RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780799|ref|YP_003065212.1| DNA translocase FtsK [Candidatus Liberibacter asiaticus str. psy62] (806 letters) >gnl|CDD|31860 COG1674, FtsK, DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning]. Length = 858 Score = 459 bits (1182), Expect = e-129 Identities = 217/531 (40%), Positives = 298/531 (56%), Gaps = 39/531 (7%) Query: 280 SITEYQLNADIVQNISQSNLINHGTGTFVLPSKEILSTSQSPVNQMTFSPKVMQNNACTL 339 +I + + G T LP +++ + + + + L Sbjct: 354 AIKGELARRQRNHINAYTKSYKRGKDTPPLPHLFLIADEFAELKSEHPDFAELLVSIARL 413 Query: 340 KSVLSDFGIQGEIVNVRPGPVITLYELEPAPGIKSSRIIGLSDDIARSMSAISAR-VAVI 398 L I GP T +E+ G+K I L +D A ++ A S R +A I Sbjct: 414 GRSLGIHLILATQKPDGVGPSNTRFEIALKVGVKVDSIEILGNDDAAALVAKSRRYLAPI 473 Query: 399 PRRNAIGIELPN-DIRETVMLRDLIVSRVFEKNQCDLAINLGKSIEGKPIIADLARMPHL 457 P ++ IG + PN LR+L+ F + I+L K I +PI+ DLA+ HL Sbjct: 474 PGKSYIGFQSPNSGRPWLPPLRELLDLDEFLERFPLGVIDLPKDIRQEPIVIDLAKAGHL 533 Query: 458 LIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLTPVVTNPQ 517 LIAG TGSGKSVA+NTMILSLLY +P + R +IDPKMLEL+ YDG+P+L PVVT+ + Sbjct: 534 LIAGATGSGKSVALNTMILSLLYTHSPEEVRFYIIDPKMLELAAYDGLPHLGDPVVTDEK 593 Query: 518 -KAVTVLKWLVCEMEERYQKMSKIGVRNIDGFNLKVAQYHNTGKKFNRTVQTGFDRKTGE 576 KA L LV EME RY+ S+ GVRNI+G+N K+A + Sbjct: 594 EKAEKALAELVAEMERRYKLFSEKGVRNIEGYNEKIAGAIPDEE---------------- 637 Query: 577 AIYETEHFDFQHMPYIVVVIDEMADLMMVARKDIESAVQRLAQMARASGIHVIMATQRPS 636 +PYIV++IDE ADLMMVA K++E + RLAQ RA+GIH+I+ATQRPS Sbjct: 638 ------------LPYIVIIIDEYADLMMVAGKELEELIARLAQKGRAAGIHLILATQRPS 685 Query: 637 VDVITGTIKANFPTRISFQVSSKIDSRTILGEQGAEQLLGQGDMLYMTGG-GRVQRIHGP 695 VDVITG IKAN PTRI+ ++SSKIDSR ILG+ GAE+LLG+GDML++ G + R+ Sbjct: 686 VDVITG-IKANIPTRIALRLSSKIDSRLILGQDGAEKLLGRGDMLFLGPGDAKPVRVLPA 744 Query: 696 FVSDIEVEKVVSHLKTQGEAKYID--IKDKILLNEEMRF----SENSSVADDLYKQAVDI 749 FVSD EVE+VV HLK+Q E Y+D +L++ E D+L+ +A ++ Sbjct: 745 FVSDEEVEEVVEHLKSQVEPVYLDLATNPHLLISGETTVLRAIDREEEAMDELFDEAKEL 804 Query: 750 VLRDNKASISYIQRRLGIGYNRAASIIENMEEKGVIGPASSTGKREILISS 800 VL KAS S +QR L +G NRAA++IE+ME G++GP + REIL+ Sbjct: 805 VLPPPKASTSLLQRALDLGLNRAATLIESMELLGIVGPPNGPKGREILVVE 855 >gnl|CDD|144975 pfam01580, FtsK_SpoIIIE, FtsK/SpoIIIE family. FtsK has extensive sequence similarity to wide variety of proteins from prokaryotes and plasmids, termed the FtsK/SpoIIIE family. This domain contains a putative ATP binding P-loop motif. It is found in the FtsK cell division protein from E. coli and the stage III sporulation protein E SpoIIIE which has roles in regulation of prespore specific gene expression in B. subtilis. A mutation in FtsK causes a temperature sensitive block in cell division and it is involved in peptidoglycan synthesis or modification. The SpoIIIE protein is implicated in intercellular chromosomal DNA transfer. Length = 202 Score = 208 bits (531), Expect = 6e-54 Identities = 94/225 (41%), Positives = 138/225 (61%), Gaps = 27/225 (12%) Query: 417 MLRDLIVSRVFEKNQCDLAINLGKSIEGKPIIADLARMPHLLIAGTTGSGKSVAINTMIL 476 L++L+ + F ++ L I LGK I G P++ADL +MPHLLIAG TGSGKS +NT+IL Sbjct: 1 ELKELLDGKPFRGSRSRLTIALGKDISGNPVVADLVKMPHLLIAGATGSGKSTFLNTLIL 60 Query: 477 SLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLTPVVTNPQKAVTVLKWLVCEMEERYQK 536 SL R +P + RL +IDPK EL+ + +P+LL+ V T+P+ A++ L+ LV EME RY Sbjct: 61 SLAARHSPEEVRLYLIDPKGGELAALEDLPHLLSAVATDPEDALSALRALVAEMERRYAL 120 Query: 537 MSKIGVRNIDGFNLKVAQYHNTGKKFNRTVQTGFDRKTGEAIYETEHFDFQHMPYIVVVI 596 + ++GVR+I+ +N ++A+ P IVV++ Sbjct: 121 LKQLGVRSIEEYNGEIAEDIL-------------GGAGWLEEL----------PPIVVIV 157 Query: 597 DEMADLMMVARKD----IESAVQRLAQMARASGIHVIMATQRPSV 637 DE A+LM+ A KD +E A+ RLA+M RA+GIH+++ATQRP V Sbjct: 158 DERAELMLAAPKDSEMRVEGALARLARMGRAAGIHLLLATQRPGV 202 >gnl|CDD|29993 cd01127, TrwB, Bacterial conjugation protein TrwB, ATP binding domain. TrwB is a homohexamer encoded by conjugative plasmids in Gram-negative bacteria. TrwB also has an all alpha domain which has been hypothesized to be responsible for DNA binding. TrwB is a component of Type IV secretion and is responsible for the horizontal transfer of DNA between bacteria.. Length = 410 Score = 38.7 bits (90), Expect = 0.006 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 5/54 (9%) Query: 441 SIEGKPIIADLARMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDP 494 +I G P D A H +I GTTG+GK+ I ++ S+ R R I+ DP Sbjct: 30 TIAGLPFPKD-AEEAHTMIIGTTGTGKTTQIRELLASIRAR----GDRAIIYDP 78 >gnl|CDD|29995 cd01129, PulE-GspE, PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP). It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which contains an ATP binding site and a tetracysteine motif. This subgroup also includes PillB and HofB.. Length = 264 Score = 37.5 bits (87), Expect = 0.014 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Query: 422 IVSRVFEKNQCDLAIN-LGKSIEGKPIIADLARMPH--LLIAGTTGSGKSVAINTMILSL 478 +V R+ +K L + LG E I L PH +L+ G TGSGK+ + + + L Sbjct: 45 VVLRILDKKNQILDLEKLGLKPENLEIFRKLLEKPHGIILVTGPTGSGKTTTLYSALSEL 104 >gnl|CDD|32635 COG2804, PulE, Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 500 Score = 36.1 bits (83), Expect = 0.042 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Query: 422 IVSRVFEKNQCDLAIN-LGKSIEGKPIIADLARMPH--LLIAGTTGSGKSVAINTMILSL 478 +V R+ +K+Q L + LG S + L P +L+ G TGSGK+ + + L Sbjct: 223 VVLRILDKDQVILDLEKLGMSPFQLARLLRLLNRPQGLILVTGPTGSGKTTTLYAALSEL 282 >gnl|CDD|33254 COG3451, VirB4, Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion]. Length = 796 Score = 34.6 bits (79), Expect = 0.12 Identities = 17/71 (23%), Positives = 32/71 (45%), Gaps = 6/71 (8%) Query: 427 FEKNQCDLAINLGKSIEGKPIIADLAR---MPHLLIAGTTGSGKSVAINTMILSLLYRMT 483 F N + + K+ +G P + + H LI G TG+GK+V ++ ++ L Sbjct: 406 FRGNPWGEPLTVLKTEDGSPFYFNFHVGEDVGHTLIIGPTGAGKTVLLSFLLAQALKYGN 465 Query: 484 PAQCRLIMIDP 494 P +++ D Sbjct: 466 P---QIVAFDK 473 >gnl|CDD|145224 pfam01935, DUF87, Domain of unknown function DUF87. The function of this prokaryotic domain is unknown. It contains several conserved aspartates and histidines that could be metal ligands. Length = 218 Score = 34.2 bits (79), Expect = 0.14 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 11/65 (16%) Query: 436 INLGKSIEGK--PIIADLARM--PHLLIAGTTGSGKSVAINTM--ILSLLYRMTPAQCRL 489 I +G+ ++G P+ DL ++ H I G+TGSGKS NT+ +L L + Sbjct: 1 IEIGRLLDGSEVPVYLDLNKLVSRHFAILGSTGSGKS---NTVAVLLEELLEK--KGATV 55 Query: 490 IMIDP 494 ++ DP Sbjct: 56 LIFDP 60 >gnl|CDD|107296 cd06301, PBP1_rhizopine_binding_like, Periplasmic binding proteins specific to rhizopines. Periplasmic binding proteins specific to rhizopines, which are simple sugar-like compounds produced in the nodules induced by the symbiotic root nodule bacteria, such as Rhizobium and Sinorhizobium. Rhizopine-binding-like proteins from other bacteria are also included. Two inositol based rhizopine compounds are known to date: L-3-O-methly-scyllo-inosamine (3-O-MSI) and scyllo-inosamine. Bacterial strains that can metabolize rhizopine have a greater competitive advantage in nodulation and rhizopine synthesis is regulated by NifA/NtrA regulatory transcription activators which are maximally expressed at the onset of nitrogen fixation in bacteroids. The members of this group belong to the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily. Length = 272 Score = 33.0 bits (76), Expect = 0.37 Identities = 27/114 (23%), Positives = 51/114 (44%), Gaps = 29/114 (25%) Query: 612 SAVQRLAQMARASGIHVIMATQRPSVDVITGTIKANFPTRISFQVSSKIDSRTILGEQGA 671 +A + + A A+GI ++ +RP N P +++ S ++ + + E A Sbjct: 68 AATAPIVKAANAAGIPLVYVNRRPE----------NAPKGVAYVGSDEVVAGRLQAEYVA 117 Query: 672 EQLLGQGDMLYMTG----GGRVQRIHGPFVSDIEVEKVVSHLKTQGEAKYIDIK 721 ++L G+G++ + G ++ R G VE+V+ AKY DIK Sbjct: 118 DKLGGKGNVAILMGPLGQSAQIDRTKG-------VEEVL--------AKYPDIK 156 >gnl|CDD|177025 CHL00093, groEL, chaperonin GroEL. Length = 529 Score = 32.8 bits (75), Expect = 0.38 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 6/44 (13%) Query: 767 IGYNRAASIIENMEEKGVIGPAS---STGKREILISSM---EEC 804 IGYN A + NM E G+I PA S + I+SM EC Sbjct: 477 IGYNAANNKFVNMYEAGIIDPAKVTRSALQNAASIASMILTTEC 520 >gnl|CDD|31711 COG1522, Lrp, Transcriptional regulators [Transcription]. Length = 154 Score = 32.7 bits (74), Expect = 0.42 Identities = 12/46 (26%), Positives = 27/46 (58%) Query: 740 DDLYKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIENMEEKGVI 785 DD+ ++ + ++ D + S + + R+G+ + I+ +EE+GVI Sbjct: 7 DDIDRRILRLLQEDARISNAELAERVGLSPSTVLRRIKRLEEEGVI 52 >gnl|CDD|31077 COG0733, COG0733, Na+-dependent transporters of the SNF family [General function prediction only]. Length = 439 Score = 32.0 bits (73), Expect = 0.71 Identities = 42/165 (25%), Positives = 66/165 (40%), Gaps = 22/165 (13%) Query: 21 WSKKKMKIVAGLILLCTVFAITLALGTWDVYD----PSFSYITLRSPKNFLGYGGAIFAD 76 +K M ++ L ++ + A+TL G + P FS +T PK +L G F Sbjct: 170 ANKIMMPLLFVLFIILVIRAVTLP-GAMEGLKFLFKPDFSKLT--DPKVWLAALGQAFFS 226 Query: 77 VAIQFFGIASVFFLPPPTMWALSLLFDKKIYCFSKRATAWLINILVSATF-FASFSPSQS 135 +++ F M S KK S + L+N L+S F S Sbjct: 227 LSLGFG-----------IMITYSSYLSKKSDLVSSALSIVLLNTLISLLAGLVIFPALFS 275 Query: 136 WPIQNGFGGIIGDLIIRLPFLFFE-SYPRKLGILFFQMILFLAMS 179 + G G + I LP +F + GILFF ++LF A++ Sbjct: 276 FGADASQG--PGLVFIVLPAVFNQMPLGTLFGILFFLLLLFAALT 318 >gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.. Length = 151 Score = 31.7 bits (72), Expect = 0.81 Identities = 16/82 (19%), Positives = 29/82 (35%), Gaps = 1/82 (1%) Query: 575 GEAIYETEHFDFQHMPYIVVVIDEMADLMMVARKDIESAVQRLAQM-ARASGIHVIMATQ 633 G + + V+ IDE+ L A+ + ++ L + + VI AT Sbjct: 69 GHFLVRLLFELAEKAKPGVLFIDEIDSLSRGAQNALLRVLETLNDLRIDRENVRVIGATN 128 Query: 634 RPSVDVITGTIKANFPTRISFQ 655 RP + + + RI Sbjct: 129 RPLLGDLDRALYDRLDIRIVIP 150 >gnl|CDD|30819 COG0471, CitT, Di- and tricarboxylate transporters [Inorganic ion transport and metabolism]. Length = 461 Score = 31.4 bits (71), Expect = 0.99 Identities = 22/141 (15%), Positives = 43/141 (30%), Gaps = 24/141 (17%) Query: 72 AIFADVAIQFFGIASVFFLPPPTMWALSLLFDKKIYCFSKR----ATAWLINILVSATFF 127 A+ +A+ G F W ++L I + A A L+ +L+ + F Sbjct: 10 ALLVLLALVLLGPVP--FGLSGFAWLFAILVAAIILWILEAIPLFALAILVIVLLVLSGF 67 Query: 128 ASFSPSQSWPIQNGFGGIIG------------------DLIIRLPFLFFESYPRKLGILF 169 + + I + FF + PR L + Sbjct: 68 ILAISASKLALSGFANSTIWLIFGLFLLSKGLEKTGLGKRLALHLLRFFGTTPRGLALGL 127 Query: 170 FQMILFLAMSWLLIYSSSAIF 190 + LFL+ ++ ++ I Sbjct: 128 VLLTLFLSPAFPSNTATGGIM 148 >gnl|CDD|30817 COG0469, PykF, Pyruvate kinase [Carbohydrate transport and metabolism]. Length = 477 Score = 30.9 bits (70), Expect = 1.3 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 14/65 (21%) Query: 596 IDEMADLMMVARKD---------IESAVQRLAQMARASGIHVIMATQRPSVDVITGTIKA 646 I E +D +MVAR D + +R+ + AR +G VI ATQ ++ I+ Sbjct: 236 IIEASDGIMVARGDLGVEIPLEEVPIIQKRIIRKARRAGKPVITATQ-----MLESMIEN 290 Query: 647 NFPTR 651 PTR Sbjct: 291 PRPTR 295 >gnl|CDD|30033 cd00530, PTE, Phosphotriesterase (PTE) catalyzes the hydrolysis of organophosphate nerve agents, including the chemical warfare agents VX, soman, and sarin as well as the insecticide paraoxon. PTE exists as a homodimer with one active site per monomer. The active site is located next to a binuclear metal center, at the C-terminal end of a TIM alpha- beta barrel motif. The native enzyme contains two zinc ions at the active site however these can be replaced with other metals such as cobalt, cadmium, nickel or manganese and the enzyme remains active.. Length = 293 Score = 30.6 bits (69), Expect = 1.7 Identities = 9/19 (47%), Positives = 18/19 (94%) Query: 614 VQRLAQMARASGIHVIMAT 632 V++LA++ARA+G++++ AT Sbjct: 61 VEKLAEVARATGVNIVAAT 79 >gnl|CDD|35569 KOG0348, KOG0348, KOG0348, ATP-dependent RNA helicase [RNA processing and modification]. Length = 708 Score = 30.4 bits (68), Expect = 1.8 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 6/60 (10%) Query: 458 LIAGTTGSGKSVAINTMILSLLYRMTPAQCR------LIMIDPKMLELSVYDGIPNLLTP 511 L+ TGSGK++A I+ L M P R L+++ + L L +Y+ + LL P Sbjct: 178 LVRAQTGSGKTLAYLLPIVQSLQAMEPKIQRSDGPYALVIVPTRELALQIYETVQKLLKP 237 >gnl|CDD|34510 COG4901, COG4901, Ribosomal protein S25 [Translation, ribosomal structure and biogenesis]. Length = 107 Score = 30.4 bits (68), Expect = 2.1 Identities = 14/61 (22%), Positives = 29/61 (47%) Query: 738 VADDLYKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIENMEEKGVIGPASSTGKREIL 797 V ++L + V R+ + + R GI + A ++ ++EE+GV+ S ++ I Sbjct: 42 VDEELLDKIRKEVPRERVVTPYVLASRYGINGSVARIVLRHLEEEGVVQLVSKNRRQAIY 101 Query: 798 I 798 Sbjct: 102 T 102 >gnl|CDD|30975 COG0630, VirB11, Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 312 Score = 30.0 bits (67), Expect = 2.4 Identities = 30/161 (18%), Positives = 55/161 (34%), Gaps = 30/161 (18%) Query: 351 EIVNVRPGPVITLYELEPAPGIKSSRIIGLSDDIARSMSAISARVA--VIPRRNAIGIEL 408 +IV PGPV ++ + ++ +++ ++ R + + L Sbjct: 29 DIVVNGPGPVYVEHKGGGS--YVTNIPFLTEEELDSLAIRLAQRSGKPISEANPILDATL 86 Query: 409 PNDIRETVMLRDLIVSRVFEKNQCDLAI--------NLGKSIEGKPI----IADLARM-- 454 P+ R ++L + N I IE I A L Sbjct: 87 PDGSRIQIVLGPEV-----SPNGSSFTIRKFSDEPITPEDLIEYGTISPEQAAYLWLAIE 141 Query: 455 --PHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMID 493 ++I G T SGK T +L+ L P + R++ I+ Sbjct: 142 ARKSIIICGGTASGK-----TTLLNALLDFIPPEERIVTIE 177 >gnl|CDD|32636 COG2805, PilT, Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 353 Score = 29.8 bits (67), Expect = 2.8 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Query: 446 PIIADLARMPH--LLIAGTTGSGKSVAINTMI 475 PI+ +LA P +L+ G TGSGKS + MI Sbjct: 115 PIVRELAESPRGLILVTGPTGSGKSTTLAAMI 146 >gnl|CDD|30782 COG0433, COG0433, Predicted ATPase [General function prediction only]. Length = 520 Score = 29.9 bits (66), Expect = 2.8 Identities = 35/181 (19%), Positives = 59/181 (32%), Gaps = 21/181 (11%) Query: 342 VLSDFGIQGEIVNVRPGPVITLYELEPAPGIKSSRIIGLSDDIARSMSAISARVAVIPRR 401 V+ D + VR G + + I + L I S+ + I +R Sbjct: 42 VIEDDEGDLVLGAVRGGVNLRDILADRITSIDLEALADLEAFIISSVLDLEGSYVGIAKR 101 Query: 402 NAIGIELPNDIRETVMLRDLIVSRVFEKNQCDLAINLG-------------KSIEGKPII 448 +G P + +R S V+ + L LG P+ Sbjct: 102 RVLGELEPELLPPRSPVR--PGSPVYRASDEVLEKILGFDVDGRGLLLGALLDGGEVPVY 159 Query: 449 ADLARMP---HLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGI 505 DL ++ H+ I G+TGSGKS N + L + +++ DP + Sbjct: 160 LDLNKLVLARHIAILGSTGSGKS---NLAKVLLEELLGKDGATVVIFDPHGEYDLLRLDR 216 Query: 506 P 506 Sbjct: 217 A 217 Score = 29.2 bits (64), Expect = 5.0 Identities = 19/80 (23%), Positives = 42/80 (52%), Gaps = 3/80 (3%) Query: 590 PYIVVVIDEMADLMMVARKD-IESAVQRLAQMARASGIHVIMATQRPSVDVITGTIKANF 648 +++VI+E + +RK ++ ++R+A+ R G+ +++ATQRPS + + + Sbjct: 391 GPLLIVIEEAHNFAPSSRKAPVKDIIERIAREGRKFGVGLVLATQRPS--DLDDLVLSQA 448 Query: 649 PTRISFQVSSKIDSRTILGE 668 T+I ++ D + I Sbjct: 449 NTKIILRLVEPTDQKYISRA 468 >gnl|CDD|73003 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.. Length = 221 Score = 29.7 bits (67), Expect = 3.0 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 5/35 (14%) Query: 459 IAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMID 493 I G TGSGKS +++L+L R+ I+ID Sbjct: 35 IVGRTGSGKS----SLLLALF-RLVELSSGSILID 64 >gnl|CDD|144365 pfam00735, Septin, Septin. Members of this family include CDC3, CDC10, CDC11 and CDC12/Septin. Members of this family bind GTP. As regards the septins, these are polypeptides of 30-65kDa with three characteristic GTPase motifs (G-1, G-3 and G-4) that are similar to those of the Ras family. The G-4 motif is strictly conserved with a unique septin consensus of AKAD. Most septins are thought to have at least one coiled-coil region, which in some cases is necessary for intermolecular interactions that allow septins to polymerize to form rod-shaped complexes. In turn, these are arranged into tandem arrays to form filaments. They are multifunctional proteins, with roles in cytokinesis, sporulation, germ cell development, exocytosis and apoptosis. Length = 280 Score = 29.6 bits (67), Expect = 3.5 Identities = 11/25 (44%), Positives = 17/25 (68%) Query: 457 LLIAGTTGSGKSVAINTMILSLLYR 481 L++ G +G GK+ INT+ L+ LY Sbjct: 7 LMVVGESGLGKTTLINTLFLTDLYP 31 >gnl|CDD|133259 cd01850, CDC_Septin, CDC/Septin. Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells. They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis. In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments. Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities. Length = 276 Score = 29.4 bits (67), Expect = 3.5 Identities = 9/25 (36%), Positives = 15/25 (60%) Query: 457 LLIAGTTGSGKSVAINTMILSLLYR 481 +++ G +G GKS INT+ + L Sbjct: 7 IMVVGESGLGKSTFINTLFNTKLIP 31 >gnl|CDD|36209 KOG0991, KOG0991, KOG0991, Replication factor C, subunit RFC2 [Replication, recombination and repair]. Length = 333 Score = 29.5 bits (66), Expect = 3.8 Identities = 13/33 (39%), Positives = 21/33 (63%) Query: 447 IIADLARMPHLLIAGTTGSGKSVAINTMILSLL 479 +IA MP+L+I+G G+GK+ +I + LL Sbjct: 41 VIAKEGNMPNLIISGPPGTGKTTSILCLARELL 73 >gnl|CDD|31342 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]. Length = 622 Score = 29.2 bits (65), Expect = 4.5 Identities = 10/42 (23%), Positives = 21/42 (50%) Query: 762 QRRLGIGYNRAASIIENMEEKGVIGPASSTGKREILISSMEE 803 R+ GY + ++I N+E + ++ P TG + + S + Sbjct: 316 TRKEEYGYGKYPNVITNLELERMLNPNGPTGGKVLRPSDGKP 357 >gnl|CDD|72986 cd03227, ABC_Class2, ABC-type Class 2 contains systems involved in cellular processes other than transport. These families are characterised by the fact that the ABC subunit is made up of duplicated, fused ABC modules (ABC2). No known transmembrane proteins or domains are associated with these proteins.. Length = 162 Score = 29.2 bits (65), Expect = 4.7 Identities = 10/39 (25%), Positives = 16/39 (41%) Query: 446 PIIADLARMPHLLIAGTTGSGKSVAINTMILSLLYRMTP 484 P +I G GSGKS ++ + L+L + Sbjct: 13 PNDVTFGEGSLTIITGPNGSGKSTILDAIGLALGGAQSA 51 >gnl|CDD|36138 KOG0920, KOG0920, KOG0920, ATP-dependent RNA helicase A [RNA processing and modification]. Length = 924 Score = 29.1 bits (65), Expect = 5.0 Identities = 13/49 (26%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Query: 447 IIADLARMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPK 495 I+ + ++I+G TG GK+ + IL A C +I P+ Sbjct: 181 ILDAIEENQVVVISGETGCGKTTQVPQFILDEAIESGAA-CNIICTQPR 228 >gnl|CDD|31157 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane]. Length = 518 Score = 29.2 bits (65), Expect = 5.1 Identities = 19/118 (16%), Positives = 35/118 (29%), Gaps = 2/118 (1%) Query: 76 DVAIQFFGIASVFFLPPPTMWALSLL-FDKKIYCFSKRATAWLINILVSATFFASFSPSQ 134 + FG PPP W L+ ++ T+W F F + Sbjct: 18 LLLALVFGALFALAFPPPDWWWLAWFSLAPLLWLVRGAPTSWEGLAKSGFLFGFGFFLAG 77 Query: 135 SWPIQNGFGGIIGDLIIRLPFLFFESYPRKLGILFFQMILFLAMSWLLIYSSSAIFQG 192 + + G +G L + LP L L + + + W + + + Sbjct: 78 FYWLGTSLGVGLGLLAVALPLLVL-LLAAWLALFLLLVAVLTCRLWFALLVVPSAWVA 134 >gnl|CDD|34613 COG5008, PilU, Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 375 Score = 29.1 bits (65), Expect = 5.1 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 446 PIIADLARMPH--LLIAGTTGSGKSVAINTMI 475 ++ DLA ++I G TGSGKS + MI Sbjct: 117 EVLKDLALAKRGLVIIVGATGSGKSTTMAAMI 148 >gnl|CDD|37866 KOG2655, KOG2655, KOG2655, Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning, Nuclear structure, Intracellular trafficking, secretion, and vesicular transport]. Length = 366 Score = 29.1 bits (65), Expect = 5.4 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 7/64 (10%) Query: 457 LLIAGTTGSGKSVAINTMILSLLY---RMTPAQCR---LIMIDPKMLELSVYDGIPNLLT 510 L++ G +G GKS IN++ L+ L + A R + I+ +E+ +G+ LT Sbjct: 24 LMVVGESGLGKSTFINSLFLTDLSGNREVPGASERIKETVEIESTKVEI-EENGVKLNLT 82 Query: 511 PVVT 514 + T Sbjct: 83 VIDT 86 >gnl|CDD|31829 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair]. Length = 845 Score = 28.8 bits (64), Expect = 5.5 Identities = 11/52 (21%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Query: 447 IIADLARMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLE 498 I+ + + ++I G TGSGK+ + +L ++ P+ L Sbjct: 58 ILKAIEQNQVVIIVGETGSGKTTQLPQFLLEEGLG---IAGKIGCTQPRRLA 106 >gnl|CDD|146673 pfam04157, EAP30, EAP30/Vps36 family. This family includes EAP30 as well as the Vps36 protein. Vps36 is involved in Golgi to endosome trafficking. EAP30 is a subunit of the ELL complex. The ELL is an 80-kDa RNA polymerase II transcription factor. ELL interacts with three other proteins to form the complex known as ELL complex. The ELL complex is capable of increasing that catalytic rate of transcription elongation, but is unable to repress initiation of transcription by RNA polymerase II as is the case of ELL. EAP30 is thought to lead to the derepression of ELL's transcriptional inhibitory activity. Length = 219 Score = 28.8 bits (65), Expect = 6.0 Identities = 8/30 (26%), Positives = 17/30 (56%) Query: 756 ASISYIQRRLGIGYNRAASIIENMEEKGVI 785 + S + +LG RA ++E E++G++ Sbjct: 187 VTASELAEKLGWSIGRAKEVLEKAEKEGLL 216 >gnl|CDD|144909 pfam01490, Aa_trans, Transmembrane amino acid transporter protein. This transmembrane region is found in many amino acid transporters including UNC-47 and MTR. UNC-47 encodes a vesicular amino butyric acid (GABA) transporter, (VGAT). UNC-47 is predicted to have 10 transmembrane domains. MTR is a N system amino acid transporter system protein involved in methyltryptophan resistance. Other members of this family include proline transporters and amino acid permeases. Length = 405 Score = 28.8 bits (65), Expect = 6.2 Identities = 25/178 (14%), Positives = 51/178 (28%), Gaps = 19/178 (10%) Query: 23 KKKMKIVAGLILLCTVFAITLAL-GTWDVYDPSFSYITLRSPKNFLGYGGAIFADVAIQF 81 K++ I++ TV I + L G + I L P + + + Sbjct: 226 PPMTKVLLTAIIIVTVLYILVGLVGYLTFGNNVKGNILLNLPNSG-WLIIIANVLLVLHL 284 Query: 82 FGIASVFFLPPPTMWALSLLFDKKIYCFSKRATAWLIN-----ILVSATFFASFSPS--- 133 + P + +LLF K + L ++V A P Sbjct: 285 LLSYPLQAFPIRDIV-ENLLFRKGASGKHNPKSKLLRVVIRSGLVVITYLIAISVPFFGD 343 Query: 134 --------QSWPIQNGFGGIIGDLIIRLPFLFFESYPRKLGILFFQMILFLAMSWLLI 183 P+ + + + E +K+ + +I L M++ + Sbjct: 344 LLSLVGATSGAPLTFILPPLFHLKLKKPKKKSLEWLWKKILDVICIVIGLLLMAYGVA 401 >gnl|CDD|31846 COG1660, COG1660, Predicted P-loop-containing kinase [General function prediction only]. Length = 286 Score = 28.6 bits (64), Expect = 6.2 Identities = 8/21 (38%), Positives = 15/21 (71%) Query: 454 MPHLLIAGTTGSGKSVAINTM 474 M +++ G +G+GKSVA+ + Sbjct: 1 MRLVIVTGLSGAGKSVALRVL 21 >gnl|CDD|109212 pfam00146, NADHdh, NADH dehydrogenase. Length = 309 Score = 28.7 bits (65), Expect = 6.2 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 11/82 (13%) Query: 118 INILVSATFFASFSPSQSWPIQNGFGGIIGDLIIRLPFLFF------ESYPR----KLGI 167 NI++ + + PI GII +++ LFF SYPR +L Sbjct: 229 ANIILMSLLTSVLFLGGWLPILPPELGIIW-FVLKTYLLFFLFIWVRASYPRFRYDQLMY 287 Query: 168 LFFQMILFLAMSWLLIYSSSAI 189 L ++ L L+++ LL +S I Sbjct: 288 LGWKNFLPLSLANLLFTASLLI 309 >gnl|CDD|35277 KOG0054, KOG0054, KOG0054, Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1381 Score = 28.7 bits (64), Expect = 6.8 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 5/35 (14%) Query: 459 IAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMID 493 I G TG+GKS I L+R+ I+ID Sbjct: 1171 IVGRTGAGKSSLILA-----LFRLVEPAEGEILID 1200 >gnl|CDD|100120 cd06181, BI-1-like, BAX inhibitor (BI)-1 like protein family. Mammalian members of this family of small transmembrane proteins have been shown to have an antiapoptotic effect either by stimulating the antiapoptotic function of Bcl-2, a well characterized oncogene, or inhibiting the proapoptotic effect of Bax, another member of the Bcl-2 family. Their broad tissue distribution and high degree of conservation suggests an important regulatory role. In plants, BI-1 like proteins play a role in pathogen resistance. A prokaryotic member, E.coli YccA, has been shown to interact with ATP-dependent protease FtsH, which degrades abnormal membrane proteins as part of a quality control mechanism to keep the integrity of biological membranes.. Length = 212 Score = 28.6 bits (65), Expect = 7.0 Identities = 14/75 (18%), Positives = 30/75 (40%), Gaps = 1/75 (1%) Query: 29 VAGLILLCTVFAITLALGTWDVYDPSFSYITLRSPKNFLGYGGAIFADV-AIQFFGIASV 87 + ++ + T ++ A G S L + ++F GG +F + + + ++ Sbjct: 85 LGPILSVYTAASVLQAFGITAAVFGGLSLYALTTKRDFSFLGGFLFMGLIVLIVASLVNI 144 Query: 88 FFLPPPTMWALSLLF 102 F P A+S L Sbjct: 145 FLQSPALQLAISALG 159 >gnl|CDD|28927 cd00046, DEXDc, DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.. Length = 144 Score = 28.5 bits (63), Expect = 8.2 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Query: 456 HLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYD 503 +L+A TGSGK++A IL LL + Q L++ + L V + Sbjct: 2 DVLLAAPTGSGKTLAALLPILELLDSLKGGQV-LVLAPTRELANQVAE 48 >gnl|CDD|109493 pfam00437, GSPII_E, Type II/IV secretion system protein. This family contains both type II and type IV pathway secretion proteins from bacteria. VirB11 ATPase is a subunit of the Agrobacterium tumefaciens transfer DNA (T-DNA) transfer system, a type IV secretion pathway required for delivery of T-DNA and effector proteins to plant cells during infection. Length = 283 Score = 28.4 bits (64), Expect = 8.8 Identities = 7/19 (36%), Positives = 14/19 (73%) Query: 457 LLIAGTTGSGKSVAINTMI 475 +L++G TGSGK+ + ++ Sbjct: 142 ILVSGGTGSGKTTLLYALL 160 >gnl|CDD|35571 KOG0350, KOG0350, KOG0350, DEAD-box ATP-dependent RNA helicase [RNA processing and modification]. Length = 620 Score = 28.1 bits (62), Expect = 9.3 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Query: 457 LLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDP-KMLELSVYD 503 + + TGSGK++A I+ LL + R ++I P + L L VYD Sbjct: 186 ICVNAPTGSGKTLAYVIPIVQLLSSRPVKRLRAVVIVPTRELALQVYD 233 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.137 0.398 Gapped Lambda K H 0.267 0.0748 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 9,727,475 Number of extensions: 545045 Number of successful extensions: 1807 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1795 Number of HSP's successfully gapped: 85 Length of query: 806 Length of database: 6,263,737 Length adjustment: 102 Effective length of query: 704 Effective length of database: 4,059,619 Effective search space: 2857971776 Effective search space used: 2857971776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 61 (27.2 bits)