RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780798|ref|YP_003065211.1| possible lolA type protein [Candidatus Liberibacter asiaticus str. psy62] (204 letters) >gnl|CDD|178807 PRK00031, lolA, lipoprotein chaperone; Reviewed. Length = 195 Score = 36.9 bits (86), Expect = 0.004 Identities = 28/142 (19%), Positives = 53/142 (37%), Gaps = 31/142 (21%) Query: 45 SIQTMQGTFLQ----EDAGYVM--KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNA 98 +++ F Q V G ++ RP+ F + Y+ P ++SDG + +Y+ Sbjct: 27 KVKSFSADFTQTVTSGSGKVVQEGSGTLWVKRPNLFRWHYTKPDEQLIVSDGKTLWIYDP 86 Query: 99 KLDTWSVYPL----RYMAFSVIFSNNQ------HVIQESIQ------RVESNNSFITIFF 142 L+ ++ L F+++ NN V Q+ ++N TI F Sbjct: 87 DLEQVTITWLKDATGNTPFALLTRNNSSDWKQYDVKQKGDTFTLTPKAKDTNFKQFTIGF 146 Query: 143 KD---------DFMGNMISVTF 155 ++ D G +TF Sbjct: 147 RNGTLASFSLVDQDGQRTLITF 168 >gnl|CDD|129638 TIGR00547, lolA, periplasmic chaperone LolA. This protein, LolA, is known so far only in the gamma and beta subdivisions of the Proteobacteria. The E. coli major outer lipoprotein (Lpp) of E. coli is released from the inner membrane as a complex with this chaperone in an energy-requiring process, and is then delivered to LolB for insertion into the outer membrane. LolA is involved in the delivery of lipoproteins generally, rather than just Lpp, and is an essential protein in E. coli, unlike Lpp itself. Length = 204 Score = 27.3 bits (60), Expect = 2.9 Identities = 10/35 (28%), Positives = 18/35 (51%) Query: 63 KGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYN 97 +G+ + RP+ F + P +ISDG + Y+ Sbjct: 58 QGDLQIKRPNLFNMEMKQPDESIIISDGKTLWFYD 92 >gnl|CDD|182110 PRK09849, PRK09849, putative oxidoreductase; Provisional. Length = 702 Score = 27.3 bits (61), Expect = 3.0 Identities = 8/21 (38%), Positives = 12/21 (57%) Query: 109 RYMAFSVIFSNNQHVIQESIQ 129 YM +I +NN HV+ + Q Sbjct: 223 DYMLTELIGANNNHVVPSTPQ 243 >gnl|CDD|179305 PRK01581, speE, spermidine synthase; Validated. Length = 374 Score = 27.2 bits (60), Expect = 3.1 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 5/41 (12%) Query: 168 MDSSRRYSIIKILK---YKEN--TVLDPKVFEIPYDKIHNI 203 M R+ S IKI + YK++ + LD FE+ + N Sbjct: 1 MPKHRKQSKIKIYRITSYKKDKRSELDSNKFELEQQLVENK 41 >gnl|CDD|129764 TIGR00681, kdpC, K+-transporting ATPase, C subunit. This chain has a single predicted transmembrane region near the amino end. It is part of a K+-transport ATPase that contains two other membrane-bound subunits, KdpA and KdpB, and a small subunit KdpF. KdpA is the K+-translocating subunit, KdpB the ATP-hydrolyzing subunit. During assembly of the complex, KdpA and KdpC bind to each other. This interaction is thought to stabilize the complex [PubMed:9858692]. Data indicates that KdpC might connect the KdpA, the K+-transporting subunit, to KdpB, the ATP-hydrolyzing (energy providing) subunit [PubMed:9858692]. Length = 187 Score = 26.8 bits (59), Expect = 4.3 Identities = 11/36 (30%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Query: 66 FFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLD 101 +F +RPS + S GSN+A N L Sbjct: 63 YFHSRPSAINYSEYPTG----ASGGSNLAPSNPDLL 94 >gnl|CDD|185664 PTZ00486, PTZ00486, apyrase Superfamily; Provisional. Length = 352 Score = 26.5 bits (59), Expect = 4.4 Identities = 13/46 (28%), Positives = 21/46 (45%) Query: 150 MISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195 +I D + R++ D R +S IK L EN ++ K E+ Sbjct: 272 IIICDEDFQNPRVIKDPQYDPERGFSSIKFLPGNENIIVALKSVEV 317 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.325 0.138 0.401 Gapped Lambda K H 0.267 0.0594 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,262,805 Number of extensions: 193855 Number of successful extensions: 522 Number of sequences better than 10.0: 1 Number of HSP's gapped: 522 Number of HSP's successfully gapped: 16 Length of query: 204 Length of database: 5,994,473 Length adjustment: 89 Effective length of query: 115 Effective length of database: 4,071,361 Effective search space: 468206515 Effective search space used: 468206515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 55 (25.3 bits)