RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780798|ref|YP_003065211.1| possible lolA type protein [Candidatus Liberibacter asiaticus str. psy62] (204 letters) >1iwl_A P20, outer-membrane lipoproteins carrier protein; unclosed beta barrel, protein transport; 1.65A {Escherichia coli} (A:) Length = 182 Score = 66.9 bits (163), Expect = 2e-12 Identities = 25/170 (14%), Positives = 62/170 (36%), Gaps = 11/170 (6%) Query: 35 SVKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYFKYSSPSSVSLIS 88 + + + +F Q+ A +G+ ++ RP+ F + + P L+S Sbjct: 2 AASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVS 61 Query: 89 DGSNIAVYNAKLDTWSVYPLRY---MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDD 145 DG + YN ++ + L+ ++ + NQ + ++ + F+ + Sbjct: 62 DGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASN 121 Query: 146 FMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFEI 195 ++ R + + ++ + S LK ++N +D F Sbjct: 122 GNLKQFTINVGRDGT-IHQFSAVEQDDQRSSY-QLKSQQNGAVDAAKFTF 169 >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, protein structure initiative, nysgxrc; 2.16A {Enterococcus faecalis V583} (A:59-140) Length = 82 Score = 25.8 bits (57), Expect = 4.6 Identities = 6/27 (22%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Query: 161 RLLNWKIMDSSRRYSIIKILKYKENTV 187 + L+ ++ S I ++L Y++ T Sbjct: 57 KYLS--LLSSEEAGEIKELLHYEDETA 81 >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, LP_2219,NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} (A:1-88,A:287-347) Length = 149 Score = 25.2 bits (54), Expect = 5.9 Identities = 7/84 (8%), Positives = 18/84 (21%), Gaps = 6/84 (7%) Query: 53 FLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMA 112 + + P L + + V N D ++Y + Sbjct: 68 WQIDGQTAHKLNTVVA------PGTPPFPRDFDLDPTEAFVVVVNQNTDNATLYARDLTS 121 Query: 113 FSVIFSNNQHVIQESIQRVESNNS 136 + + E + + Sbjct: 122 GKLSLLQKDVTVPEGVCVRFLEHH 145 >2b29_A Replication protein A 70 kDa DNA-binding subunit; 1.60A {Homo sapiens} (A:) Length = 123 Score = 25.1 bits (55), Expect = 7.6 Identities = 5/24 (20%), Positives = 11/24 (45%) Query: 172 RRYSIIKILKYKENTVLDPKVFEI 195 + +I ++ NT+ D + I Sbjct: 75 SSNCVCQIHRFIVNTLKDGRRVVI 98 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.325 0.138 0.401 Gapped Lambda K H 0.267 0.0470 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,481,651 Number of extensions: 61883 Number of successful extensions: 179 Number of sequences better than 10.0: 1 Number of HSP's gapped: 179 Number of HSP's successfully gapped: 13 Length of query: 204 Length of database: 4,956,049 Length adjustment: 84 Effective length of query: 120 Effective length of database: 2,116,429 Effective search space: 253971480 Effective search space used: 253971480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.4 bits)