HHsearch alignment for GI: 254780799 and conserved domain: COG1674

>COG1674 FtsK DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning].
Probab=100.00  E-value=0  Score=1254.64  Aligned_cols=471  Identities=46%  Similarity=0.643  Sum_probs=441.0

Q ss_pred             CCCCCCCCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCEEEEEEEEECCCCCHHHHHHHH
Q ss_conf             23576203661353320012455563256654578999999742486328998410442444443214786399999788
Q gi|254780799|r  302 HGTGTFVLPSKEILSTSQSPVNQMTFSPKVMQNNACTLKSVLSDFGIQGEIVNVRPGPVITLYELEPAPGIKSSRIIGLS  381 (806)
Q Consensus       302 ~~~~~YkLPsLdLL~~~~~~~~~~~~s~eeL~~nA~lLE~tL~dFGVe~~Vv~v~pGPVVTrYEi~PApGVKvSKI~nLa  381 (806)
T Consensus       376 ~~~~~~~lP~l~ll~~~~~~~~~~~~~~~~l~~~~~~l~~sl~~f~i~a~~~~~~~gp~vt~yei~l~~gvk~~~i~~L~  455 (858)
T COG1674         376 RGKDTPPLPHLFLIADEFAELKSEHPDFAELLVSIARLGRSLGIHLILATQKPDGVGPSNTRFEIALKVGVKVDSIEILG  455 (858)
T ss_pred             CCCCCCCCCCHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHEEEEEEEECCCCCCCEEEEEEECCCCHHHHHHHCC
T ss_conf             56887889822120554322345774778899999999887886443578960567885126998645662166776047


Q ss_pred             HHHHHHHHHCCCCC-CCCCCCCEEEEEECCCC-CCEEEEHHHCCCHHHHHCCCCCHHHCCCCCCCCEEEEECCCCCEEEE
Q ss_conf             99998863001210-00388612555302456-62387342307213430221000210456666667854100202355
Q gi|254780799|r  382 DDIARSMSAISARV-AVIPRRNAIGIELPNDI-RETVMLRDLIVSRVFEKNQCDLAINLGKSIEGKPIIADLARMPHLLI  459 (806)
Q Consensus       382 dDIA~aLsa~svRI-apIPGK~~VGIEiPN~~-r~~V~lreil~s~~f~~s~~~L~iaLGKdI~G~pvv~DLakMPHLLI  459 (806)
T Consensus       456 ~d~A~~L~~~~~ri~~~ipgk~~igie~pn~~~~~~~~L~e~~~~~~~~~~~~~l~i~lg~~~~~~~~~~dlak~~hlli  535 (858)
T COG1674         456 NDDAAALVAKSRRYLAPIPGKSYIGFQSPNSGRPWLPPLRELLDLDEFLERFPLGVIDLPKDIRQEPIVIDLAKAGHLLI  535 (858)
T ss_pred             CHHHHHCCCCCEEEEEEECCCCEEEEECCCCCCCCCCCHHHCCCCHHHHCCCCCEEECCCHHCCCCCEEEECCCCCCEEE
T ss_conf             37788501446058987479753789746889867787121035234532465147525100368813855356888788


Q ss_pred             EECCCCHHHHHHHHHHHHHHHHCCHHHEEEEEECCCHHHHHHCCCCHHHHCCCCCCHH-HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             3047740679999999999982995784788852310011102770343122334304-566899999999999999998
Q gi|254780799|r  460 AGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLTPVVTNPQ-KAVTVLKWLVCEMEERYQKMS  538 (806)
Q Consensus       460 AGtTGSGKSV~iN~iI~SlLyk~~P~evkliliDPK~vEls~Y~~iPHLl~pVvTd~~-kA~~aL~w~V~EMe~RY~l~a  538 (806)
T Consensus       536 ~G~tgsGKSv~lnt~i~Sll~~~~P~ev~~~~iD~k~~~L~~~~~iPHl~~~v~td~~~k~~~al~~~~~eme~R~~l~~  615 (858)
T COG1674         536 AGATGSGKSVALNTMILSLLYTHSPEEVRFYIIDPKMLELAAYDGLPHLGDPVVTDEKEKAEKALAELVAEMERRYKLFS  615 (858)
T ss_pred             ECCCCCCHHHHHHHHHHHHHHCCCCHHEEEEEECCCCCCCHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             24888651558999999987518906849999747875433330698557723247477899999999999999999888


Q ss_pred             HCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCCCHHHHHHHHHH
Q ss_conf             70899689999999988744786677544677654543222332232346986877634468888732100588999999
Q gi|254780799|r  539 KIGVRNIDGFNLKVAQYHNTGKKFNRTVQTGFDRKTGEAIYETEHFDFQHMPYIVVVIDEMADLMMVARKDIESAVQRLA  618 (806)
Q Consensus       539 ~~~vRni~~yN~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lp~ivviiDElaDlmm~~~~~ve~~i~rla  618 (806)
T Consensus       616 ~~~vr~i~~yn~k~~~~----------------------------~~~~~lP~iviiiDe~adlm~~~~k~ve~~i~rLa  667 (858)
T COG1674         616 EKGVRNIEGYNEKIAGA----------------------------IPDEELPYIVIIIDEYADLMMVAGKELEELIARLA  667 (858)
T ss_pred             HHCCCCHHHHHHHHCCC----------------------------CCCCCCCCEEEEECCHHHHHCCCCHHHHHHHHHHH
T ss_conf             85666277776542024----------------------------55567980899944478886123176999999999


Q ss_pred             HHHHHCCEEEEEEECCCCCCCCCHHHHHCCCCEEEEEECCCCCCHHHCCCCCHHHHCCCCCEEEECCC-CCEEEEEECCC
Q ss_conf             86641423799996577753554355411025158764586642123388645786588754773689-83258883348
Q gi|254780799|r  619 QMARASGIHVIMATQRPSVDVITGTIKANFPTRISFQVSSKIDSRTILGEQGAEQLLGQGDMLYMTGG-GRVQRIHGPFV  697 (806)
Q Consensus       619 q~ara~GiHli~aTqrPsvdvitg~ikan~p~riaf~v~s~~dSrtild~~gae~Llg~gdml~~~~~-~~~~r~~g~~v  697 (806)
T Consensus       668 ~~ara~GIHlilatqRps~dVit~-ikan~psrIaf~v~s~~dsr~il~~~gae~l~GrGd~l~~~~~~~~pvr~~~~fv  746 (858)
T COG1674         668 QKGRAAGIHLILATQRPSVDVITG-IKANIPTRIALRLSSKIDSRLILGQDGAEKLLGRGDMLFLGPGDAKPVRVLPAFV  746 (858)
T ss_pred             HHHHHCCCEEEEECCCCCCCHHHH-HHHCCCCCEEEEECCCCCEEEEECCCHHHHCCCCCEEECCCCCCCCCCCCCCCEE
T ss_conf             978765826999748999504088-8853875256651687652566245506308885424215788988602665400


Q ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCCC---CC-CCCC--CCCCCCCCHHHHHHHHHHHHCCCEEEEHHHHHHCCCHHH
Q ss_conf             98899999999971289742110012455---66-6778--888877770389999999965985000142220011778
Q gi|254780799|r  698 SDIEVEKVVSHLKTQGEAKYIDIKDKILL---NE-EMRF--SENSSVADDLYKQAVDIVLRDNKASISYIQRRLGIGYNR  771 (806)
Q Consensus       698 ~~~ev~~v~~~~~~q~~~~y~~~~~~~~~---~~-~~~~--~~~~~~~d~l~~~a~~~v~~~~~~s~s~lqr~~~igy~r  771 (806)
T Consensus       747 sd~ev~~v~~~~k~~~~p~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~l~~~a~~~v~~~~~~S~s~lqr~~~iG~~r  826 (858)
T COG1674         747 SDEEVEEVVEHLKSQVEPVYLDLATNPHLLISGETTVLRAIDREEEAMDELFDEAKELVLPPPKASTSLLQRALDLGLNR  826 (858)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHCCCCCCEEE
T ss_conf             48888886300231377324423567542013531002221011011038999999862472113789872062678177


Q ss_pred             HHHHHHHHHHCCCCCHHHCCCCCEEEECHH
Q ss_conf             999999999779868022788726731712
Q gi|254780799|r  772 AASIIENMEEKGVIGPASSTGKREILISSM  801 (806)
Q Consensus       772 aar~~~~~e~~giv~~~~g~~~r~vl~~~~  801 (806)
T Consensus       827 aa~~~~~~e~~giv~~~~~~~~reil~~~~  856 (858)
T COG1674         827 AATLIESMELLGIVGPPNGPKGREILVVED  856 (858)
T ss_pred             EECCCCCCHHHCEECCCCCCCCCEEEECCC
T ss_conf             604222121313434645799852762677