RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780799|ref|YP_003065212.1| DNA translocase FtsK [Candidatus Liberibacter asiaticus str. psy62] (806 letters) >gnl|CDD|182344 PRK10263, PRK10263, DNA translocase FtsK; Provisional. Length = 1355 Score = 492 bits (1267), Expect = e-139 Identities = 247/496 (49%), Positives = 329/496 (66%), Gaps = 19/496 (3%) Query: 309 LPSKEILSTSQSPVNQM-TFSPKVMQNNACTLKSVLSDFGIQGEIVNVRPGPVITLYELE 367 LPS ++L+ S V + TF+ + M A +++ L+DF I+ ++VN PGPVIT +EL Sbjct: 866 LPSLDLLTPPPSEVEPVDTFALEQM---ARLVEARLADFRIKADVVNYSPGPVITRFELN 922 Query: 368 PAPGIKSSRIIGLSDDIARSMSAISARVA-VIPRRNAIGIELPNDIRETVMLRDLIVSRV 426 APG+K++RI LS D+ARS+S ++ RV VIP + +G+ELPN R+TV LR+++ + Sbjct: 923 LAPGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAK 982 Query: 427 FEKNQCDLAINLGKSIEGKPIIADLARMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQ 486 F N L + LGK I G+P++ADLA+MPHLL+AGTTGSGKSV +N MILS+LY+ P Sbjct: 983 FRDNPSPLTVVLGKDIAGEPVVADLAKMPHLLVAGTTGSGKSVGVNAMILSMLYKAQPED 1042 Query: 487 CRLIMIDPKMLELSVYDGIPNLLTPVVTNPQKAVTVLKWLVCEMEERYQKMSKIGVRNID 546 R IMIDPKMLELSVY+GIP+LLT VVT+ + A L+W V EME RY+ MS +GVRN+ Sbjct: 1043 VRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWCVNEMERRYKLMSALGVRNLA 1102 Query: 547 GFNLKVAQYHNTGKKFNRTVQTGFDRKTGEAIYETEHFDFQHMPYIVVVIDEMADLMMVA 606 G+N K+A+ R + + K G+++ + +H + PYIVV++DE ADLMM Sbjct: 1103 GYNEKIAEADRMM----RPIPDPY-WKPGDSM-DAQHPVLKKEPYIVVLVDEFADLMMTV 1156 Query: 607 RKDIESAVQRLAQMARASGIHVIMATQRPSVDVITGTIKANFPTRISFQVSSKIDSRTIL 666 K +E + RLAQ ARA+GIH+++ATQRPSVDVITG IKAN PTRI+F VSSKIDSRTIL Sbjct: 1157 GKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSRTIL 1216 Query: 667 GEQGAEQLLGQGDMLYMTGGGRVQ-RIHGPFVSDIEVEKVVSHLKTQGEAKYIDIKDKIL 725 + GAE LLG GDMLY + R+HG FV D EV VV K +G +Y+ D I Sbjct: 1217 DQAGAESLLGMGDMLYSGPNSTLPVRVHGAFVRDQEVHAVVQDWKARGRPQYV---DGIT 1273 Query: 726 LNEEMRFS----ENSSVADDLYKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIENMEE 781 + E + + D L+ QAV V KASIS +QR+ IGYNRAA IIE ME Sbjct: 1274 SDSESEGGAGGFDGAEELDPLFDQAVQFVTEKRKASISGVQRQFRIGYNRAARIIEQMEA 1333 Query: 782 KGVIGPASSTGKREIL 797 +G++ G RE+L Sbjct: 1334 QGIVSEQGHNGNREVL 1349 >gnl|CDD|150161 pfam09397, Ftsk_gamma, Ftsk gamma domain. This domain directs oriented DNA translocation and forms a winged helix structure. Mutated proteins with substitutions in the FtsK gamma DNA-recognition helix are impaired in DNA binding. Length = 67 Score = 106 bits (267), Expect = 3e-23 Identities = 33/61 (54%), Positives = 46/61 (75%) Query: 740 DDLYKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIENMEEKGVIGPASSTGKREILIS 799 D+LY +AV+ V+ KAS S +QRRL IGYNRAA +IE MEE+G++GPA+ + RE+L+ Sbjct: 6 DELYDEAVEFVIETQKASTSLLQRRLRIGYNRAARLIEQMEEEGIVGPANGSKPREVLVP 65 Query: 800 S 800 Sbjct: 66 K 66 >gnl|CDD|129076 smart00843, Ftsk_gamma, This domain directs oriented DNA translocation and forms a winged helix structure. Mutated proteins with substitutions in the FtsK gamma DNA-recognition helix are impaired in DNA binding. Length = 63 Score = 105 bits (264), Expect = 7e-23 Identities = 31/60 (51%), Positives = 48/60 (80%) Query: 740 DDLYKQAVDIVLRDNKASISYIQRRLGIGYNRAASIIENMEEKGVIGPASSTGKREILIS 799 D+LY +AV++V+ KAS S +QRRL IGYNRAA +I+ +EE+G++GPA+ + RE+L++ Sbjct: 4 DELYDEAVELVIETQKASTSLLQRRLRIGYNRAARLIDQLEEEGIVGPANGSKPREVLVT 63 >gnl|CDD|150993 pfam10412, TrwB_AAD_bind, Type IV secretion-system coupling protein DNA-binding domain. The plasmid conjugative coupling protein TrwB forms hexamers from six structurally very similar protomers. This hexamer contains a central channel running from the cytosolic pole (made up by the AADs) to the membrane pole ending at the transmembrane pore shaped by 12 transmembrane helices, rendering an overall mushroom-like structure. The TrwB_AAD (all-alpha domain) domain appears to be the DNA-binding domain of the structure. TrwB, a basic integral inner-membrane nucleoside-triphosphate-binding protein, is the structural prototype for the type IV secretion system coupling proteins, a family of proteins essential for macromolecular transport between cells and export. Length = 386 Score = 40.6 bits (96), Expect = 0.001 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Query: 442 IEGKPIIADLARMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPK 495 I G P+ H+LI GTTG+GK+ A+ ++ + R R I+ DP Sbjct: 4 IAGVPLPRRSETQ-HILIVGTTGTGKTQALRELLDQIRAR----GDRAIIYDPT 52 >gnl|CDD|131806 TIGR02759, TraD_Ftype, type IV conjugative transfer system coupling protein TraD. The TraD protein performs an essential coupling function in conjugative type IV secretion systems. This protein sits at the inner membrane in contact with the assembled pilus and its scaffold as well as the relaxosome-plasmid DNA complex (through TraM). Length = 566 Score = 36.2 bits (84), Expect = 0.031 Identities = 18/31 (58%), Positives = 21/31 (67%) Query: 441 SIEGKPIIADLARMPHLLIAGTTGSGKSVAI 471 I G P+I + H+LI GTTGSGKSVAI Sbjct: 163 KIGGLPLIKFGSETQHILIHGTTGSGKSVAI 193 >gnl|CDD|128763 smart00487, DEXDc, DEAD-like helicases superfamily. Length = 201 Score = 35.9 bits (83), Expect = 0.041 Identities = 27/174 (15%), Positives = 59/174 (33%), Gaps = 34/174 (19%) Query: 451 LARMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLT 510 L+ + +++A TGSGK++A L L R + L+++ + L + Sbjct: 21 LSGLRDVILAAPTGSGKTLAALLPALEALKRGKGKRV-LVLVPTRELAEQWAE------- 72 Query: 511 PVVTNPQKAVTVLKWLVCEMEERYQKMSKIGVRNIDGFNLKVAQYHNTGKKFNRTVQTGF 570 E+++ + V G + + K + V T Sbjct: 73 ------------------ELKKLGPSLGLKVVGLYGGDSKREQLRKLESGKTDILVTT-- 112 Query: 571 DRKTGEAIYETEHFDFQHMPYIVVVIDEMADLM--MVARKDIESAVQRLAQMAR 622 G + E+ + +V++DE A + +E ++ L + + Sbjct: 113 ---PGRLLDLLENDLLELSNVDLVILDE-AHRLLDGGFGDQLEKLLKLLPKNVQ 162 >gnl|CDD|163455 TIGR03743, SXT_TraD, conjugative coupling factor TraD, SXT/TOL subfamily. Members of this protein family are the putative conjugative coupling factor, TraD (or TraG), rather distantly related to the well-characterized TraD of the F plasmid. Members are associated with conjugative-transposon-like mobile genetic elements of the class that includes SXT, an antibiotic resistance transfer element in some Vibrio cholerae strains. Length = 634 Score = 35.7 bits (83), Expect = 0.048 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 5/52 (9%) Query: 445 KPIIADLARMP-HLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPK 495 + + L H L+ GTTG GK+ +I + R +I+IDPK Sbjct: 166 EDVYLPLGHRVGHTLVLGTTGVGKTRLAELLITQDIRRGDV----VIVIDPK 213 >gnl|CDD|180487 PRK06247, PRK06247, pyruvate kinase; Provisional. Length = 476 Score = 35.3 bits (82), Expect = 0.064 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 14/65 (21%) Query: 596 IDEMADLMMVARKDI------ES--AVQ-RLAQMARASGIHVIMATQRPSVDVITGTIKA 646 I E +D +MVAR D+ E +Q R+ + AR +G V++ATQ ++ I+ Sbjct: 230 IVEASDAIMVARGDLGVEVPLEQVPLIQKRIIRAARRAGKPVVVATQ-----MLESMIEN 284 Query: 647 NFPTR 651 PTR Sbjct: 285 PVPTR 289 >gnl|CDD|163456 TIGR03744, traC_PFL_4706, conjugative transfer ATPase, PFL_4706 family. Members of this protein family are predicted ATP-binding proteins apparently associated with DNA conjugal transfer. Members are found both in plasmids and in bacterial chromosomal regions that appear to derive from integrative elements such as conjugative transposons. More distant homologs, outside the scope of this family, include type IV secretion/conjugal transfer proteins such as TraC, VirB4 and TrsE. The granularity of this protein family definition is chosen so as to represent one distinctive clade and act as a marker through which to define and recognize the class of mobile element it serves. Length = 893 Score = 34.2 bits (79), Expect = 0.12 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Query: 456 HLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMID 493 HLLI G TG+GKS + +++ ++ P RL +++ Sbjct: 477 HLLILGPTGAGKSATLTNLLMQVMAVHRP---RLFIVE 511 >gnl|CDD|131585 TIGR02533, type_II_gspE, general secretory pathway protein E. This family describes GspE, the E protein of the type II secretion system, also called the main terminal branch of the general secretion pathway. This model separates GspE from the PilB protein of type IV pilin biosynthesis. Length = 486 Score = 33.9 bits (78), Expect = 0.16 Identities = 29/99 (29%), Positives = 46/99 (46%), Gaps = 19/99 (19%) Query: 389 SAISARVAVIPRRNAIGIELPNDIRETVML--RDL--------------IVSRVFEKNQC 432 +A+ +RV ++ + N LP D R ++ + RD+ +V R+ +K Sbjct: 158 AALVSRVKIMAKLNIAEKRLPQDGRISLRVGGRDIDIRVSTVPTSHGERVVMRLLDKTAV 217 Query: 433 DLAI-NLGKSIEGKPIIADLARMPH--LLIAGTTGSGKS 468 L + LG S E L R PH +L+ G TGSGK+ Sbjct: 218 RLDLETLGMSPELLSRFERLIRRPHGIILVTGPTGSGKT 256 >gnl|CDD|184357 PRK13873, PRK13873, conjugal transfer ATPase TrbE; Provisional. Length = 811 Score = 33.0 bits (76), Expect = 0.34 Identities = 11/21 (52%), Positives = 14/21 (66%) Query: 456 HLLIAGTTGSGKSVAINTMIL 476 H L+ G TG+GKSV + M L Sbjct: 443 HTLVVGPTGAGKSVLLALMAL 463 >gnl|CDD|163531 TIGR03819, heli_sec_ATPase, helicase/secretion neighborhood ATPase. Members of this protein family comprise a distinct clade of putative ATPase associated with an integral membrane complex likely to act in pilus formation, secretion, or conjugal transfer. The association of most members with a nearby gene for a DEAH-box helicase suggests a role in conjugal transfer. Length = 340 Score = 32.7 bits (75), Expect = 0.42 Identities = 26/112 (23%), Positives = 47/112 (41%), Gaps = 36/112 (32%) Query: 384 IARSMSAISARVAVIPRRNAIGIELPNDIRETVMLRDLIVSRVFEKNQCDLAINLGKSIE 443 +A + +S RV PR T L +L+ S F Sbjct: 135 VATDGTCLSLRV---PRP------------RTFTLDELVASGTFPP-------------G 166 Query: 444 GKPIIADL--ARMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMID 493 ++ + AR+ LI+G TGSGK+ T++ +LL + P + R+++++ Sbjct: 167 VARLLRAIVAARLA-FLISGGTGSGKT----TLLSALLALVAPDE-RIVLVE 212 >gnl|CDD|182509 PRK10513, PRK10513, sugar phosphate phosphatase; Provisional. Length = 270 Score = 32.4 bits (74), Expect = 0.43 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Query: 589 MPYIVVVIDEMADLMMVARKDIESAVQRLAQMARASGIHVIMATQRPSVDV 639 M ++ ID M +++ I AV++ ARA G++V++ T RP V Sbjct: 1 MAIKLIAID-MDGTLLLPDHTISPAVKQAIAAARAKGVNVVLTTGRPYAGV 50 >gnl|CDD|183479 PRK12373, PRK12373, NADH dehydrogenase subunit E; Provisional. Length = 400 Score = 31.7 bits (72), Expect = 0.68 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 5/48 (10%) Query: 350 GEIVNVRPGPVITLYELEPAPGIKSSRIIGLSDDIARSMSAISARVAV 397 G+ V+PGP I Y EPA G+ S L+++ ++ S +A Sbjct: 172 GKGPVVKPGPQIGRYASEPAGGLTS-----LTEEAGKARYNASKALAE 214 >gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment. Length = 148 Score = 31.6 bits (71), Expect = 0.82 Identities = 15/58 (25%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Query: 453 RMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLT 510 +LI G GSGK+ T+ +L + P +I ID + + V D + ++ Sbjct: 1 PGEVILIVGPPGSGKT----TLARALARELGPPGGGVIYIDGEDILEEVLDQLLLIIV 54 >gnl|CDD|180277 PRK05826, PRK05826, pyruvate kinase; Provisional. Length = 465 Score = 31.7 bits (73), Expect = 0.89 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 12/50 (24%) Query: 596 IDEM---ADLMMVARKD--IE------SAVQ-RLAQMARASGIHVIMATQ 633 IDE+ +D +MVAR D +E +Q ++ + AR +G VI ATQ Sbjct: 231 IDEIIEASDGIMVARGDLGVEIPDEEVPGLQKKIIRKAREAGKPVITATQ 280 >gnl|CDD|162184 TIGR01064, pyruv_kin, pyruvate kinase. This enzyme is a homotetramer. Some forms are active only in the presence of fructose-1,6-bisphosphate or similar phosphorylated sugars. Length = 473 Score = 31.5 bits (72), Expect = 0.92 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 14/65 (21%) Query: 596 IDEMADLMMVARKD--IE-SAVQ------RLAQMARASGIHVIMATQRPSVDVITGTIKA 646 I E +D +MVAR D +E A + ++ + +G VI ATQ ++ IK Sbjct: 232 IAEASDGIMVARGDLGVEIPAEEVPIAQKKMIRKCNRAGKPVITATQ-----MLDSMIKN 286 Query: 647 NFPTR 651 PTR Sbjct: 287 PRPTR 291 >gnl|CDD|162997 TIGR02746, TraC-F-type, type-IV secretion system protein TraC. The protein family described here is common among the F, P and I-like type IV secretion systems. Gene symbols include TraC (F-type), TrbE/VirB4 (P-type) and TraU (I-type). The protein conyains the Walker A and B motifs and so is a putative nucleotide triphosphatase. Length = 797 Score = 31.5 bits (72), Expect = 0.95 Identities = 7/22 (31%), Positives = 13/22 (59%) Query: 458 LIAGTTGSGKSVAINTMILSLL 479 + G +G+GKS + +I+ L Sbjct: 434 AVVGGSGAGKSFFMQELIVDNL 455 >gnl|CDD|150299 pfam09586, YfhO, Bacterial membrane protein YfhO. This protein is a conserved membrane protein. The yfhO gene is transcribed in Difco sporulation medium and the transcription is affected by the YvrGHb two-component system. Some members of this family have been annotated as glycosyl transferases of the PMT family. Length = 835 Score = 31.4 bits (72), Expect = 0.98 Identities = 27/100 (27%), Positives = 49/100 (49%), Gaps = 7/100 (7%) Query: 82 FGIASVFFLPPPTMWALSLLFDKKIYCFSKRATAWLINIL--VSATFFASFSPSQSWPIQ 139 GI++V LP L LL +K+ Y + IN L ++ SF+ +Q + Sbjct: 224 GGISAVVLLPT----VLGLLNNKRAYTEVSILLTFDINPLDLLAKLLIGSFNFTQMGGLP 279 Query: 140 NGFGGIIGDLIIRLPFLFFESYPRKLGILFFQMILFLAMS 179 N + G++ L++ + + F + K +LF ++LFL +S Sbjct: 280 NIYVGLLP-LLLLILYFFNKLIKLKEKLLFALLLLFLILS 318 >gnl|CDD|183378 PRK11913, phhA, phenylalanine 4-monooxygenase; Reviewed. Length = 275 Score = 31.4 bits (72), Expect = 1.0 Identities = 18/73 (24%), Positives = 25/73 (34%), Gaps = 17/73 (23%) Query: 574 TGEAIYETEH-------FDFQHM---PY-------IVVVIDEMADLMMVARKDIESAVQR 616 GE +Y E FD + + PY VID L +A D + V R Sbjct: 196 PGETLYALESDSPNRRPFDLERVMRTPYRIDIFQPTYFVIDSFEQLFDIAEPDFMALVAR 255 Query: 617 LAQMARASGIHVI 629 Q+ + V Sbjct: 256 AKQLGLFAPGFVP 268 >gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional. Length = 588 Score = 31.1 bits (71), Expect = 1.3 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 5/35 (14%) Query: 459 IAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMID 493 I G TG+GKS IN LL R+ Q I+ID Sbjct: 366 IVGPTGAGKSTLIN-----LLQRVFDPQSGRILID 395 >gnl|CDD|118392 pfam09862, DUF2089, Protein of unknown function(DUF2089). This domain, found in various hypothetical prokaryotic proteins, has no known function. Length = 113 Score = 30.7 bits (70), Expect = 1.6 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 5/55 (9%) Query: 747 VDIVLRDNKASISYIQRRLGIGY----NRAASIIENMEEKGVIGPASSTGKREIL 797 V++ ++ + +I +++ LGI Y NR II + + P K+EIL Sbjct: 42 VELFIK-CRGNIKEVEKELGISYPTVRNRLDEIIAALGYEEEPEPEKRVDKKEIL 95 >gnl|CDD|180064 PRK05416, PRK05416, glmZ(sRNA)-inactivating NTPase; Provisional. Length = 288 Score = 30.5 bits (70), Expect = 1.8 Identities = 9/23 (39%), Positives = 16/23 (69%) Query: 452 ARMPHLLIAGTTGSGKSVAINTM 474 A M +++ G +G+GKSVA+ + Sbjct: 4 APMRLVIVTGLSGAGKSVALRAL 26 >gnl|CDD|183503 PRK12402, PRK12402, replication factor C small subunit 2; Reviewed. Length = 337 Score = 30.0 bits (68), Expect = 2.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Query: 448 IADLARMPHLLIAGTTGSGKSVAI 471 D +PHLL+ G GSGK+ A+ Sbjct: 30 AVDSPNLPHLLVQGPPGSGKTAAV 53 >gnl|CDD|184806 PRK14725, PRK14725, pyruvate kinase; Provisional. Length = 608 Score = 29.9 bits (68), Expect = 2.5 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 9/39 (23%) Query: 604 MVARKD--IESAVQRLAQ-------MARASGIHVIMATQ 633 M+AR D +E +RLA+ + A+ + VI ATQ Sbjct: 505 MIARGDLAVEVGFERLAEVQEEILWLCEAAHVPVIWATQ 543 >gnl|CDD|178776 PLN03238, PLN03238, probable histone acetyltransferase MYST; Provisional. Length = 290 Score = 29.8 bits (67), Expect = 2.7 Identities = 13/41 (31%), Positives = 20/41 (48%) Query: 594 VVIDEMADLMMVARKDIESAVQRLAQMARASGIHVIMATQR 634 V I +++ + +DI S +Q L + G HVI QR Sbjct: 224 VSIKDLSLATGIRGEDIVSTLQSLNLIKYWKGQHVIHVDQR 264 >gnl|CDD|182240 PRK10098, PRK10098, putative dehydrogenase; Provisional. Length = 350 Score = 29.6 bits (67), Expect = 3.0 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 6/48 (12%) Query: 181 LLIYSSSAIFQGKRRVPYNM-----ADCLISDESKTQLE-DVMASSLL 222 LL +++SAI GK RV +N CLI + VM S L Sbjct: 178 LLDFATSAIAFGKTRVAWNKGVPVPPGCLIDVNGVPTTDPAVMQESPL 225 >gnl|CDD|130947 TIGR01892, AcOrn-deacetyl, acetylornithine deacetylase (ArgE). This model represents a clade of acetylornithine deacetylases from proteobacteria. This enzyme is the final step of the "acetylated" ornithine biosynthesis pathway. The enzyme is closely related to dapE, succinyl-diaminopimelate desuccinylase, and outside of this clade annotation is very inaccurate as to which function should be ascribed to genes. Length = 364 Score = 29.4 bits (66), Expect = 3.4 Identities = 17/74 (22%), Positives = 31/74 (41%), Gaps = 2/74 (2%) Query: 350 GEIVNVRPGPVITLYELEPAPGIKSSRIIGLSDDIARSMSAIS-ARVAVIPRRNAI-GIE 407 G+ VN+ PG ++E P PG+ ++ L + IA+++ I + G+ Sbjct: 233 GKAVNIIPGACEFVFEWRPIPGMDPEELLQLLETIAQALVRDEPGFEVQIEVVSTDPGVN 292 Query: 408 LPNDIRETVMLRDL 421 D L +L Sbjct: 293 TEPDAELVAFLEEL 306 >gnl|CDD|162351 TIGR01420, pilT_fam, pilus retraction protein PilT. This model represents the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction. Members of this family may be found in some species that type IV pili but have related structures for DNA uptake and natural transformation. Length = 343 Score = 29.2 bits (66), Expect = 4.4 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Query: 446 PIIADLARMPH--LLIAGTTGSGKSVAINTMI 475 P++ +LA P +L+ G TGSGKS + +MI Sbjct: 112 PVLRELAERPRGLILVTGPTGSGKSTTLASMI 143 >gnl|CDD|163401 TIGR03689, pup_AAA, proteasome ATPase. In the Actinobacteria, as shown for Mycobacterium tuberculosis, some proteins are modified by ligation between an epsilon-amino group of a lysine side chain and the C-terminal carboxylate of the ubiquitin-like protein Pup. This modification leads to protein degradation by the archaeal-like proteasome found in the Actinobacteria. Members of this protein family belong to the AAA family of ATPases and tend to be clustered with the genes for Pup, the Pup ligase PafA, and structural components of the proteasome. This protein forms hexameric rings with ATPase activity. Length = 512 Score = 29.3 bits (66), Expect = 4.4 Identities = 17/85 (20%), Positives = 35/85 (41%), Gaps = 11/85 (12%) Query: 597 DEMADLMMVARKDIE---SAVQRLAQMARASGIHVIMATQRPSVDVITGTIKANFPTRIS 653 ++A+L+ AR + S +++LAQ G + A + +V T R+ Sbjct: 18 AKLAELLKAARDKLSKLKSQLEQLAQPPSTYGTFLQTAIDDETAEVFTAG------RRMR 71 Query: 654 FQVSSKIDSRTILGEQGAEQLLGQG 678 VS +++ ++ G L + Sbjct: 72 VTVSPNVNAAELV--PGQTVRLNEA 94 >gnl|CDD|161993 TIGR00678, holB, DNA polymerase III, delta' subunit. At position 126-127 of the seed alignment, this family lacks the HM motif of gamma/tau; at 132 it has a near-invariant A vs. an invariant F in gamma/tau. Length = 188 Score = 29.1 bits (66), Expect = 4.8 Identities = 14/48 (29%), Positives = 18/48 (37%), Gaps = 9/48 (18%) Query: 453 RMPH-LLIAGTTGSGKSVAINTMILSLLYRM--------TPAQCRLIM 491 R+ H L AG G GK + + +LL CRLI Sbjct: 12 RLAHAYLFAGPEGVGKELLALALAKALLCEQPGGGEPCGECPSCRLIE 59 >gnl|CDD|114590 pfam05872, DUF853, Bacterial protein of unknown function (DUF853). This family consists of several bacterial proteins of unknown function. One member from Brucella melitensis is thought to be an ATPase. Length = 504 Score = 28.9 bits (65), Expect = 5.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Query: 456 HLLIAGTTGSGKSVAINTMILSL 478 H LIAG TG+GK+V + + S Sbjct: 23 HGLIAGATGTGKTVTLQVLAESF 45 >gnl|CDD|165253 PHA02943, PHA02943, hypothetical protein; Provisional. Length = 165 Score = 28.7 bits (64), Expect = 5.7 Identities = 8/35 (22%), Positives = 20/35 (57%) Query: 751 LRDNKASISYIQRRLGIGYNRAASIIENMEEKGVI 785 L D + S I +LG+ ++ A + + + ++G++ Sbjct: 20 LADGCKTTSRIANKLGVSHSMARNALYQLAKEGMV 54 >gnl|CDD|178040 PLN02420, PLN02420, endoglucanase. Length = 525 Score = 28.8 bits (64), Expect = 6.0 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 10/50 (20%) Query: 744 KQAVDIVLRDNKASISYIQRRLGIG-------YNRAASIIENMEEKGVIG 786 K +D +L N SY+ +G G ++R ASI E KG IG Sbjct: 400 KSQIDYILGSNPMETSYL---VGYGPKYPTRVHHRGASIASFKEHKGFIG 446 >gnl|CDD|162115 TIGR00929, VirB4_CagE, type IV secretion/conjugal transfer ATPase, VirB4 family. Type IV secretion systems are found in Gram-negative pathogens. They export proteins, DNA, or complexes in different systems and are related to plasmid conjugation systems. This model represents related ATPases that include VirB4 in Agrobacterium tumefaciens (DNA export) CagE in Helicobacter pylori (protein export) and plasmid TraB (conjugation). Length = 785 Score = 28.8 bits (65), Expect = 6.1 Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Query: 456 HLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMID 493 H LI G TGSGK+ +N +L+ + + + D Sbjct: 436 HTLIFGPTGSGKTTLLN-FLLAQMQKYGGM--TIFAFD 470 >gnl|CDD|172375 PRK13851, PRK13851, type IV secretion system protein VirB11; Provisional. Length = 344 Score = 28.7 bits (64), Expect = 6.3 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 6/45 (13%) Query: 457 LLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSV 501 +L+ G TGSGK+ T+I ++ P Q RLI I+ LEL + Sbjct: 165 MLLCGPTGSGKTTMSKTLISAI-----PPQERLITIE-DTLELVI 203 >gnl|CDD|182098 PRK09828, PRK09828, putative fimbrial outer membrane usher protein; Provisional. Length = 865 Score = 28.6 bits (64), Expect = 7.3 Identities = 28/93 (30%), Positives = 40/93 (43%), Gaps = 20/93 (21%) Query: 369 APGIKSSRIIGLSDDIARS----MSAISARVAVIPRRNAIGI---ELPNDI-----RETV 416 APG K +RI + I R SA+S R N + + L ND+ Sbjct: 705 APGAKGARINYGNSTIDRWGYGVTSALSPY-----RENRVALDINTLENDVELKSTSAVA 759 Query: 417 MLRD-LIVSRVFEKNQCDLAI-NLGKSIEGKPI 447 + R +V FE +Q AI N+ +S +GK I Sbjct: 760 VPRQGAVVLADFETDQGRSAIMNITRS-DGKNI 791 >gnl|CDD|177721 PLN00104, PLN00104, MYST -like histone acetyltransferase; Provisional. Length = 450 Score = 28.5 bits (64), Expect = 7.8 Identities = 13/42 (30%), Positives = 22/42 (52%) Query: 593 VVVIDEMADLMMVARKDIESAVQRLAQMARASGIHVIMATQR 634 + I E++D+ + +DI S +Q L + G HVI A + Sbjct: 374 NISIKELSDMTAIKAEDIVSTLQSLNLIQYRKGQHVICADPK 415 >gnl|CDD|131777 TIGR02730, carot_isom, carotene isomerase. Members of this family, including sll0033 (crtH) of Synechocystis sp. PCC 6803, catalyze a cis-trans isomerization of carotenes to the all-trans lycopene, a reaction that can also occur non-enzymatically in light through photoisomerization. Length = 493 Score = 28.2 bits (63), Expect = 7.9 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 12/78 (15%) Query: 372 IKSSRIIGLSDD-----IARSMSAISARVAVIPRRNAIGIELPNDIRETVMLRDLIVSRV 426 + +S I G D + R+++A+ ++ IP I LPN + ++ V R Sbjct: 51 VGASMIFGFGDKGTTNLLTRALAAVGRKLETIPDPVQIHYHLPNGL-------NVKVHRE 103 Query: 427 FEKNQCDLAINLGKSIEG 444 ++ +L EG Sbjct: 104 YDDFIQELVAKFPHEKEG 121 >gnl|CDD|181993 PRK09616, pheT, phenylalanyl-tRNA synthetase subunit beta; Reviewed. Length = 552 Score = 28.2 bits (64), Expect = 8.0 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 12/46 (26%) Query: 753 DNKASISYIQRRLGIGYN------------RAASIIENMEEKGVIG 786 + K+ + + R LGI Y R A I+ N ++ GVIG Sbjct: 477 EIKSVVQALLRELGIEYEVEESEHPSFIPGRCADILVNGKKIGVIG 522 >gnl|CDD|115248 pfam06578, YscK, YOP proteins translocation protein K (YscK). This family consists of several YscK proteins. The function of this protein is unknown but it belongs to an operon involved in the secretion of Yop proteins across bacterial membranes. Length = 206 Score = 28.1 bits (63), Expect = 8.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 663 RTILGEQGAEQLLGQGDML 681 +LGE+G LL QGD+L Sbjct: 101 NNLLGEEGHRFLLQQGDLL 119 >gnl|CDD|129495 TIGR00400, mgtE, Mg2+ transporter (mgtE). This family of prokaryotic proteins models a class of Mg++ transporter first described in Bacillus firmus. May form a homodimer. Length = 449 Score = 28.3 bits (63), Expect = 8.5 Identities = 29/126 (23%), Positives = 49/126 (38%), Gaps = 27/126 (21%) Query: 102 FDKKIYCFSKRATAWLINILVSATFFASFSPSQS------------WPIQNGFGGIIGD- 148 FD I +K WL+ +LVS+TF A+ + P+ G G Sbjct: 273 FDTSILVMAKNRIIWLLVLLVSSTFTATIISNYEDLLLSLVALANFIPLLMDTSGNAGSQ 332 Query: 149 ---LIIRLPFL-------FFESYPRKLGILFFQMILFLAMSWLLIYSSSAIFQGKRRVPY 198 ++IR L FF+ R++ + IL A+ + + FQGK + + Sbjct: 333 SSAVVIRGLALETVKVKDFFKVILREICV----SILVGAILASVNFLRIVFFQGKLLIAF 388 Query: 199 NMADCL 204 ++ L Sbjct: 389 VVSSSL 394 >gnl|CDD|130326 TIGR01259, comE, comEA protein. This model describes the ComEA protein in bacteria. The com E locus is obligatory for bacterial cell competence - the process of internalizing the exogenous added DNA. Lesions in the loci has been variously described for the appearance of competence-related pheonotypes and impairment of competence, suggesting their intimate functional role in bacterial transformation. Length = 120 Score = 28.3 bits (63), Expect = 8.6 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 8/66 (12%) Query: 722 DKILLNEEMRFSENSS---VADDLYK-QAVDIVLRDNKASISYIQRRLGIGYNRAASIIE 777 D++ + M+ E S K AV+I N AS+ +Q GIG +A +IIE Sbjct: 31 DEMFVYVPMKGEEAVSQQGTQSSAGKLAAVNI----NAASLEELQALPGIGPAKAKAIIE 86 Query: 778 NMEEKG 783 EE G Sbjct: 87 YREENG 92 >gnl|CDD|163021 TIGR02788, VirB11, P-type DNA transfer ATPase VirB11. The VirB11 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer. VirB11 is believed to be an ATPase. VirB11 is a homolog of the P-like conjugation system TrbB protein and the Flp pilus sytem protein TadA. Length = 308 Score = 28.1 bits (63), Expect = 8.7 Identities = 19/59 (32%), Positives = 23/59 (38%), Gaps = 20/59 (33%) Query: 434 LAINLGKSIEGKPIIADLARMPHLLIAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMI 492 LAI K+I +I+G TGSGK T L L P R+I I Sbjct: 139 LAIASRKNI---------------IISGGTGSGK-----TTFLKSLVDEIPKDERIITI 177 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.137 0.398 Gapped Lambda K H 0.267 0.0711 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 13,220,826 Number of extensions: 896323 Number of successful extensions: 2116 Number of sequences better than 10.0: 1 Number of HSP's gapped: 2107 Number of HSP's successfully gapped: 76 Length of query: 806 Length of database: 5,994,473 Length adjustment: 101 Effective length of query: 705 Effective length of database: 3,812,065 Effective search space: 2687505825 Effective search space used: 2687505825 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 61 (27.3 bits)