RPSBLAST alignment of GI: 254780798 and MMDB domain: 1iwl_A_

>1iwl_A (A:) P20, outer-membrane lipoproteins carrier protein; unclosed beta barrel, protein transport; 1.65A {Escherichia coli}Length = 182
 Score = 66.9 bits (163), Expect = 2e-12
 Identities = 25/170 (14%), Positives = 62/170 (36%), Gaps = 11/170 (6%)

Query: 35  SVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYFKYSSPSSVSLIS 88
           +          + +   +F Q+       A    +G+ ++ RP+ F +  + P    L+S
Sbjct: 2   AASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVS 61

Query: 89  DGSNIAVYNAKLDTWSVYPLRY---MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD 145
           DG  +  YN  ++  +   L+        ++ + NQ    +     ++ + F+      +
Sbjct: 62  DGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASN 121

Query: 146 FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195
                 ++   R    +  +  ++   + S    LK ++N  +D   F  
Sbjct: 122 GNLKQFTINVGRDGT-IHQFSAVEQDDQRSSY-QLKSQQNGAVDAAKFTF 169