RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780798|ref|YP_003065211.1| possible lolA type protein [Candidatus Liberibacter asiaticus str. psy62] (204 letters) >d1iwla_ b.125.1.1 (A:) Outer-membrane lipoproteins carrier protein LolA {Escherichia coli [TaxId: 562]} Length = 182 Score = 53.4 bits (127), Expect = 1e-08 Identities = 25/168 (14%), Positives = 61/168 (36%), Gaps = 11/168 (6%) Query: 36 VKKAIEHFLSIQTMQGTFLQE------DAGYVMKGEFFMARPSKFYFKYSSPSSVSLISD 89 + + +F Q+ A +G+ ++ RP+ F + + P L+SD Sbjct: 3 ASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSD 62 Query: 90 GSNIAVYNAKLDTWSVYPLRY---MAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDF 146 G + YN ++ + L+ ++ + NQ + ++ + F+ + Sbjct: 63 GKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNG 122 Query: 147 MGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKILKYKENTVLDPKVFE 194 ++ R + + ++ + S LK ++N +D F Sbjct: 123 NLKQFTINVGR-DGTIHQFSAVEQDDQRSSY-QLKSQQNGAVDAAKFT 168 >d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 448 Score = 28.1 bits (62), Expect = 0.50 Identities = 9/48 (18%), Positives = 17/48 (35%), Gaps = 8/48 (16%) Query: 33 DQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSS 80 ++ ++ + L Q G + QE+ G F Y+S Sbjct: 383 IEAQERGVRCLLEKQLPNGDWPQENIA----GVF----NKSCAISYTS 422 >d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Length = 352 Score = 26.7 bits (58), Expect = 1.4 Identities = 8/48 (16%), Positives = 19/48 (39%), Gaps = 7/48 (14%) Query: 33 DQSVKKAIEHFLSIQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSS 80 ++ ++ +++ + Q G + + G F P FY Y+ Sbjct: 293 SEAARRGVQYLVETQRPDGGWDEPY----YTGTGF---PGDFYLGYTM 333 >d1okia2 b.11.1.1 (A:145-236) beta-Crystallin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Score = 24.3 bits (53), Expect = 7.1 Identities = 7/19 (36%), Positives = 11/19 (57%) Query: 138 ITIFFKDDFMGNMISVTFD 156 I++F +F GN I + D Sbjct: 6 ISLFEGANFKGNTIEIQGD 24 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.325 0.138 0.401 Gapped Lambda K H 0.267 0.0503 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 748,606 Number of extensions: 32706 Number of successful extensions: 108 Number of sequences better than 10.0: 1 Number of HSP's gapped: 107 Number of HSP's successfully gapped: 8 Length of query: 204 Length of database: 2,407,596 Length adjustment: 81 Effective length of query: 123 Effective length of database: 1,295,466 Effective search space: 159342318 Effective search space used: 159342318 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.0 bits)