQKGDDFSLTPKSADGNLKQFTINV--AQNGTINQFSAVEQDGQRSNYALKSQQSG 181

Query: 186 TVLDPKVFEIPYDK 199
             +    F+    K
Sbjct: 182 P-ISADKFKFRPPK 194


>gi|315179810|gb|ADT86724.1| outer-membrane lipoprotein carrier protein [Vibrio furnissii NCTC
           11218]
          Length = 198

 Score = 67.2 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/201 (12%), Positives = 48/201 (23%), Gaps = 21/201 (10%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV- 61
            K    +    F                   +   E           F Q      G V 
Sbjct: 1   MKKWFALFFCSFSVF------------ATPKETLSERLALTDGFSAKFEQQVISPDGDVV 48

Query: 62  --MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIF 117
               G   +ARPS F ++  +P    L+SDG ++  Y+  ++                + 
Sbjct: 49  MEGNGVVDIARPSLFRWETLAPDENLLVSDGQSLWYYSPFIEQVTIYNQEQATEQTPFVL 108

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                       +VE      T+                     +  + +++   + S  
Sbjct: 109 LTRNRASDWDAYQVEEKGDVFTLTPTAVDSNQGQFQITIDTHGVVKGFNVIEQDGQRSQF 168

Query: 178 KILKYKENTVLDPKVFEIPYD 198
                K+        F+    
Sbjct: 169 TFADVKQ-QKPQASRFKFDVP 188


>gi|260768111|ref|ZP_05877045.1| outer membrane lipoprotein carrier protein LolA [Vibrio furnissii
           CIP 102972]
 gi|260616141|gb|EEX41326.1| outer membrane lipoprotein carrier protein LolA [Vibrio furnissii
           CIP 102972]
          Length = 198

 Score = 67.2 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/201 (12%), Positives = 49/201 (24%), Gaps = 21/201 (10%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV- 61
            K    +    F                   +   E           F Q      G V 
Sbjct: 1   MKKWFALFFCSFSVF------------ATPKETLSERLALTDGFSAKFEQQVISPDGDVV 48

Query: 62  --MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIF 117
               G   +ARPS F ++  +P    L+SDG ++  Y+  ++                + 
Sbjct: 49  MEGNGVVDIARPSLFRWETLAPDENLLVSDGQSLWYYSPFIEQVTIYNQEQATEQTPFVL 108

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                       +VE      T+                     +  + +++   + S+ 
Sbjct: 109 LTRNRASDWDAYQVEEKGDVFTLTPTAVDSNQGQFQITIDSKGVVKGFNVIEQDGQKSLF 168

Query: 178 KILKYKENTVLDPKVFEIPYD 198
                K+        F+    
Sbjct: 169 TFNDVKQ-QKPQASRFKFDVP 188


>gi|213851470|ref|ZP_03381368.1| outer-membrane lipoprotein carrier protein [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
          Length = 192

 Score = 66.8 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/186 (12%), Positives = 61/186 (32%), Gaps = 13/186 (6%)

Query: 24  FNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFK 77
            +         +          + +   TF Q+            +G+ ++ RP+ F + 
Sbjct: 1   SSVVASSVWADAASSLKSRLDKVSSFHATFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWH 60

Query: 78  YSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQESIQRVES 133
            + P    L+SDG  +  YN  ++  +            F +I  N     Q+   + + 
Sbjct: 61  MTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQASDWQQYNIKQDG 120

Query: 134 NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
           +N  +T    +  +              +  +  ++   + S  ++   ++N  ++P  F
Sbjct: 121 DNFVLTPKASNGNLKQFTINV--GRDGTIHQFSAVEQDDQRSAYQLKS-QQNGAVEPSKF 177

Query: 194 EIPYDK 199
                +
Sbjct: 178 TFTPPQ 183


>gi|224367520|ref|YP_002601683.1| outer membrane lipoprotein carrier protein precursor
           [Desulfobacterium autotrophicum HRM2]
 gi|223690236|gb|ACN13519.1| outer membrane lipoprotein carrier protein precursor
           [Desulfobacterium autotrophicum HRM2]
          Length = 267

 Score = 66.8 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/208 (12%), Positives = 66/208 (31%), Gaps = 15/208 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA------G 59
            +  + +V+     +     A       ++V   IEH  S Q     F Q          
Sbjct: 49  KRFCLAMVLSVVLFSFANAQADTQTPDLETVLTGIEHRYSGQDFTANFYQTSRLAAIEIT 108

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--------WSVYPLRYM 111
               G+ F + P +  ++Y  P    +I++G  + +Y  + +         +        
Sbjct: 109 ETANGQAFFSHPGRMRWEYQEPERQEIITNGKTLWIYRTEENQVVKGDAAAFFKTGGGGA 168

Query: 112 AFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS 171
             S I            +      + + +  + +     I +   R ++ +   +  ++ 
Sbjct: 169 FLSDITLIRIDYTITLGKFDTDFVTLVLVPKRQNPEITTIDIRVSRTTFDVDRVETTNTY 228

Query: 172 RRYSIIKILKYKENTVLDPKVFEIPYDK 199
              +I++  +      L+  +FE    +
Sbjct: 229 GDTTILEFKEITF-HKLEKALFEFTVPE 255


>gi|260898066|ref|ZP_05906562.1| outer membrane lipoprotein carrier protein LolA [Vibrio
           parahaemolyticus Peru-466]
 gi|308088960|gb|EFO38655.1| outer membrane lipoprotein carrier protein LolA [Vibrio
           parahaemolyticus Peru-466]
          Length = 189

 Score = 66.8 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/177 (10%), Positives = 43/177 (24%), Gaps = 9/177 (5%)

Query: 31  TKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEFFMARPSKFYFKYSSPSSV 84
                  +  +     +     F Q      G      +G   +ARPS F +  + P   
Sbjct: 5   NAASPKDELNKRLAMNEGFSADFSQQVISPEGETVMEGEGTVEIARPSLFRWSTTFPDEN 64

Query: 85  SLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFF 142
            L+SDG  +  Y+  ++                +             ++    +  T+  
Sbjct: 65  LLVSDGKTLWYYSPFIEQVSIYWQEQATEQTPFVLLTRNRASDWDNYKISQKGNEFTLIP 124

Query: 143 KDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                              +  + +++   +  +      K         F     K
Sbjct: 125 TAVDSTQGQFQINIDAKGVVKGFNVIEQDGQKGLFTFSNVKLGKP-KADRFTFTVPK 180


>gi|59711513|ref|YP_204289.1| outer-membrane lipoprotein carrier protein [Vibrio fischeri ES114]
 gi|71648708|sp|Q5E6E5|LOLA_VIBF1 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|59479614|gb|AAW85401.1| lipoprotein chaperone [Vibrio fischeri ES114]
          Length = 198

 Score = 66.8 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/187 (12%), Positives = 55/187 (29%), Gaps = 9/187 (4%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
            +F               +  E        +  F Q+            +G+  + RP+ 
Sbjct: 4   FLFSLCLLSSTVLASPQSELTERLNQNAGFEAGFTQKVLSPEGDVLMQGEGDVKILRPNL 63

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRV 131
           F +   +P    L++DG+ +  YN  ++  ++  L         +              V
Sbjct: 64  FRWHTQTPDENLLVTDGNTLWYYNPFVEQVTLMGLEKATTQTPFVLLTRNKASDWDNYSV 123

Query: 132 ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPK 191
             N    T+  K D       +   + + ++  + +++   + S     K++        
Sbjct: 124 SQNGDAFTVSPKADSAVKSEFIVRIQENGKVTGFSVVEQDGQRSDFDFTKFEA-KKPAKD 182

Query: 192 VFEIPYD 198
            F     
Sbjct: 183 NFTFAIP 189


>gi|323498306|ref|ZP_08103308.1| lipoprotein chaperone [Vibrio sinaloensis DSM 21326]
 gi|323316734|gb|EGA69743.1| lipoprotein chaperone [Vibrio sinaloensis DSM 21326]
          Length = 198

 Score = 66.8 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/187 (10%), Positives = 45/187 (24%), Gaps = 9/187 (4%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEFFMARPSKF 74
           +                +              F Q      G V    +G+  +ARPS F
Sbjct: 4   LAALLFMSLSVLAAPKDELSHRLQLTGGFSADFAQQVTSPDGEVVMEGEGKVEIARPSLF 63

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIFSNNQHVIQESIQRVE 132
            +  + P    L+SDG ++  Y+  ++                +             +V 
Sbjct: 64  RWTTTLPDENVLVSDGESLWYYSPFIEQVSIYWQEQATEQTPFVLLTRSRASDWDNYKVS 123

Query: 133 SNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
                 T+                     +  + +++   + S  +            + 
Sbjct: 124 QQGDVFTLVPTAVDSNQGQFKLEIDTKGAVKGFSVIEQDGQKSAFEFDNIDL-AKPKTER 182

Query: 193 FEIPYDK 199
           F     +
Sbjct: 183 FTFTIPQ 189


>gi|73667459|ref|YP_303475.1| hypothetical protein Ecaj_0846 [Ehrlichia canis str. Jake]
 gi|72394600|gb|AAZ68877.1| hypothetical protein Ecaj_0846 [Ehrlichia canis str. Jake]
          Length = 193

 Score = 66.8 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/187 (15%), Positives = 83/187 (44%), Gaps = 3/187 (1%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED--AGYVMKGEFF 67
           + + +++ +  I  F + +  + ++   +A+ +F +I + +  F+Q +        G   
Sbjct: 1   MKISVVYIFFFIVCFFSVHSYSSEKIKVEALSYFNTIHSFKAEFVQTNSANNVAQYGTLI 60

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQES 127
           M +P    + Y +P+  S+I  G+ I+ Y+ +L+ +S   +     +++ S+ +++    
Sbjct: 61  MKKPGLLKWDYYAPTPASIIIQGTTISYYDKELEEYSYAIVNNPIINLLSSDIKNIEDII 120

Query: 128 IQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
              + + ++   I  +D     + +V F+     ++   I++       IK    + N  
Sbjct: 121 FTNISTVDNNKIITLQDKKTQILAAVVFNVNPITIVGLNIINP-DSTIYIKFYNIQNNIT 179

Query: 188 LDPKVFE 194
           ++   F+
Sbjct: 180 IEESEFK 186


>gi|197334699|ref|YP_002155668.1| outer membrane lipoprotein carrier protein LolA [Vibrio fischeri
           MJ11]
 gi|229485843|sp|B5FCK5|LOLA_VIBFM RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|197316189|gb|ACH65636.1| outer membrane lipoprotein carrier protein LolA [Vibrio fischeri
           MJ11]
          Length = 198

 Score = 66.8 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/187 (12%), Positives = 55/187 (29%), Gaps = 9/187 (4%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
            +F               +  E        +  F Q+            +G+  + RP+ 
Sbjct: 4   FLFSLCLLSSTVLASPQSELTERLNQNAGFEAGFTQKVLSPEGDVLMQGEGDVKILRPNL 63

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRV 131
           F +   +P    L++DG+ +  YN  ++  ++  L         +              V
Sbjct: 64  FRWHTQTPDENLLVTDGNTLWYYNPFVEQVTLMGLEKATTQTPFVLLTRNKASDWDNYSV 123

Query: 132 ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPK 191
             N    T+  K D       +   + + ++  + +++   + S     K++        
Sbjct: 124 SQNGDAFTVSPKADSAVKSEFIVRIQENGKVTGFSVVEQDGQRSDFDFTKFEA-KKPAKN 182

Query: 192 VFEIPYD 198
            F     
Sbjct: 183 NFTFAIP 189


>gi|326572779|gb|EGE22765.1| outer-membrane lipoproteins carrier protein [Moraxella catarrhalis
           BC7]
 gi|326573998|gb|EGE23947.1| outer-membrane lipoproteins carrier protein [Moraxella catarrhalis
           CO72]
          Length = 145

 Score = 66.8 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/136 (13%), Positives = 46/136 (33%), Gaps = 4/136 (2%)

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSVIFSNNQHV 123
           + R ++F ++  SP+   ++++G+ + +Y+  L   +   +          ++  +   +
Sbjct: 3   VQRQNQFRWETKSPAEQLIVANGNTMWIYDKDLQQATRQSVGSQIGEVPALLLSGDPSQI 62

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
            +         N    I        N  S++      R +   + DS  + + I+     
Sbjct: 63  DRHFNVSQPDANKNYFILTPKSSNANFGSLSLSFNGGRPVMMVLQDSIGQTTTIQFSNIA 122

Query: 184 ENTVLDPKVFEIPYDK 199
            N  L    F      
Sbjct: 123 LNKKLPATQFNFTPPN 138


>gi|288930725|ref|YP_003434785.1| hypothetical protein Ferp_0331 [Ferroglobus placidus DSM 10642]
 gi|288892973|gb|ADC64510.1| conserved hypothetical protein [Ferroglobus placidus DSM 10642]
          Length = 324

 Score = 66.8 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/197 (14%), Positives = 66/197 (33%), Gaps = 12/197 (6%)

Query: 13  VILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEF----FM 68
            I    + +   +A   ++ ++  KK  E + S+   +G       G             
Sbjct: 3   KIFVILATLVFVSACTQMSAEEIAKKLEEKYDSVNDFKGKISYTMIGESGNITMEYEYVF 62

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESI 128
            +P+K  +  +  +   ++S+G  + +Y+ K +   V  +  M  +  +      + E  
Sbjct: 63  KKPNKI-WMRNEKAGTLIVSNGEKMWIYDEKKNEVFVMNVSKMPVNPDYGKLVKEMLEMY 121

Query: 129 ------QRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKY 182
                     +      I  K   M     +  D+  +  L  +  +S     I +    
Sbjct: 122 EVKLLGVERVAERECYVIELKSKEMNQSAKMWVDKEFWYPLRIE-SESYGIKIITEYKNV 180

Query: 183 KENTVLDPKVFEIPYDK 199
           + NT +  ++FE    +
Sbjct: 181 EFNTGVSDELFEFKIPE 197


>gi|156934614|ref|YP_001438530.1| outer-membrane lipoprotein carrier protein [Cronobacter sakazakii
           ATCC BAA-894]
 gi|166230490|sp|A7MER9|LOLA_ENTS8 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|156532868|gb|ABU77694.1| hypothetical protein ESA_02448 [Cronobacter sakazakii ATCC BAA-894]
          Length = 204

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/204 (12%), Positives = 61/204 (29%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +         +       A       +          + +   +F Q+         
Sbjct: 1   MKKI-------AVTCALLSAFAVSSVWADAAGDLKSRLDKVSSFHASFTQKVTDGSGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYP----LRYMAFSV 115
              +G+ ++ RP+ F +  + P    LISDG  +  YN  ++  S            F +
Sbjct: 54  QEGQGDLWVKRPNLFNWHMTQPDESVLISDGKTLWFYNPFVEQASATWLKDATSNTPFML 113

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
           I  N     Q+   +   ++  +T       +           +     +  ++   + S
Sbjct: 114 IARNQSSDWQQYNIKQNGDDFVLTPKSASGNLKQFTINVSRDGTIN--QFSAVEQDDQRS 171

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
             ++   ++N  +D   F     +
Sbjct: 172 SYQLKS-QQNGAVDMSKFTFTPPQ 194


>gi|326567958|gb|EGE18055.1| outer-membrane lipoproteins carrier protein [Moraxella catarrhalis
           BC1]
 gi|326577033|gb|EGE26928.1| outer-membrane lipoproteins carrier protein [Moraxella catarrhalis
           101P30B1]
          Length = 146

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/136 (13%), Positives = 46/136 (33%), Gaps = 4/136 (2%)

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSVIFSNNQHV 123
           + R ++F ++  SP+   ++++G+ + +Y+  L   +   +          ++  +   +
Sbjct: 4   VQRQNQFRWETKSPAEQLIVANGNTMWIYDKDLQQATRQSVGSQIGEVPALLLSGDPGQI 63

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
            +         N    I        N  S++      R +   + DS  + + I+     
Sbjct: 64  DRHFNVSQPDVNKNYFILTPKSSNANFGSLSLSFNGGRPVMMVLQDSIGQTTTIQFSNIA 123

Query: 184 ENTVLDPKVFEIPYDK 199
            N  L    F      
Sbjct: 124 LNKKLPATQFNFTPPN 139


>gi|261253434|ref|ZP_05946007.1| outer membrane lipoprotein carrier protein LolA [Vibrio orientalis
           CIP 102891]
 gi|260936825|gb|EEX92814.1| outer membrane lipoprotein carrier protein LolA [Vibrio orientalis
           CIP 102891]
          Length = 198

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/202 (10%), Positives = 50/202 (24%), Gaps = 21/202 (10%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGY-- 60
            K +  + ++ F                    +  +           F Q      G   
Sbjct: 1   MKKLAVLFLMSFSVL------------AAPKDELSQRLQKNDGFSADFAQQLISPEGDLV 48

Query: 61  -VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIF 117
              +G+  +ARPS F +  ++P    L+SDG ++  Y+  ++                + 
Sbjct: 49  MEGQGKVEIARPSLFRWTTTAPDENVLVSDGQSLWYYSPFIEQVSIYWQEQATEQTPFVL 108

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                       +V+       +                     +  + +++   + S  
Sbjct: 109 LTRNRASDWDNYKVDQQGDTFILTPTAVDSNQGQFKLSIDEQGAVQGFSVVEQDGQQSNF 168

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
                  N       F     +
Sbjct: 169 TFNNINLNKP-KANRFTFVIPE 189


>gi|326569461|gb|EGE19521.1| outer-membrane lipoproteins carrier protein [Moraxella catarrhalis
           BC8]
          Length = 146

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/136 (13%), Positives = 46/136 (33%), Gaps = 4/136 (2%)

Query: 68  MARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM----AFSVIFSNNQHV 123
           + R ++F ++  SP+   ++++G+ + +Y+  L   +   +          ++  +   +
Sbjct: 4   VQRQNQFRWETKSPAEQLIVANGNTMWIYDKDLQQATRQSVGSQIGEVPALLLSGDPSQI 63

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
            +         N    I        N  S++      R +   + DS  + + I+     
Sbjct: 64  DRHFNVSQPDANKNYFILTPKSSNANFGSLSLSFNGGRPVMMVLQDSIGQTTTIQFSNIA 123

Query: 184 ENTVLDPKVFEIPYDK 199
            N  L    F      
Sbjct: 124 LNKKLPATQFNFTPPN 139


>gi|291616895|ref|YP_003519637.1| LolA [Pantoea ananatis LMG 20103]
 gi|291151925|gb|ADD76509.1| LolA [Pantoea ananatis LMG 20103]
          Length = 203

 Score = 66.1 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/168 (13%), Positives = 56/168 (33%), Gaps = 9/168 (5%)

Query: 40  IEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
            +    + +   +F Q+            +GE ++ RPS F +  ++P    ++SDG ++
Sbjct: 28  QQRLNKVNSFHASFTQKVTDGSGANVQDGEGELWVKRPSLFNWHMTAPDESVIVSDGKSL 87

Query: 94  AVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMI 151
             YN  ++  +V  L+    +   +              V+       +  K        
Sbjct: 88  WFYNPFVEQATVSLLKNATSNTPFMLIARNQSSDWQQYNVKQQGDKFELTPKKSDGNLKQ 147

Query: 152 SVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                     +  +  ++   + S  ++   ++N  + P  F     K
Sbjct: 148 FTIDVTPDGTINQFSAVEQDGQRSNYQLKS-QKNGPISPDKFTFTPPK 194


>gi|296103103|ref|YP_003613249.1| outer membrane lipoprotein carrier protein LolA [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
 gi|295057562|gb|ADF62300.1| outer membrane lipoprotein carrier protein LolA [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
          Length = 203

 Score = 66.1 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/202 (9%), Positives = 59/202 (29%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +         +     +         +          + +   +F Q+         
Sbjct: 1   MKKI-------AIACALLTSFVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGNAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +G+ ++ RP+ F +  + P    L+SDG  +  +N  ++  +   L+    +   + 
Sbjct: 54  QEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFFNPFVEQATATWLKDATSNTPFML 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                        ++ N     +  K               +  +  +  ++   + S  
Sbjct: 114 IARNQASDWQQYNIKQNGDEFVLTPKGSNGNLKQFTINVSTNGTINQFGAVEQDDQRSSY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
           ++   ++N  +D   F     +
Sbjct: 174 QLKS-QQNGAVDASKFTFTPPQ 194


>gi|254480621|ref|ZP_05093868.1| outer membrane lipoprotein carrier protein LolA [marine gamma
           proteobacterium HTCC2148]
 gi|214039204|gb|EEB79864.1| outer membrane lipoprotein carrier protein LolA [marine gamma
           proteobacterium HTCC2148]
          Length = 207

 Score = 66.1 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 26/182 (14%), Positives = 67/182 (36%), Gaps = 13/182 (7%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQE----DAGY---VMKGEFFMARPSKFYFKYSSP 81
             + + + ++ I    S+  +QG F Q     D      +  G F + +P  F +   SP
Sbjct: 19  ARSNESATEQLIVELESLNQLQGRFEQTQFAADQDQPSALSSGHFKLLKPMYFLWDIDSP 78

Query: 82  SSVSLISDGSNIAVYNAKLDTWSVY----PLRYMAFSVIFSNNQHVIQESIQRVESNNSF 137
            +  +++DG ++  ++  L+T +        +     V+  +   + +           F
Sbjct: 79  DNQLIVADGEHLWHHDRDLETVTRRSVAGHDQLSPLQVLAGDRAILSERFEVSRTGEGRF 138

Query: 138 ITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
           + +          +++ F   + ++   ++ D   +   I++     +T L P  F    
Sbjct: 139 LLVPIDGSPGFRSLTLVF--ANGQISAMEVNDQLNQRLFIQLQDVDSDTALMPADFGFVP 196

Query: 198 DK 199
            +
Sbjct: 197 PE 198


>gi|146311072|ref|YP_001176146.1| outer-membrane lipoprotein carrier protein [Enterobacter sp. 638]
 gi|166990716|sp|A4W8R5|LOLA_ENT38 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|145317948|gb|ABP60095.1| outer membrane lipoprotein carrier protein LolA [Enterobacter sp.
           638]
          Length = 204

 Score = 66.1 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 22/194 (11%), Positives = 60/194 (30%), Gaps = 13/194 (6%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMA 69
                    +         +          + +   +F Q+            +G+ ++ 
Sbjct: 4   IAIVGALLTSFVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGNAVQEGQGDLWVK 63

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS----VYPLRYMAFSVIFSNNQHVIQ 125
           RP+ F +  + P    L+SDG  +  YN  ++  +            F +I  N     Q
Sbjct: 64  RPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATLLKDATSNTPFMLIARNQTSDWQ 123

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
           +   +   ++  +T    +  +           +  +  +  ++   + S  ++   ++N
Sbjct: 124 QYNIKQNGDDFVLTPKTSNGNLKQFTINV--SNNGTINQFSAVEQDEQRSSYQLKS-QQN 180

Query: 186 TVLDPKVFEIPYDK 199
             +D   F     +
Sbjct: 181 GAIDASKFTFTPPQ 194


>gi|52307559|gb|AAU38059.1| LolA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 181

 Score = 66.1 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/169 (11%), Positives = 48/169 (28%), Gaps = 9/169 (5%)

Query: 39  AIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSN 92
             +    +      F Q  +           G+  + RP+ F     +P    +ISDG  
Sbjct: 1   MQQRLAQVNYFSADFNQNVSSANGKNVQTGSGKLQIKRPNLFRMDNKAPQETQIISDGKT 60

Query: 93  IAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNM 150
           +  Y+  ++  +   +     +   +   +      +   V  N     +  K       
Sbjct: 61  LWFYDPFVEQVTANWVENAVNNTPFVLLTSNDSANWNQYTVVQNGDTFVLKPKAKNSNIK 120

Query: 151 ISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                      L  +  ++   + ++  +     N  L   +F+    K
Sbjct: 121 QFDIRIDNQGVLKGFSTIEKDGQTNLYILRNI-TNQPLADSLFKFTVPK 168


>gi|84394176|ref|ZP_00992907.1| outer-membrane lipoprotein carrier protein precursor [Vibrio
           splendidus 12B01]
 gi|84375196|gb|EAP92112.1| outer-membrane lipoprotein carrier protein precursor [Vibrio
           splendidus 12B01]
          Length = 198

 Score = 65.7 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/198 (10%), Positives = 45/198 (22%), Gaps = 21/198 (10%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K V  ++ + F                   ++              F Q          
Sbjct: 1   MKKVFALLFMSFSVL------------ASPKEELSSRLSLNAGFSADFKQVVTSPDGDVV 48

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIF 117
              +G   +ARPS F ++ + P    L+SDG ++  Y+  ++                + 
Sbjct: 49  MEGEGTVEIARPSLFRWETTFPDENVLVSDGQSLWYYSPFIEQVSIYWQEQATSQTPFVL 108

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                        V    +  T+                     +  + +++   +    
Sbjct: 109 LTRNQESDWDNYNVAQTGNQFTLTPTAVDSNQGDFQIKITEKGIVQGFNVIEQDGQKGEF 168

Query: 178 KILKYKENTVLDPKVFEI 195
                          F  
Sbjct: 169 TFSNVDLGKP-AADRFTF 185


>gi|299142671|ref|ZP_07035801.1| outer membrane lipoprotein carrier protein LolA [Prevotella oris
           C735]
 gi|298575886|gb|EFI47762.1| outer membrane lipoprotein carrier protein LolA [Prevotella oris
           C735]
          Length = 205

 Score = 65.7 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 31/204 (15%), Positives = 75/204 (36%), Gaps = 18/204 (8%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMK 63
           +  ++LFF         A    +    ++      +++TMQ  F+Q       +   V +
Sbjct: 1   MKKLLLFFMVLCIANANAQSFNETTVRQQIENAAANMKTMQCDFVQTKTLRVLNDKMVSR 60

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNI------------AVYNAKLDTWSVYPLRYM 111
           G+ +  +  K  ++Y+SP   + I +GS +               +      +   +  +
Sbjct: 61  GKMYYQQSDKLRWEYTSPYLYTFILNGSKVLISKGKRNDVINVEQSKFFKEIARIMMNSV 120

Query: 112 AFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS 171
               +       +  S    E   +      +   M   I + F+R    +   ++++  
Sbjct: 121 VGKCLNDKKDFKVSLSATPTEYIATLFPQQRQMQQMFQKIILHFNRQRAMVAKVELVEKR 180

Query: 172 RRYSIIKILKYKENTVLDPKVFEI 195
             +++I++   K N+ ++ KVF I
Sbjct: 181 GDHTVIEMKNVKVNSPINAKVFTI 204


>gi|254469012|ref|ZP_05082418.1| outer membrane lipoprotein carrier protein LolA [beta
           proteobacterium KB13]
 gi|207087822|gb|EDZ65105.1| outer membrane lipoprotein carrier protein LolA [beta
           proteobacterium KB13]
          Length = 195

 Score = 65.7 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 26/187 (13%), Positives = 51/187 (27%), Gaps = 9/187 (4%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVM------KGEFFMARPSKF 74
           +  F     +       +            G F Q              GE    +P  F
Sbjct: 1   MLLFYLNINLLWAAPADELSSLLNKTIAFSGQFSQSVYDNKSQLIEEANGEVVFKKPHFF 60

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESN 134
            + Y +P    +I DG  + +Y+  L    +        +   +       E   +V   
Sbjct: 61  KWIYQAPHQNQIIGDGETVYIYDPDLSQVIMSKFSQSKNNNPANIFFLNNIEEYFKVTKI 120

Query: 135 ---NSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPK 191
              +             +  S+       ++   +++DS +   II  L   +N  +D  
Sbjct: 121 LIEDEIWYRCESKSKDIDYQSIEISFNEDKIHGMRVVDSLQNKIIINFLNILQNRNIDEA 180

Query: 192 VFEIPYD 198
            F     
Sbjct: 181 SFLFNVP 187


>gi|183220783|ref|YP_001838779.1| outer membrane lipoprotein carrier protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
 gi|189910883|ref|YP_001962438.1| outer membrane lipoprotein-sorting protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167775559|gb|ABZ93860.1| Outer membrane lipoprotein-sorting protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167779205|gb|ABZ97503.1| Outer-membrane lipoprotein carrier protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
          Length = 233

 Score = 65.7 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 66/216 (30%), Gaps = 26/216 (12%)

Query: 6   YKSVIGVVILFFYSAI--FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTF-LQEDAGYVM 62
            K  IG ++L    ++      A    +  + VKK  ++F  I +    F ++ +     
Sbjct: 1   MKVWIGFLLLVLGVSLEAQTSPAHNWHSPSEVVKKIKKNFSEINSYSADFLIKTEDNKKE 60

Query: 63  K---GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD----------------TW 103
           K   G+ F  RP K  + +S P    ++SDG  + ++  +L                   
Sbjct: 61  KQMRGKCFYKRPGKIRYNFSEPDGDEIVSDGKTLHIFIKRLGAVGKQDLTLDRKNSSGPI 120

Query: 104 SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITI----FFKDDFMGNMISVTFDRLS 159
                      +    +         R   +++   +      +       + +  D  S
Sbjct: 121 FTTNSPDGLNRLFRKYHYKFDTIEQPRSMGDSAKYFVLDLDQREKIGGFEKMKLFVDSES 180

Query: 160 YRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
           Y +      D   + + I       +  +   VF  
Sbjct: 181 YLIKKAVATDGRGKVTTISFSNINFSEEIQDGVFNF 216


>gi|260597295|ref|YP_003209866.1| lipoprotein chaperone [Cronobacter turicensis z3032]
 gi|260216472|emb|CBA29616.1| Outer-membrane lipoprotein carrier protein [Cronobacter turicensis
           z3032]
          Length = 204

 Score = 65.3 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 24/202 (11%), Positives = 58/202 (28%), Gaps = 16/202 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K +         +       A       +          + +   +F Q+         
Sbjct: 1   MKKI-------AVTCALLSAFAVSSVWADAAGDLKSRLDKVSSFHASFTQKVTDGSGAAV 53

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIF 117
              +G+ ++ RP+ F +  + P    LISDG  +  YN  ++  S   L+    +   + 
Sbjct: 54  QEGQGDLWVKRPNLFNWHMTQPDESVLISDGKTLWFYNPFVEQASATWLKDATSNTPFML 113

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                        ++ N     +  K                  +  +  ++   + S  
Sbjct: 114 IARNQSSDWQQYNIKQNGDDFVLMPKASSGNLKQFTINVSRDGTINQFSAVEQDDQRSNY 173

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
           ++   ++N  +D   F     +
Sbjct: 174 ELKS-QQNGAVDMSKFTFTPPQ 194


>gi|297181321|gb|ADI17512.1| outer membrane lipoprotein-sorting protein [uncultured bacterium
           HF0130_06E03]
          Length = 220

 Score = 65.3 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 26/203 (12%), Positives = 73/203 (35%), Gaps = 15/203 (7%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAG 59
               + ++++  +   F  +    IT  + VKK  +   +  T    F +E      D  
Sbjct: 1   MNQFVSILVVLLFYFTFFAHGVMAITGGEIVKKLRDRLENYVTYSMRFEKEFYWSALDKT 60

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY---NAKLDTWSVYPLRYMAFSVI 116
               G F+M  P+KF     +     +++DG  +  Y   N ++            + + 
Sbjct: 61  RSRSGTFYMQNPNKFRVGIDNG--DVVVADGITVWSYIDRNKQVLISDYEGDLQNPWQIF 118

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMI----SVTFDRLSYRLLNWKIMDSSR 172
              + + +   ++  + +     +    +   N +     +  D+  + +L  + ++++ 
Sbjct: 119 VDYSTNFVTIGVKETKISGKSAYMLSMKEESNNSLGRGLKIWVDKKKWWMLQIEFVETNG 178

Query: 173 RYSIIKILKYKENTVLDPKVFEI 195
             +  ++ ++K N  +    F  
Sbjct: 179 DITTYRLKEHKVNKKIRSSRFSF 201


>gi|323144223|ref|ZP_08078855.1| outer membrane lipoprotein carrier protein LolA [Succinatimonas
           hippei YIT 12066]
 gi|322415998|gb|EFY06700.1| outer membrane lipoprotein carrier protein LolA [Succinatimonas
           hippei YIT 12066]
          Length = 202

 Score = 65.3 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 27/203 (13%), Positives = 64/203 (31%), Gaps = 12/203 (5%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------VM 62
           +   +     +A   +  +                 +      +F+QE            
Sbjct: 1   MFKFIKCLAAAACLSYALS-GTAFADDKADLKAKLNAFNEFSASFVQEVTDKSGQEVMSS 59

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS-VIFSNNQ 121
            G   + +P+KF     +P    L   G++I  Y+  ++  S++    ++ S  I  ++ 
Sbjct: 60  NGIIALQKPAKFMLHTLNPDEQVLFCAGNDIYFYDPFVNQVSIFSRSELSASPFILLSDM 119

Query: 122 HVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILK 181
                +   V   N    I          + ++F       ++  + D     +  K+  
Sbjct: 120 SDNVWAHYDVRHENGVYIITPNRQGDIVNLRLSFKGSDIDTISLVMKD--GNINTYKLSD 177

Query: 182 YKENTVLDPKVFEIPYDKIHNIN 204
            +     DP+VFE    +   ++
Sbjct: 178 GRR--SADPQVFEYKIPEDAEVD 198


>gi|288817553|ref|YP_003431900.1| outer membrane lipoprotein carrier protein [Hydrogenobacter
           thermophilus TK-6]
 gi|288786952|dbj|BAI68699.1| outer membrane lipoprotein carrier protein [Hydrogenobacter
           thermophilus TK-6]
 gi|308751155|gb|ADO44638.1| outer membrane lipoprotein carrier protein LolA [Hydrogenobacter
           thermophilus TK-6]
          Length = 200

 Score = 65.3 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 29/189 (15%), Positives = 67/189 (35%), Gaps = 12/189 (6%)

Query: 22  FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARPSKFY 75
                   I+  Q+     +    I+T++  F+Q+          V KG F+  +  KF 
Sbjct: 4   LLLVLIPIISWGQAFSMLEKKLSEIKTLKVAFVQKVSYSWYPKADVSKGFFYAQKGGKFR 63

Query: 76  FKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYM-----AFSVIFSNNQHVIQESIQR 130
            +Y  P  + ++SDG  I +Y  K  +  +  +            + S     + + +  
Sbjct: 64  IEYEQPERMLIVSDGREILLYYPKEKSAIIDKVENNRSAVVEALFLLSKPISEVFDQVGE 123

Query: 131 VESNNSFITIFFKDDFMGNMISVTFD-RLSYRLLNWKIMDSSRRYSIIKILKYKENTVLD 189
           ++ +N+   +        N   V  +      + + ++ D     + ++ L   +N    
Sbjct: 124 IKRDNNTTLVLKPKVIDDNFYRVYVELDEELNIRSIRVEDKDGTTTTVEFLSLSKNFSPS 183

Query: 190 PKVFEIPYD 198
            ++F I   
Sbjct: 184 EELFRIRLP 192


>gi|281425204|ref|ZP_06256117.1| outer membrane lipoprotein carrier protein LolA [Prevotella oris
           F0302]
 gi|281400670|gb|EFB31501.1| outer membrane lipoprotein carrier protein LolA [Prevotella oris
           F0302]
          Length = 205

 Score = 65.3 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 31/204 (15%), Positives = 75/204 (36%), Gaps = 18/204 (8%)

Query: 10  IGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMK 63
           +  ++LFF         A    +    ++      +++TMQ  F+Q       +   V +
Sbjct: 1   MKKLLLFFMVLCIANANAQSFNETTVRQQIENAAANMKTMQCDFVQTKTLRMLNDKMVSQ 60

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNI------------AVYNAKLDTWSVYPLRYM 111
           G+ +  +  K  ++Y+SP   + I +GS +               +      +   +  +
Sbjct: 61  GKMYYQQSDKLRWEYTSPYLYTFILNGSKVLISKGKRNDVINVEQSKFFKEIARIMMNSV 120

Query: 112 AFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSS 171
               +       +  S    E   +      +   M   I + F+R    +   ++++  
Sbjct: 121 VGKCLNDKKDFKVSLSATPTEYIATLFPQQKQMQQMFQKIILHFNRQRAMVAKVELVEKR 180

Query: 172 RRYSIIKILKYKENTVLDPKVFEI 195
             +++I++   K N+ ++ KVF I
Sbjct: 181 GDHTVIEMKNVKVNSPINAKVFTI 204


>gi|260773039|ref|ZP_05881955.1| outer membrane lipoprotein carrier protein LolA [Vibrio
           metschnikovii CIP 69.14]
 gi|260612178|gb|EEX37381.1| outer membrane lipoprotein carrier protein LolA [Vibrio
           metschnikovii CIP 69.14]
          Length = 197

 Score = 64.9 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 27/200 (13%), Positives = 55/200 (27%), Gaps = 21/200 (10%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV- 61
            K    +V+LF   ++               +   +     +     F Q      G   
Sbjct: 1   MKK--WIVLLFCSFSVL----------ASPKETLSQRLALTEGFSAQFDQQVLSPEGETV 48

Query: 62  --MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIF 117
              KG   +ARP  F ++   P    L+SDG  +  Y+  ++                I 
Sbjct: 49  MEGKGTVEVARPGLFRWETFEPDENILVSDGQTLWYYSPFIEQVSIYNQQQATEQTPFIL 108

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                    +  +VE+     T+                    ++  + +++   + S  
Sbjct: 109 LTRNQASDWNAYQVEAEGDVFTLTPITFESNQGRFQIVIDAQGKVTGFTVIEQDGQQSRF 168

Query: 178 KILKYK-ENTVLDPKVFEIP 196
                  +   +    F IP
Sbjct: 169 TFHDVTLQKPPISRFQFVIP 188


>gi|189426246|ref|YP_001953423.1| outer membrane lipoprotein carrier protein LolA [Geobacter lovleyi
           SZ]
 gi|189422505|gb|ACD96903.1| outer membrane lipoprotein carrier protein LolA [Geobacter lovleyi
           SZ]
          Length = 237

 Score = 64.9 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 27/231 (11%), Positives = 66/231 (28%), Gaps = 37/231 (16%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DA 58
           + + +I + +            A   T  Q +    + + S+Q +Q +F Q         
Sbjct: 1   MKQRIITIFLSLALGGTISSAQAAEATLQQVIATLEQGYASLQDLQASFNQSTTLAGFPK 60

Query: 59  GYVMKGEFFMARP----SKFYFKYSSPSSVSLISDGSNIAVYNAKL-----------DTW 103
                GE  + RP    ++F F Y +    S+IS+G  +  Y  +               
Sbjct: 61  PQKGHGELALRRPPQGTAQFRFDY-AVPKQSIISNGKQVWFYQPENRQVLVSSLEGMMKG 119

Query: 104 SVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTF-------- 155
                      +   +       +    +   +++           +  +          
Sbjct: 120 GNSIGMAYLTGLGNVSKDFNAAFAKPSRDKQGNYLLELTPRKPTPVLSRLRLTIHEEAVN 179

Query: 156 -------DRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                   +  + ++   ++D S   + I   + + N+ L    F     +
Sbjct: 180 ALLADGQTKEPFPVVASTVVDGSGTETRISYSRIRTNSGLSAAKFNFKVPQ 230


>gi|218710025|ref|YP_002417646.1| outer-membrane lipoprotein carrier protein [Vibrio splendidus
           LGP32]
 gi|218323044|emb|CAV19221.1| Outer-membrane lipoprotein carrier protein precursor [Vibrio
           splendidus LGP32]
          Length = 199

 Score = 64.9 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/199 (10%), Positives = 46/199 (23%), Gaps = 21/199 (10%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----- 59
           + K V  ++ + F                   ++              F Q         
Sbjct: 1   MMKKVFALLFMSFSVF------------ASPKEELNSRLSLNAGFSADFKQVVTSPDGDV 48

Query: 60  -YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVI 116
               +G   +ARPS F ++ + P    L+SDG ++  Y+  ++                +
Sbjct: 49  VMEGEGTVEIARPSLFRWETTFPDENLLVSDGQSLWYYSPFIEQVSIYWQEQATSQTPFV 108

Query: 117 FSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSI 176
                         V    +  T+                     +  + +++   +   
Sbjct: 109 LLTRNQESDWDNYNVAQTGNQFTLTPTAVDSNQGDFQINITKKGIVQGFNVIEQDGQKGE 168

Query: 177 IKILKYKENTVLDPKVFEI 195
                           F  
Sbjct: 169 FTFNNVDLGKP-AADRFTF 186


>gi|260910706|ref|ZP_05917365.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260635216|gb|EEX53247.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 223

 Score = 64.9 bits (156), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 32/208 (15%), Positives = 78/208 (37%), Gaps = 18/208 (8%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAG 59
              ++ +++LF         A      DQ ++K  E     +++Q +F Q       +  
Sbjct: 16  MNHILSIILLFVPLIGHGQTAVNGGKADQMMQKVGEVAQKTKSLQCSFTQTKTLKMLNQK 75

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVY------------NAKLDTWSVYP 107
            ++KG    ++PSK  ++Y SP   + I +G+ + +             N      +   
Sbjct: 76  MIVKGRMCYSQPSKLRWQYISPYQYTFILNGTKVLMKSAQRKDVIDAAKNKVFREITAIM 135

Query: 108 LRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKI 167
           L  +    +    +   Q  +   +       +  +   M +++ +TFD         ++
Sbjct: 136 LSSLTGECLNDKQRFKTQMFVDGDKWIAQLTPLKKEMKQMFSLLVITFDSKQLIATTVEM 195

Query: 168 MDSSRRYSIIKILKYKENTVLDPKVFEI 195
            +     + I++ + K+N  +  + F+I
Sbjct: 196 REKGGDNTRIELHQVKKNVAVSDEEFKI 223


>gi|262200011|ref|YP_003271220.1| outer membrane lipoprotein carrier protein LolA [Haliangium
           ochraceum DSM 14365]
 gi|262083358|gb|ACY19327.1| outer membrane lipoprotein carrier protein LolA [Haliangium
           ochraceum DSM 14365]
          Length = 258

 Score = 64.9 bits (156), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 24/197 (12%), Positives = 55/197 (27%), Gaps = 20/197 (10%)

Query: 26  AAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKY- 78
           ++      Q V +  E ++  Q +   F Q           V  G+ ++ +P K  + Y 
Sbjct: 45  SSKLSDPAQVVARVQEFYIDTQRLTALFRQIYTNTTFGKKSVSDGKLWVKKPGKMRWDYR 104

Query: 79  --SSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAF-----------SVIFSNNQHVIQ 125
                   S ISDG+ +              L                 +       +  
Sbjct: 105 GSQKKVKKSFISDGTTLWAVEHDNQQVFKKNLEDDMLPVAVSFLYGKGDLARDFRPALDT 164

Query: 126 ESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
            +    +S+        K       + +  D  ++R+    ++++S   +  +       
Sbjct: 165 SNKYGKKSDYVLELTPRKPSAQYKTLYLVVDPGNFRVKESVVIEASGNTNHFRFFSPDTR 224

Query: 186 TVLDPKVFEIPYDKIHN 202
             +    F     +  N
Sbjct: 225 AGIQDAWFFFNEKRFKN 241


>gi|328954082|ref|YP_004371416.1| outer membrane lipoprotein carrier protein LolA [Desulfobacca
           acetoxidans DSM 11109]
 gi|328454406|gb|AEB10235.1| outer membrane lipoprotein carrier protein LolA [Desulfobacca
           acetoxidans DSM 11109]
          Length = 240

 Score = 64.9 bits (156), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 27/212 (12%), Positives = 72/212 (33%), Gaps = 19/212 (8%)

Query: 11  GVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA------GYVMKG 64
            +++L +   + P   A  ++ ++ + +  + + +    +  F QE            +G
Sbjct: 24  AMILLVWGFCLGPAGPAVAVSPEEIITQVQKKYDATGMFKTRFRQESQLKTAGAPDTAEG 83

Query: 65  EFFMARPSKFYFKYS--SPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQH 122
             F  +PS+  ++Y         +I+DG  +++Y  +     VYPL  +  S +      
Sbjct: 84  WLFFKKPSRMRWQYQYPPEQKKEVIADGREVSIYIPQDRMVMVYPLNQVLRSDLVMRFFS 143

Query: 123 VIQESIQRVESNNS----------FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSR 172
            +                            K       + +T D  ++ +   +  ++  
Sbjct: 144 GMGRLQTDFTVTWDRPYQIHEPIRIRLKPVKPQPELKHLILTIDPETFLVQALEFSNAYG 203

Query: 173 RYSIIKILKYKENTVLDPKVFEI-PYDKIHNI 203
            ++ +   + + +  L P  F   P   +  +
Sbjct: 204 DHTRMSFTQTQLDIKLAPGFFTFIPPPGVEIV 235


>gi|308198522|pdb|3KSN|A Chain A, Crystal Structure Of The Lipoprotein Localization Factor,
           Lola
          Length = 183

 Score = 64.5 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 22/176 (12%), Positives = 58/176 (32%), Gaps = 13/176 (7%)

Query: 34  QSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSPSSVSLI 87
            +          + +   +F Q+            +G+ ++ RP+ F +  + P    L+
Sbjct: 2   DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILV 61

Query: 88  SDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFK 143
           SDG  +  YN  ++  +            F +I  N     Q+   +   ++  +T    
Sbjct: 62  SDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKAS 121

Query: 144 DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           +  +              +  +  ++   + S  ++   ++N  +D   F     +
Sbjct: 122 NGNLKQFTINV--GRDGTIHQFSAVEQDDQRSSYQLKS-QQNGAVDAAKFTFTPPQ 174


>gi|308049687|ref|YP_003913253.1| outer membrane lipoprotein carrier protein LolA [Ferrimonas
           balearica DSM 9799]
 gi|307631877|gb|ADN76179.1| outer membrane lipoprotein carrier protein LolA [Ferrimonas
           balearica DSM 9799]
          Length = 202

 Score = 64.5 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 26/189 (13%), Positives = 67/189 (35%), Gaps = 11/189 (5%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPS 72
             +       P+      +        +   +  F Q             +G   MA P+
Sbjct: 7   LTLALGALVAPLAMAAPQQALQAKLAQLPEFEAQFEQVVTDPDGTLLQQGQGSLAMAVPN 66

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQR 130
           +F +   +P    ++SDG ++ +Y+  L+  S+Y L+       +   ++    + +  +
Sbjct: 67  RFAWHQQAPEESVILSDGEDVYLYDPLLEQVSIYDLQDATGQTPLSLLSSNDEAEWAAYQ 126

Query: 131 VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDP 190
           V  N    T+   D      +++ FD     + +  ++D  +  + + + ++     L+ 
Sbjct: 127 VSQNGDCFTLTPSDADGIQTMAICFDGD--AIESLSLVDGQQVETRMTLSRFHTGP-LEQ 183

Query: 191 KVFEIPYDK 199
             F     +
Sbjct: 184 GRFTFAAPE 192


>gi|206890469|ref|YP_002248971.1| outer membrane lipoprotein carrier protein LolA
           [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206742407|gb|ACI21464.1| outer membrane lipoprotein carrier protein LolA
           [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 203

 Score = 64.5 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 31/199 (15%), Positives = 65/199 (32%), Gaps = 11/199 (5%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFM 68
           +   +      A     +D ++ K    + +I    GTF+Q       D     KG+FF+
Sbjct: 3   ILLINLFIFLFANLVFAQDNAITKLNNAYKNINDASGTFIQTSYIKDLDKTQKFKGKFFI 62

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAK----LDTWSVYPLRYMAFSVIFSNNQHVI 124
               +  ++Y       +  +   + VY+      + +             + S    + 
Sbjct: 63  KA-DRIRWQYEGQFPQIIYLNKETLIVYDKIRKQAIQSSFSEEKYGQLPLALLSRMADIE 121

Query: 125 QESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKE 184
           ++     +S N+ I I          I +      + + + KI D++     I     K 
Sbjct: 122 KDFEITEKSENTLILIPKTKMGNIKKIELIIHEEDFPIKSLKITDNASNTVKIDFYSVKI 181

Query: 185 NTVLDPKVFEIPYDKIHNI 203
           N  L   +F+    K   +
Sbjct: 182 NINLKDSIFKFVPKKDDTV 200


>gi|15602121|ref|NP_245193.1| outer-membrane lipoprotein carrier protein [Pasteurella multocida
           subsp. multocida str. Pm70]
 gi|13431619|sp|P57835|LOLA_PASMU RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|12720485|gb|AAK02340.1| LolA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 205

 Score = 64.5 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 21/170 (12%), Positives = 52/170 (30%), Gaps = 9/170 (5%)

Query: 38  KAIEHFLSIQTMQGTFLQEDAGY------VMKGEFFMARPSKFYFKYSSPSSVSLISDGS 91
           +  +    +  +   + Q  +           G   + RP+ F     +P    +ISDG 
Sbjct: 27  ELQQRLSKVNVLSADYAQTVSSSDGKNVQQGSGTLKIKRPNLFRMDNKTPQENQIISDGK 86

Query: 92  NIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGN 149
            +  Y+  ++  +   ++    +   +   +      +   VE      T+  K      
Sbjct: 87  TLWFYDPFVEQVTANWVKDAVNNTPFVLLTSDDSSHWAQYNVEQKADTFTLKPKAKQSNI 146

Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                       L N+  ++   + ++  +     N  L   +F+    K
Sbjct: 147 KQFDIRIDSEGVLRNFSTIEKDGQTNLYILRNI-TNQPLADGIFKFSVPK 195


>gi|167626751|ref|YP_001677251.1| lipoprotein releasing system subunit A [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|189028551|sp|B0U0J9|LOLA_FRAP2 RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|167596752|gb|ABZ86750.1| lipoprotein releasing system, subunit A [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
          Length = 205

 Score = 64.5 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 25/191 (13%), Positives = 63/191 (32%), Gaps = 10/191 (5%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-------DAGYVMKGEFFMAR 70
              +     +   +   +    I    +I +M  +F Q+             KG   + +
Sbjct: 4   IVLLVTLVFSINYSFANASDDLINKIKNIHSMSASFDQKLINGGRASDNISSKGYMSLKK 63

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQR 130
           P  F +  ++P++  +IS+GS + +Y+  L+   +  +        +        ++I +
Sbjct: 64  PKFFRWITTTPNNQEIISNGSKLWIYDGDLEQVIIKKVSNNIAQFPYLILLSKNTDNINK 123

Query: 131 ---VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
              V+  +    +    +             +  L    I  S  +++ I     K +  
Sbjct: 124 LFTVKELDKNTYLLKPKNDQMIDSIQIKFSDNENLEYLAISTSLNQFTKISFSDVKTDID 183

Query: 188 LDPKVFEIPYD 198
           +D   F+    
Sbjct: 184 IDNNKFDFKIP 194


>gi|322435183|ref|YP_004217395.1| outer membrane lipoprotein carrier protein LolA [Acidobacterium sp.
           MP5ACTX9]
 gi|321162910|gb|ADW68615.1| outer membrane lipoprotein carrier protein LolA [Acidobacterium sp.
           MP5ACTX9]
          Length = 220

 Score = 64.5 bits (155), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 22/181 (12%), Positives = 55/181 (30%), Gaps = 11/181 (6%)

Query: 29  PITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----YVMKGEFFMARPSKFYFKYSSPSSV 84
              +D  ++K  +H+  + +++  + +   G        G   + +P +  + Y  P+  
Sbjct: 28  QSPQDALLQKVDDHYNHLASLRARYREHYTGMGMDRSESGTLLLKKPGRMAWHYDVPAGK 87

Query: 85  SLISDGSNIAVYNAKLDTWSVYPLRYM-----AFSVIFSNNQHVIQESIQRVESNNSFIT 139
             + DG     Y          P + M         +  + Q   +    +V    +   
Sbjct: 88  LFVFDGKFAWFYTPGDPQAQKIPAKQMDDLHTPLRFLLGHTQLKKELDQIKVTPVGTEFR 147

Query: 140 IFFKDDFMGNMISVTFDRLSYR--LLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPY 197
           I      M   I     +++    +   ++ +     +     + KEN       F+   
Sbjct: 148 ITGIPKGMQQRIHQLGLQVTPEGLITAMQVEEIDGAKTEFTFTEMKENIPATNADFQFTP 207

Query: 198 D 198
            
Sbjct: 208 P 208


>gi|225874662|ref|YP_002756121.1| outer membrane lipoprotein carrier protein, LolA family
           [Acidobacterium capsulatum ATCC 51196]
 gi|225791682|gb|ACO31772.1| outer membrane lipoprotein carrier protein, LolA family
           [Acidobacterium capsulatum ATCC 51196]
          Length = 226

 Score = 64.1 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 15/200 (7%), Positives = 52/200 (26%), Gaps = 12/200 (6%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----YVMK 63
            ++    +   +A+    +       +   +  +H+  + +++  F+Q   G        
Sbjct: 11  RILCFAAIASLTALPLHASGTMPGVKELAARVDQHYNRLHSLEVAFVQSYTGMGLHKREA 70

Query: 64  GEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLR-----YMAFSVIFS 118
           G   + +P +  + Y+ P     + DG     Y          P +           +  
Sbjct: 71  GALLLKKPGRMRWTYTQPDGKLYVLDGKFGYFYTPGQTEAQKVPAKKLDDLQSPLRYLLG 130

Query: 119 NNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRL---SYRLLNWKIMDSSRRYS 175
           + + + +     +    + +                          +   ++  +    +
Sbjct: 131 HTELMREMPNLHIAGEENGVYTLQGVPRGMQKSIAGVTLKVTADGYIHQIRVAQTDGIVN 190

Query: 176 IIKILKYKENTVLDPKVFEI 195
            +      +N       F  
Sbjct: 191 ELDFSGETDNVPAPSSAFVF 210


>gi|241667330|ref|ZP_04754908.1| lipoprotein releasing system, subunit A [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254875882|ref|ZP_05248592.1| lipoprotein releasing system protein [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254841903|gb|EET20317.1| lipoprotein releasing system protein [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
          Length = 205

 Score = 64.1 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 27/196 (13%), Positives = 65/196 (33%), Gaps = 10/196 (5%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE-------DAGYVMKGEFFMAR 70
              +     +   +   +    I    +I +M  +F Q+             KG   + +
Sbjct: 4   IVLLVTLVFSINYSFANASDDLINKIKNIHSMSASFDQKLINGGRASDNISSKGYMSLKK 63

Query: 71  PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQR 130
           P  F +  +SP++  +IS+GS + +Y+  L+   +  +        +        ++I +
Sbjct: 64  PKFFRWITTSPNNQEIISNGSKLWIYDGDLEQVIIKKVSNNIAQFPYLILLSKNTDNINK 123

Query: 131 ---VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
              V   +    +    +             +  L    I  S  +++ I     K +  
Sbjct: 124 LFTVRELDKNTYLLKPKNDQMIDSIQIKFSDNENLEYLAISTSLNQFTKISFSDLKTDID 183

Query: 188 LDPKVFEIPYDKIHNI 203
           +D   F+    K  ++
Sbjct: 184 IDNTKFDFDIPKDTDV 199


>gi|34811363|pdb|1IWL|A Chain A, Crystal Structure Of The Lipoprotein Localization Factor,
           Lola
 gi|34811639|pdb|1UA8|A Chain A, Crystal Structure Of The Lipoprotein Localization Factor,
           Lola
          Length = 182

 Score = 64.1 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 22/176 (12%), Positives = 58/176 (32%), Gaps = 13/176 (7%)

Query: 34  QSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSPSSVSLI 87
            +          + +   +F Q+            +G+ ++ RP+ F +  + P    L+
Sbjct: 1   DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILV 60

Query: 88  SDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFK 143
           SDG  +  YN  ++  +            F +I  N     Q+   +   ++  +T    
Sbjct: 61  SDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKAS 120

Query: 144 DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           +  +              +  +  ++   + S  ++   ++N  +D   F     +
Sbjct: 121 NGNLKQFTINV--GRDGTIHQFSAVEQDDQRSSYQLKS-QQNGAVDAAKFTFTPPQ 173


>gi|269468978|gb|EEZ80554.1| membrane lipoprotein-sorting protein [uncultured SUP05 cluster
           bacterium]
          Length = 193

 Score = 63.7 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/186 (10%), Positives = 56/186 (30%), Gaps = 9/186 (4%)

Query: 19  SAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY------VMKGEFFMARPS 72
             +            Q+  +  + F S   +   F Q              G     RP 
Sbjct: 4   FFLAITLLLALTNHAQANNQFNDFFNSFDRLSANFKQTTHNEFGALINASSGTLTFNRPR 63

Query: 73  KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVE 132
           +  +    P+   L+ + + + + + +L+  ++     ++          V +    +  
Sbjct: 64  QLRWHTMHPNEQILLLNHNELWLVDVELEQATLQKTTDLS---KTPLYWLVNKPDRIKNT 120

Query: 133 SNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
              S               ++ F   +  L    + +   +  ++ + +   N  +D +V
Sbjct: 121 PVFSHTEQGTDWYKTTQENTLYFGFDNNTLSAISLKNELDQKVLVVLDQVTINPSIDTQV 180

Query: 193 FEIPYD 198
           F++  D
Sbjct: 181 FKLNLD 186


>gi|308272707|emb|CBX29311.1| hypothetical protein N47_J02920 [uncultured Desulfobacterium sp.]
          Length = 220

 Score = 63.7 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 30/213 (14%), Positives = 73/213 (34%), Gaps = 19/213 (8%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAY---PITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY 60
           +  K++I  + + F    F F+A      +  +Q + K  + + S+      F+Q     
Sbjct: 1   MKSKTIILSLAIIFCLTCFAFDAQAKEESLKANQIMMKVEKKY-SVPGFVAKFIQSSTLK 59

Query: 61  ------VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--------WSVY 106
                 V +G+ F+ RP    ++Y  P    +++DG N+ +Y  + +         +   
Sbjct: 60  AMGIADVAEGKMFVKRPGMMRWEYEKPEKQIVVTDGENLWIYRPQDNQVMVGKAPEFFGA 119

Query: 107 PLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWK 166
                  S I    ++         +       +  +     + + +   + ++ +    
Sbjct: 120 GKGASFLSDISIIRRNFSVSIKNNSDKYYVLKLLPNEKRSDLSYLYLYVSKSNFEIAKIG 179

Query: 167 IMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           I +     + I+++  K        VF     K
Sbjct: 180 IYNIYDDETEIELIDSKL-VDNPDSVFSFKIPK 211


>gi|57339510|gb|AAW49742.1| hypothetical protein FTT1636 [synthetic construct]
          Length = 240

 Score = 63.4 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 78/207 (37%), Gaps = 20/207 (9%)

Query: 3   FLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------E 56
            L  K +I   I  F   +             +  + I+   +I +M   F Q       
Sbjct: 24  MLEMKKIIICFIFVFSINVSF---------ADATSELIDKIKNIHSMTANFNQKLIDGQT 74

Query: 57  DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVI 116
           +     KG   + +P  F +  +SP++  ++S+G+ + +Y+  LD   +  +        
Sbjct: 75  NNNLNSKGNMSLKKPQYFKWITTSPNNQEIVSNGTKLWIYDGDLDQLIIKKVSNDIAQFP 134

Query: 117 FSNNQHVIQESIQRVE----SNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSR 172
           +         +I ++      +N+   +  K+D M + I + F   + +L   +I  S  
Sbjct: 135 YLILLSKNTNNINKLFTVTAQDNNSYILKPKNDQMIDSIKIKFTPNN-QLEYLEISTSLN 193

Query: 173 RYSIIKILKYKENTVLDPKVFEIPYDK 199
           +++ I+    K +  +    F+    +
Sbjct: 194 QFTKIEFNNVKTDVDISNTSFDFKAPQ 220


>gi|78224398|ref|YP_386145.1| Outer membrane lipoprotein carrier protein LolA [Geobacter
           metallireducens GS-15]
 gi|78195653|gb|ABB33420.1| Outer membrane lipoprotein carrier protein LolA [Geobacter
           metallireducens GS-15]
          Length = 242

 Score = 63.4 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/230 (8%), Positives = 63/230 (27%), Gaps = 37/230 (16%)

Query: 4   LLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED------ 57
           ++++ ++  ++            A   +  + V    + + S++ +Q +F Q        
Sbjct: 1   MIFRRLLPCLV--AALMTVAPTLAAAASVSEVVTALEKGYASLRDLQASFTQRSELASVK 58

Query: 58  AGYVMKGEFFMARP---SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS 114
                 GE F+ +       +    +     +IS+G  +  Y  +           +   
Sbjct: 59  KAQTGSGEVFIRKGSGAGAMFRFNYTKPRQEIISNGKKVWYYLPENRQVMTMDAASLFAG 118

Query: 115 -----------VIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRL----- 158
                      +   +    ++      ++  +++              +          
Sbjct: 119 GGGVALSYLTGMGEVSRDFTVRFVGDGKDARGNYVLELVPKKPGQAFQKLHLTVSGRAVE 178

Query: 159 ----------SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                      + +++  + D     + I+  K K N  +   +F     
Sbjct: 179 EYLAQGRASMPFPIVSSVVFDQMGNRTAIEFSKVKVNRGVKASLFTFTPP 228


>gi|323495034|ref|ZP_08100123.1| lipoprotein chaperone [Vibrio brasiliensis LMG 20546]
 gi|323310691|gb|EGA63866.1| lipoprotein chaperone [Vibrio brasiliensis LMG 20546]
          Length = 198

 Score = 63.4 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/187 (12%), Positives = 49/187 (26%), Gaps = 9/187 (4%)

Query: 21  IFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV---MKGEFFMARPSKF 74
           +                +  +           F Q      G V    +G   +ARPS F
Sbjct: 4   LAVLLMMSFSVMAAPKDELSQRLQMNDGFSADFSQQLISPEGDVVMEGQGNVEIARPSLF 63

Query: 75  YFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIFSNNQHVIQESIQRVE 132
            +  ++P    L+SDG ++  Y+  ++                +             +VE
Sbjct: 64  RWTTTAPDENVLVSDGKSLWYYSPFIEQVSIYWQEQATEQTPFVLLTRNRASDWDNYKVE 123

Query: 133 SNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKV 192
              +  T+                    ++  + +++   + S       K  T      
Sbjct: 124 QQGNTFTLTPTAADTNQGQFKLKIDSKGKVEGFSVVEQDGQQSNFTFNNVKL-TKPSADR 182

Query: 193 FEIPYDK 199
           F     +
Sbjct: 183 FTFAIPQ 189


>gi|329298238|ref|ZP_08255574.1| lipoprotein chaperone [Plautia stali symbiont]
          Length = 203

 Score = 63.4 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/170 (17%), Positives = 61/170 (35%), Gaps = 13/170 (7%)

Query: 40  IEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNI 93
            +    + +   +F Q+            +GE ++ RPS F +  ++P    +ISDG N+
Sbjct: 28  QQRLNKVNSFHASFSQKVTDGSGANVQDGEGELWVKRPSLFNWHMTAPDESVIISDGKNL 87

Query: 94  AVYNAKLDTWS----VYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGN 149
             YN  ++  S            F +I  N     Q+   + + +N  +T    D  +  
Sbjct: 88  WFYNPFVEQASVSLLQNATSNTPFMLIARNQPSDWQQYNIKQQGDNFELTPKSSDGNLKQ 147

Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
                    +     +  ++   + S  ++   ++N  + P  F     K
Sbjct: 148 FTINVTSAGTIN--QFSAIEQDGQRSSYQLKS-QKNGAISPDKFTFTPPK 194


>gi|148981575|ref|ZP_01816462.1| outer-membrane lipoprotein carrier protein precursor [Vibrionales
           bacterium SWAT-3]
 gi|145960818|gb|EDK26152.1| outer-membrane lipoprotein carrier protein precursor [Vibrionales
           bacterium SWAT-3]
          Length = 198

 Score = 63.4 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/198 (10%), Positives = 46/198 (23%), Gaps = 21/198 (10%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K V  ++ + F                   ++              F Q          
Sbjct: 1   MKKVFALLFMSFSVF------------ASPKEELSSRLALNAGFSADFKQVVTSPDGDVV 48

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIF 117
              +G   +ARPS F ++ + P    L+SDG ++  Y+  ++                + 
Sbjct: 49  MEGEGTVEIARPSLFRWETTFPDENLLVSDGQSLWYYSPFIEQVSIYWQEQATSQTPFVL 108

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                        V  + +  T+                     +  + +++   +    
Sbjct: 109 LTRNQESDWDNYNVAQSGNQFTLTPTAVDSNQGDFQININEKGIVQGFNVIEQDGQKGEF 168

Query: 178 KILKYKENTVLDPKVFEI 195
                          F  
Sbjct: 169 TFSNVNLGKP-AADRFTF 185


>gi|189467787|ref|ZP_03016572.1| hypothetical protein BACINT_04179 [Bacteroides intestinalis DSM
           17393]
 gi|189436051|gb|EDV05036.1| hypothetical protein BACINT_04179 [Bacteroides intestinalis DSM
           17393]
          Length = 214

 Score = 63.4 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/206 (10%), Positives = 59/206 (28%), Gaps = 15/206 (7%)

Query: 5   LYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFL-QEDAGYVMK 63
           + K+V+ + I  F  A+    +A  +     + +    F     +Q  F  Q  A  +++
Sbjct: 1   MMKNVLLICICLFGLALPL--SAQKLDAQDILDRTATAFRQAGGIQADFTVQTYAKSILQ 58

Query: 64  G-----------EFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA 112
           G           +F +       + +   +  S +++   + +     +         + 
Sbjct: 59  GSSTGVIRLKGEKFLLDADGVKTW-FDGRTQWSYLTNSDEVNISEPTPEELQSINPYALL 117

Query: 113 FSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSR 172
                  +  + +      +     I            + +   + + + L   +     
Sbjct: 118 SIYKQGYHMKLGKADTYGGKPAYEVILTASNRKQDLQCVIIYVTKDTLQPLCISMTQKGG 177

Query: 173 RYSIIKILKYKENTVLDPKVFEIPYD 198
               I+I  YK     +  +F     
Sbjct: 178 NSVAIRITSYKTGESYNDNLFTFDKK 203


>gi|118594712|ref|ZP_01552059.1| Outer membrane lipoprotein carrier protein LolA [Methylophilales
           bacterium HTCC2181]
 gi|118440490|gb|EAV47117.1| Outer membrane lipoprotein carrier protein LolA [Methylophilales
           bacterium HTCC2181]
          Length = 203

 Score = 63.4 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/196 (15%), Positives = 60/196 (30%), Gaps = 11/196 (5%)

Query: 15  LFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGYVMK------GEFFM 68
           +     I        I+              +++++G F Q+             G F  
Sbjct: 1   MIRLFFIINLCLISYISLANEEPSFSHTVAEMKSVEGNFSQQVIDQRGSVMQEVSGNFLF 60

Query: 69  ARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRY-----MAFSVIFSNNQHV 123
            +P+ F + Y  P    +ISDG  + +Y+  L    +  L+       A  ++ S+    
Sbjct: 61  KKPNLFKWNYIDPIQSQIISDGELLYLYDPDLKQVVISSLKKLGGVSPAMLLVSSSASEH 120

Query: 124 IQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
                 R     S      K+    +   V        L    I+D+    + I      
Sbjct: 121 FIVKSIRATDLISIYEAIPKNPQEASFSKVLIHFNQGLLSQMHIIDNFNHKTKIYFDSIV 180

Query: 184 ENTVLDPKVFEIPYDK 199
            N +++   F   + +
Sbjct: 181 NNRLINDAAFLFNFPE 196


>gi|86147115|ref|ZP_01065432.1| outer-membrane lipoprotein carrier protein precursor [Vibrio sp.
           MED222]
 gi|85835180|gb|EAQ53321.1| outer-membrane lipoprotein carrier protein precursor [Vibrio sp.
           MED222]
          Length = 198

 Score = 63.4 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/198 (10%), Positives = 45/198 (22%), Gaps = 21/198 (10%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------ 59
            K V  ++ + F                   ++              F Q          
Sbjct: 1   MKKVFALLFMSFSVF------------ASPKEELSSRLSLNAGFSADFKQVVTSPDGDVV 48

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIF 117
              +G   +ARPS F ++ + P    L+SDG ++  Y+  ++                + 
Sbjct: 49  MEGEGTVEIARPSLFRWETTFPDENLLVSDGQSLWYYSPFIEQVSIYWQEQATSQTPFVL 108

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                        V    +  T+                     +  + +++   +    
Sbjct: 109 LTRNQASDWDNYNVAQTGNQFTLTPTAVDSNQGDFQINITEKGIVQGFNVIEQDGQKGEF 168

Query: 178 KILKYKENTVLDPKVFEI 195
                          F  
Sbjct: 169 TFNNVDLGKP-AADRFTF 185


>gi|283851735|ref|ZP_06369013.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio sp.
           FW1012B]
 gi|283572855|gb|EFC20837.1| outer membrane lipoprotein carrier protein LolA [Desulfovibrio sp.
           FW1012B]
          Length = 208

 Score = 63.0 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/181 (16%), Positives = 58/181 (32%), Gaps = 18/181 (9%)

Query: 34  QSVKKAIEHFLSIQTMQGTFLQEDAGYV------MKGEFFMARPSKFYFKYSSPSSVSLI 87
            ++ +       ++++Q  F QE    +       KGEF   RP    ++Y  P     I
Sbjct: 28  DTLLRLAAKAGQVRSIQTEFTQEKRLSIFKQILLSKGEFAFQRPRSLRWEYLEPVRSGFI 87

Query: 88  SDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFM 147
             G +   +N        + +R      + S+   +      +  S    I +      +
Sbjct: 88  LHGDSGKRWNELAGETQDFSVRKDPIMQLVSSQILLWTTLDLKALSRTYTIAVKSDAPAV 147

Query: 148 GNMI------------SVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
                            +TF      +   +I++     + I+    + N  +DP VF  
Sbjct: 148 LLFTPRAAEVGPIAGLCITFTPDDAAIAVIEILEGQGDSTTIRFHGTRLNDDIDPGVFTR 207

Query: 196 P 196
           P
Sbjct: 208 P 208


>gi|224437272|ref|ZP_03658244.1| outer-membrane lipoprotein carrier protein [Helicobacter cinaedi
           CCUG 18818]
 gi|313143727|ref|ZP_07805920.1| outer-membrane lipoprotein carrier protein [Helicobacter cinaedi
           CCUG 18818]
 gi|313128758|gb|EFR46375.1| outer-membrane lipoprotein carrier protein [Helicobacter cinaedi
           CCUG 18818]
          Length = 178

 Score = 63.0 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/161 (13%), Positives = 52/161 (32%), Gaps = 19/161 (11%)

Query: 44  LSIQTMQGTFLQEDAGYVM-----KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNA 98
            ++Q+++  F Q            +G+ +   P+K  + Y++P    +    + + +Y  
Sbjct: 22  ENLQSIEADFEQFIVSEEGIPAHYEGKIYGKAPNKVKWDYTNPLKKEIYMKDNAVLIYEP 81

Query: 99  KLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRL 158
            L+  S                    +     +  +            +     V F   
Sbjct: 82  SLEQVSRSH--------------LKEKTDFISIIKSAKKQPDGTYHTKIEGTQYVLFVDK 127

Query: 159 SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           +      + +DS    +I+K+ K + N  +  K+FE     
Sbjct: 128 NDTPEQIEFVDSMGSKTILKLTKVRLNPKIQDKIFEFSIPN 168


>gi|312882488|ref|ZP_07742229.1| outer-membrane lipoprotein carrier protein [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309369888|gb|EFP97399.1| outer-membrane lipoprotein carrier protein [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 198

 Score = 63.0 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/202 (13%), Positives = 49/202 (24%), Gaps = 21/202 (10%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ---EDAGYV- 61
            K ++ +V L                      +              F Q      G V 
Sbjct: 1   MKKLLVLVFLSCSVF------------ATPKDELSNRLKLSDGFNANFSQKVISPDGEVV 48

Query: 62  --MKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIF 117
              KG   +ARPS F +  S+P    L+SDG  +  Y+  ++                I 
Sbjct: 49  MEGKGSVDIARPSLFRWHTSAPDENLLVSDGKTVWYYSPFIEQVSIYSQDQATQQTPFIL 108

Query: 118 SNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSII 177
                        V       T+                     +  + +++   + ++ 
Sbjct: 109 LTRNRASDWEQYHVSQKEDTFTLIPVATDTTQGQFQISIDTKGVVKGFNVIEQDGQKALF 168

Query: 178 KILKYKENTVLDPKVFEIPYDK 199
                K        +F     K
Sbjct: 169 TFDTVKLGKP-AMDLFTFQVPK 189


>gi|209695309|ref|YP_002263238.1| outer-membrane lipoprotein carrier protein [Aliivibrio salmonicida
           LFI1238]
 gi|229485823|sp|B6ENN3|LOLA_ALISL RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|208009261|emb|CAQ79527.1| outer-membrane lipoprotein carrier protein precursor [Aliivibrio
           salmonicida LFI1238]
          Length = 198

 Score = 63.0 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/187 (11%), Positives = 55/187 (29%), Gaps = 9/187 (4%)

Query: 20  AIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSK 73
            +        +       +  +     +  + +F Q+            +G+  + RP+ 
Sbjct: 4   ILLSLCFLSSVAFASPQGELTDRLNQNKGFEASFTQKVLSPEGDVLMQGEGDVKILRPNL 63

Query: 74  FYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFS--VIFSNNQHVIQESIQRV 131
           F +   +P    L++DG  +  YN  ++  ++  L         +              V
Sbjct: 64  FRWHTQTPDENLLVTDGKTLWYYNPFVEQVTLMGLDQATTQTPFVLLTRNKASDWDNYSV 123

Query: 132 ESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPK 191
             N    T+  K D       +   + S ++  + +++   + S      ++        
Sbjct: 124 AQNGDAFTVSPKSDSAIKSEFIVRIQPSGKVTGFSVVEQDGQRSDFNFTTFEA-KKPAQS 182

Query: 192 VFEIPYD 198
            F     
Sbjct: 183 NFMFTVP 189


>gi|47117227|sp|Q8D8M3|LOLA_VIBVU RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
          Length = 198

 Score = 63.0 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/186 (11%), Positives = 45/186 (24%), Gaps = 9/186 (4%)

Query: 22  FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFY 75
                          ++  +           F Q             +G   +ARPS F 
Sbjct: 5   LVVFFLSASALANPQQELNQRLGMNDGFSANFNQTVTSPEGEVVMEGEGSVDIARPSLFR 64

Query: 76  FKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIFSNNQHVIQESIQRVES 133
           +  S P    L+SDG  +  Y+  ++                +             ++  
Sbjct: 65  WSTSLPDENLLVSDGKTLWYYSPFIEQVSIYWQEQAVQQTPFVLLTRNQSSDWGNYQITQ 124

Query: 134 NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
           + +  T+  K                  +  + +++   +  I K    K         F
Sbjct: 125 DGNVFTLVPKAADSTQGQFQIDIDAKGIVHGFNVIEQDGQKGIFKFTDMKLGKP-AAARF 183

Query: 194 EIPYDK 199
                +
Sbjct: 184 TFNIPE 189


>gi|37679507|ref|NP_934116.1| outer-membrane lipoprotein carrier protein [Vibrio vulnificus
           YJ016]
 gi|320156736|ref|YP_004189115.1| outer membrane lipoprotein carrier protein LolA [Vibrio vulnificus
           MO6-24/O]
 gi|326424104|ref|NP_761753.2| outer membrane lipoprotein carrier protein LolA [Vibrio vulnificus
           CMCP6]
 gi|47117150|sp|Q7MLV4|LOLA_VIBVY RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|37198251|dbj|BAC94087.1| outer membrane lipoproteins carrier protein [Vibrio vulnificus
           YJ016]
 gi|319932048|gb|ADV86912.1| outer membrane lipoprotein carrier protein LolA [Vibrio vulnificus
           MO6-24/O]
 gi|319999485|gb|AAO11280.2| outer membrane lipoprotein carrier protein LolA [Vibrio vulnificus
           CMCP6]
          Length = 198

 Score = 62.6 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/186 (11%), Positives = 45/186 (24%), Gaps = 9/186 (4%)

Query: 22  FPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFY 75
                          ++  +           F Q             +G   +ARPS F 
Sbjct: 5   LVVFFLSASALANPQQELNQRLGMNDGFSANFNQTVTSPEGEVVMEGEGSVDIARPSLFR 64

Query: 76  FKYSSPSSVSLISDGSNIAVYNAKLDT--WSVYPLRYMAFSVIFSNNQHVIQESIQRVES 133
           +  S P    L+SDG  +  Y+  ++                +             ++  
Sbjct: 65  WSTSLPDENLLVSDGKTLWYYSPFIEQVSIYWQEQAVQQTPFVLLTRNQSSDWENYQITQ 124

Query: 134 NNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVF 193
           + +  T+  K                  +  + +++   +  I K    K         F
Sbjct: 125 DGNVFTLVPKAADSTQGQFQIDIDAKGIVHGFNVIEQDGQKGIFKFTDMKLGKP-AAARF 183

Query: 194 EIPYDK 199
                +
Sbjct: 184 TFNIPE 189


>gi|307564507|ref|ZP_07627048.1| outer membrane lipoprotein carrier protein [Prevotella amnii CRIS
           21A-A]
 gi|307346867|gb|EFN92163.1| outer membrane lipoprotein carrier protein [Prevotella amnii CRIS
           21A-A]
          Length = 206

 Score = 62.6 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/205 (14%), Positives = 75/205 (36%), Gaps = 18/205 (8%)

Query: 9   VIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVM 62
           +    +LF    +F   A+  + + Q  ++     L +++MQ  F+Q       +   V 
Sbjct: 1   MKRFFVLFIVLGMFFSIASAQLNEAQLKRQINALALKMKSMQCDFVQTKYIKMLNYNMVS 60

Query: 63  KGEFFMARPSKFYFKYSSPSSVSLISDGSNI------------AVYNAKLDTWSVYPLRY 110
           +G+ F  + +K  ++Y+SP + + + +G  +               +      +   +  
Sbjct: 61  RGKMFYQQGNKLRWEYTSPYTYAFVLNGQKVLISRGKRSDVININQSKMFKEIARVMMNS 120

Query: 111 MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDS 170
           +    +          +    E   +      +   M   I + F++ S  +   ++++ 
Sbjct: 121 VVGKCLTDTKDFKSSITDASTEYIATLYPQQKQMRQMFQKIVLRFNKHSSMVSTVELVEK 180

Query: 171 SRRYSIIKILKYKENTVLDPKVFEI 195
               ++I +   K N  +  KVF I
Sbjct: 181 KGDKTVIVLKNVKTNVPIYAKVFSI 205


>gi|284040688|ref|YP_003390618.1| outer membrane lipoprotein carrier protein LolA [Spirosoma linguale
           DSM 74]
 gi|283819981|gb|ADB41819.1| outer membrane lipoprotein carrier protein LolA [Spirosoma linguale
           DSM 74]
          Length = 213

 Score = 62.6 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 25/204 (12%), Positives = 59/204 (28%), Gaps = 11/204 (5%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAG----YV 61
            K    V++   +    P  A         +    + + S+++ Q +F    AG      
Sbjct: 1   MKK-FAVLLSLAFVMTLPAFAQKDKRAQGILDAMSKKYKSLKSYQASFTFASAGGGAKES 59

Query: 62  MKGEFFMARPSKFYFK------YSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSV 115
            KG+  +                   +  + I + + + V +    + S      +    
Sbjct: 60  YKGDLTVKNEKFRLLLGGQEVFTDGKTMSTYIKESNEVNVQDYDAGSNSELNPTQIYTIY 119

Query: 116 IFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
               +   ++E  Q   +         +       + +  D+    + NW I +   + +
Sbjct: 120 KRGFDYRFLKEQKQAGRTLEVIELTSNRPKSAIKTVQIAVDKADKSVRNWLISNKDGKQT 179

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
              I K+  N  +    F     K
Sbjct: 180 SYTITKFTPNVNVPDSFFAFDKSK 203


>gi|94265788|ref|ZP_01289522.1| Outer membrane lipoprotein carrier protein LolA [delta
           proteobacterium MLMS-1]
 gi|93453680|gb|EAT04064.1| Outer membrane lipoprotein carrier protein LolA [delta
           proteobacterium MLMS-1]
          Length = 218

 Score = 62.6 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 29/186 (15%), Positives = 65/186 (34%), Gaps = 16/186 (8%)

Query: 25  NAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYFKY 78
            A  P      +++       +++M   F Q+      D   V +G+  + RP +  +++
Sbjct: 27  AATEPGELAAFLQEVDRAAAEVRSMSCAFTQKKELAMFDRPVVFRGKLDLVRPDRLRWEF 86

Query: 79  SSPSSVSLISDGSNIAVYN-------AKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRV 131
           +SP +  LI  G +    +         L    V  L      +        + E     
Sbjct: 87  ASPVNSVLIFKGDSGLRCDGNSPPVRFDLQKDPVMRLVARQLWLWLGGEHDRLAEDYHLS 146

Query: 132 ESNNSFITIFFKDDFMGNMIS---VTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVL 188
            +  + + I  KD  M   I+   + FD  + +    +I ++    + +     + +   
Sbjct: 147 LAGEATLFIEPKDPGMAEFITSLTIVFDPETLQPRQVEIKEAEGDLTRLTFHDCQPDPDP 206

Query: 189 DPKVFE 194
           D  +F+
Sbjct: 207 DEALFD 212


>gi|253699277|ref|YP_003020466.1| outer membrane lipoprotein carrier protein LolA [Geobacter sp. M21]
 gi|251774127|gb|ACT16708.1| outer membrane lipoprotein carrier protein LolA [Geobacter sp. M21]
          Length = 236

 Score = 62.6 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 22/226 (9%), Positives = 57/226 (25%), Gaps = 35/226 (15%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED------AGYV 61
            +I V +L           ++     Q V+   + + S+  +Q  F Q            
Sbjct: 2   KLIRVSMLVMALVALSATVSFAAELSQVVRTLEQGYASLNDLQADFSQRSVIRAMRREEK 61

Query: 62  MKGEFFMAR---PSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA------ 112
             GE  + +       +          ++S+G  +  Y        V  L ++       
Sbjct: 62  GGGELLIKKGSGKDSMFRFNYKKPKQQIVSNGKTVWYYIPDQKQVMVMDLAHLFEAGNAI 121

Query: 113 -------FSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRL------- 158
                     +  + +       +    N        +       + +  D         
Sbjct: 122 AMNYLAGLGQVSRDFKISFAGQQRDKSGNYQLELTPNRKSPAMAKLMLVIDGKAVETFLA 181

Query: 159 ------SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                  + +++  ++D +   + +     K N  +    F     
Sbjct: 182 KGRPGTPFPVVSSTVVDQAGNSTRMDFSAVKTNRGISDGKFSFKVP 227


>gi|222054023|ref|YP_002536385.1| outer membrane lipoprotein carrier protein LolA [Geobacter sp.
           FRC-32]
 gi|221563312|gb|ACM19284.1| outer membrane lipoprotein carrier protein LolA [Geobacter sp.
           FRC-32]
          Length = 242

 Score = 62.2 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 26/230 (11%), Positives = 64/230 (27%), Gaps = 37/230 (16%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITK--DQSVKKAIEHFLSIQTMQGTFLQEDA----- 58
            +S   +++L     +      + +    +  VK   + + ++  +Q  F Q+       
Sbjct: 1   MRSCFSILLLSCVVLLQSALPQHGLAAEMNDVVKTLEQGYRTLNDLQADFSQQTEIASMK 60

Query: 59  -GYVMKGEFFMAR--PSKFYFKYS-SPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA-- 112
                 GE F+ +    +  F ++ S     +IS+G  +  Y  +     V  +  +   
Sbjct: 61  RKERGAGELFLKKGANGQAMFSFNYSKPRQQIISNGKKVWYYLPENRQVMVSDVASLFEG 120

Query: 113 -----------FSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRL--- 158
                         +  +         +  + N     I  K       + +        
Sbjct: 121 GNSVALNYLSGMGHVSRDFNIRFAGDGRDKKGNYLLELIPKKPSQAMAKLHLGIKAQAVA 180

Query: 159 ----------SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                      + +    + DS    ++I+    K N  +    F     
Sbjct: 181 SFTREGQAADPFPIAYSVVFDSFGNRTVIEFSNIKVNRGMRSDRFNFKVP 230


>gi|197117017|ref|YP_002137444.1| outer membrane lipoprotein carrier/sorting protein LolA [Geobacter
           bemidjiensis Bem]
 gi|197086377|gb|ACH37648.1| outer membrane lipoprotein carrier/sorting protein LolA [Geobacter
           bemidjiensis Bem]
          Length = 236

 Score = 62.2 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 25/227 (11%), Positives = 62/227 (27%), Gaps = 37/227 (16%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQED------AGYV 61
            +I V +L           ++     Q V+   + +  +  +Q  F Q            
Sbjct: 2   KLIRVSMLVMALVALSATMSFAAELSQVVRTLEQGYAGLNDLQADFSQRSLIRAMRREEK 61

Query: 62  MKGEFFMARPS----KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA----- 112
             GE  + +       F F Y+ P    ++S+G  +  Y        +  L ++      
Sbjct: 62  GGGELLIKKGGGKDSMFRFNYTKPK-QQIVSNGKTVWYYIPDQKQVMIMDLAHLFEAGNG 120

Query: 113 --------FSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRL------ 158
                      +  + +    +  +    N     I  +       + +  D        
Sbjct: 121 IAMNYLAGLGQVSRDFKISFADQQRDKNGNYQLELIPNRKSPAMAKLILVIDGKAVETFI 180

Query: 159 -------SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                   + +++  ++D +   + +     K N  +    F     
Sbjct: 181 SKGRPGTPFPVVSSTVVDQAGNSTRMDFSGIKTNRGISDSKFSFKVP 227


>gi|195927393|pdb|2ZPC|A Chain A, Crystal Structure Of The R43l Mutant Of Lola In The Closed
           Form
 gi|195927394|pdb|2ZPD|A Chain A, Crystal Structure Of The R43l Mutant Of Lola In The Open
           Form
          Length = 190

 Score = 61.8 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 21/176 (11%), Positives = 57/176 (32%), Gaps = 13/176 (7%)

Query: 34  QSVKKAIEHFLSIQTMQGTFLQEDAG------YVMKGEFFMARPSKFYFKYSSPSSVSLI 87
            +          + +   +F Q+            +G+ ++  P+ F +  + P    L+
Sbjct: 1   DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKLPNLFNWHMTQPDESILV 60

Query: 88  SDGSNIAVYNAKLDTWSVYP----LRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFK 143
           SDG  +  YN  ++  +            F +I  N     Q+   +   ++  +T    
Sbjct: 61  SDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKAS 120

Query: 144 DDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDK 199
           +  +              +  +  ++   + S  ++   ++N  +D   F     +
Sbjct: 121 NGNLKQFTINV--GRDGTIHQFSAVEQDDQRSSYQLKS-QQNGAVDAAKFTFTPPQ 173


>gi|330994810|ref|ZP_08318732.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           sp. SXCC-1]
 gi|329758071|gb|EGG74593.1| outer membrane lipoprotein carrier protein LolA [Gluconacetobacter
           sp. SXCC-1]
          Length = 207

 Score = 61.8 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 65/175 (37%), Gaps = 8/175 (4%)

Query: 28  YPITKDQSVKKAIEHFLSIQTMQGTFLQE-DAGYVMKGEFFMARPSKFYFKYSSPSSVSL 86
               +   + +   +  + + +Q  F+Q    G   +G      P +    Y++P ++ L
Sbjct: 30  QTPDQRGDIARVETYLNTSRGLQAGFVQTWPDGGKGEGVLHYD-PGRLRLDYTTPGAMKL 88

Query: 87  ISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVES---NNSFITIFFK 143
           ++   ++   + + ++ +   L +    +I     H+  + +        N+  +++   
Sbjct: 89  VAANGHLLFVDHRRESVTRMSLGHQPLGLILEQPVHLSGQIVVTAVQHGTNSLQVSLARS 148

Query: 144 DDFMGNMISVTFDR--LSYRLLNWKIMDSSRRYSIIKILK-YKENTVLDPKVFEI 195
           D     ++++ F     +  LL  ++ D  R++  + +             +F +
Sbjct: 149 DSPSQGILTLGFSDIGGTLSLLVIEMTDVERQHIRLDLTDATATGQPWPDAMFTL 203


>gi|297569091|ref|YP_003690435.1| outer membrane lipoprotein carrier protein LolA [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296925006|gb|ADH85816.1| outer membrane lipoprotein carrier protein LolA [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 215

 Score = 61.4 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 25/178 (14%), Positives = 63/178 (35%), Gaps = 16/178 (8%)

Query: 33  DQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYFKYSSPSSVSL 86
              ++K       +++M   F QE      D   V +G   + RP +  ++++SP +  L
Sbjct: 32  AAFLQKIDRSAAEMRSMSCAFTQEKELAMFDRPVVFRGRLDLVRPDRLRWEFASPINSVL 91

Query: 87  ISDGSNIAVYN-------AKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFIT 139
           I  G +    +         L    +  +      +        +        + ++ + 
Sbjct: 92  IFKGDSGMRCDGNSPPVRFDLQQDPIMRMVARQLWLWLGGEHERLAAEYHLSLAADATLL 151

Query: 140 IFFKDDFMGNMIS---VTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194
           I  KD  +   +S   + F+  +++    +I ++    + +     + +  LD  +F 
Sbjct: 152 IEPKDPAVAEFVSSLTIAFNPETHQPRQVEIKEAGGDLTRLTFHDCQPDPDLDDALFS 209


>gi|291278700|ref|YP_003495535.1| hypothetical protein DEFDS_0271 [Deferribacter desulfuricans SSM1]
 gi|290753402|dbj|BAI79779.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 200

 Score = 61.4 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 26/171 (15%), Positives = 56/171 (32%), Gaps = 6/171 (3%)

Query: 33  DQSVKKAIEHFLSIQTMQGTFLQED-----AGYVMKGEFFMARPSKFYFKYSSPSSVSLI 87
              V   I  +  I+T+Q  FLQ+            G+ ++ +  +  + Y+SP     +
Sbjct: 21  ANDVDNLINKYSKIKTIQANFLQKTLIKGFGEEYYSGKVYLIKGERLLWNYTSPYWQYYL 80

Query: 88  SDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFM 147
                +  Y++ L       + +    ++         +    V   N         + +
Sbjct: 81  FQNGVMEYYDSSLKQLMRQKINFENNVILQLIMDLGSLKKNFNVSLLNEDRLKLIPKNEI 140

Query: 148 GNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
           G    +     ++ +   K  D +  ++ I       N  +D  VFEI   
Sbjct: 141 GIKYILLDFDNTF-VKTMKSEDDAGNFTEIVFKDVLINKNIDESVFEIVVP 190


>gi|322421213|ref|YP_004200436.1| outer membrane lipoprotein carrier protein LolA [Geobacter sp. M18]
 gi|320127600|gb|ADW15160.1| outer membrane lipoprotein carrier protein LolA [Geobacter sp. M18]
          Length = 236

 Score = 61.4 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 25/226 (11%), Positives = 57/226 (25%), Gaps = 35/226 (15%)

Query: 8   SVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDA------GYV 61
            + G V +         ++A      Q V+   + + S+  +Q  F Q  +         
Sbjct: 2   KLAGTVAMCIALIALSVSSALCAELSQVVRTLEQGYASLNDLQADFSQRSSIRALKREEK 61

Query: 62  MKGEFFMARPS---KFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA------ 112
             GE F+ +       +          ++S+G  +  Y        V  L  +       
Sbjct: 62  GGGELFIKKGGGKDSMFRFDYKKPKQQIVSNGKTVWYYIPDQKQVMVMDLAQLFEAGNGI 121

Query: 113 -------FSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRL------- 158
                     +  +         +    N     I  K       + +T           
Sbjct: 122 AMNYLAGLGQVSKDFSIAFAAEQKDKSGNYQLELIPHKKSPAMAKLQLTISGDAVESFIA 181

Query: 159 ------SYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYD 198
                  + +++  ++D     + +     K N  +    F     
Sbjct: 182 KGRASTPFPVVSSTVIDQVGNATRMDFSDVKTNRGISSGKFTFKIP 227


>gi|297183296|gb|ADI19433.1| outer membrane lipoprotein-sorting protein [uncultured bacterium
           HF0500_16O16]
          Length = 217

 Score = 61.4 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 32/206 (15%), Positives = 72/206 (34%), Gaps = 19/206 (9%)

Query: 16  FFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMA 69
                         IT  + +++  E F   +T   TF ++      D     +G  F  
Sbjct: 9   VLILVAACSGPVRAITGAEVIERMEERFAKAKTYSATFEKQFFWSVLDRNMSREGRIFTR 68

Query: 70  RPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVI-----FSNNQHVI 124
           RP +F  +        +I+DG  I VYN       V P      +       +++    +
Sbjct: 69  RPRQFRVEVKDG--DLVIADGEAIWVYNKANQQVIVAPYEDELRTPWEILVEYADGYTPV 126

Query: 125 QESIQRVESNNSFITIFFKDDF-----MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179
             +   ++  ++++ I               + V   R  + LL  + ++++       +
Sbjct: 127 SVAETELDGTDAYVVILQPRPDAPPNLQVQRLRVWVGRKDWDLLQVEQLEANDDIRTYVL 186

Query: 180 LKYKENTVLDPKVFEI-PYDKIHNIN 204
            +++ N  L  ++F   P + +  I+
Sbjct: 187 REHRRNKKLGDELFVFSPPEGVEIID 212


>gi|77920249|ref|YP_358064.1| hypothetical protein Pcar_2658 [Pelobacter carbinolicus DSM 2380]
 gi|77546332|gb|ABA89894.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380]
          Length = 206

 Score = 61.4 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 31/190 (16%), Positives = 61/190 (32%), Gaps = 23/190 (12%)

Query: 27  AYPITKDQSVKKAIEHFL----SIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYF 76
           +        +   ++       S+QT+Q +F+QE             G F   RP K  +
Sbjct: 15  SAGFANATELDTVLQRLKTTAGSVQTIQSSFVQEKHLSMFSEALESHGTFSFQRPGKLRW 74

Query: 77  KYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNS 136
           +Y +P  +  + DG     +N+ +     + L       I +    V  E          
Sbjct: 75  EYETPVRMGFVIDGDKGRRWNSLVKQDQHFQLEDNLELRIAAEQLLVWTELDLDKLQRAY 134

Query: 137 FITIFFKDD-------------FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYK 183
            I I                     + + VTF   +  +    I ++    ++++    K
Sbjct: 135 DIEIAAVQPVSLLLTPRGMGARQFVDHLKVTFSASARTVTEVAIFETGGDKTLLRFSDSK 194

Query: 184 ENTVLDPKVF 193
            +  LD  +F
Sbjct: 195 IDRALDEALF 204


>gi|297568263|ref|YP_003689607.1| outer membrane lipoprotein carrier protein LolA [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924178|gb|ADH84988.1| outer membrane lipoprotein carrier protein LolA [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 234

 Score = 61.1 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 18/199 (9%), Positives = 59/199 (29%), Gaps = 21/199 (10%)

Query: 26  AAYPITKDQSVKKAIEHFLSIQTMQGTFLQED------AGYVMKGEFFMARPSKFYFKYS 79
           A      ++   +  E +  +   +  F Q             +G     +P +  ++Y+
Sbjct: 34  AEADPDPEKLAGRLQEIYDQVTGFKAEFQQRTAMPMSRRQRAGEGTVMFRKPHQMRWEYA 93

Query: 80  SPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVESNNS--- 136
           +P    L+ DG  +  Y+A+ +   +  +     S +         + ++          
Sbjct: 94  APDHQVLVGDGKEVHFYSARSNQLMISEVDTYLDSDVTYAFFAGTGDILRDFAVTAVPER 153

Query: 137 -----------FITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKEN 185
                            +       + +      + +    I+D     + ++  + + +
Sbjct: 154 ERPALPAGYHALRLEPRELHSQVEYLDLLVGGEPFFIRRLDIVDHFGSVTTLEFSRVELD 213

Query: 186 TVLDPKVFEI-PYDKIHNI 203
             L    +   P +++  +
Sbjct: 214 PELPADFYRFEPPEEVEIL 232


>gi|328675455|gb|AEB28130.1| Outer membrane lipoprotein carrier protein LolA [Francisella cf.
           novicida 3523]
          Length = 205

 Score = 60.7 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 40/204 (19%), Positives = 76/204 (37%), Gaps = 20/204 (9%)

Query: 6   YKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------EDAG 59
            K +I   ILFF   I                  IE   +I +M   F Q          
Sbjct: 1   MKKIIIYFILFFSIHISF---------ADPASDLIEKIKNIHSMTANFNQKLIDGQTSNN 51

Query: 60  YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSN 119
              KG   + +P  F +  +SP++  ++S+G+N+ +Y+  LD   +  +        +  
Sbjct: 52  LNSKGNMSLKKPQYFKWITTSPNNQVIVSNGTNLWIYDGDLDQLIIKKVSNDIAQFPYLI 111

Query: 120 NQHVIQESIQR----VESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYS 175
                  +I +     E NN+   +  K+D M + I + F   + +L   +I  S  +++
Sbjct: 112 LLSRNTNNINKLFTVTEQNNNSYILKPKNDQMIDSIKIKFTSTN-QLEYLEISTSLNQFT 170

Query: 176 IIKILKYKENTVLDPKVFEIPYDK 199
            I+    K +  +    F     +
Sbjct: 171 KIEFSDVKTDVNISDTSFNFRAPE 194


>gi|187931113|ref|YP_001891097.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|229485830|sp|B2SFG6|LOLA_FRATM RecName: Full=Outer-membrane lipoprotein carrier protein; Flags:
           Precursor
 gi|187712022|gb|ACD30319.1| lipoprotein releasing system, subunit A, outer membrane
           lipoproteins carrier [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 205

 Score = 60.7 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/192 (15%), Positives = 74/192 (38%), Gaps = 11/192 (5%)

Query: 18  YSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQ------EDAGYVMKGEFFMARP 71
               F F  +  ++   +  + I+   +I +M   F Q       +     KG   + +P
Sbjct: 4   IIICFIFVFSINVSFADATSELIDKIKNIHSMTANFNQKLIDGQTNNNLNSKGNMSLKKP 63

Query: 72  SKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRV 131
             F +  +SP+   ++ +G+ + +Y+  LD   +  +        +         +I ++
Sbjct: 64  QYFKWITTSPNHQEIVYNGTKLWIYDGDLDQLIIKKVSNDIAQFPYLILLSKNTNNINKL 123

Query: 132 E----SNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTV 187
                 +N+   +  K+D M + I + F   + +L   +I  S  +++ I+    K +  
Sbjct: 124 FTVTAQDNNSYILKPKNDQMIDSIKIKFTPNN-QLEYLEISTSLNQFTKIEFNNVKTDVD 182

Query: 188 LDPKVFEIPYDK 199
           +    F+    +
Sbjct: