RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780800|ref|YP_003065213.1| hypothetical protein CLIBASIA_03455 [Candidatus Liberibacter asiaticus str. psy62] (192 letters) >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Score = 26.5 bits (57), Expect = 1.7 Identities = 10/57 (17%), Positives = 20/57 (35%) Query: 136 QIRNRTHWNTANLVPMDPVTLGLCAQIDLDREIEKCSKNTEAKYNKAVDDISTPFSS 192 ++ + A + ++ + +LDRE E NT DD + + Sbjct: 40 KLSYFIGNDPARWLTVNKDNGIVTGNGNLDRESEYVKNNTYTVIMLVTDDGVSVGTG 96 >d1uf2a_ e.28.1.2 (A:) RDV p3 {Rice dwarf virus [TaxId: 10991]} Length = 967 Score = 25.3 bits (55), Expect = 3.1 Identities = 16/78 (20%), Positives = 35/78 (44%), Gaps = 8/78 (10%) Query: 16 IDNTSLSFDQIAEFCGLHLLEVMAIADGESLQGIKGFNLISSGQLSAEEIALGEKDKNYK 75 +DNTS + F GL +I+ E ++ + G ++ + G++ A ++ + K + Sbjct: 779 VDNTSYTDSLSDMFNGLR-----SISSSEFVRSVNGRSVFTEGRIDAIKVNMRAK---FD 830 Query: 76 LKISKPKSYILESTKKKK 93 L+ + + KK Sbjct: 831 LQFITEEGGYSKPPNVKK 848 >d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Length = 70 Score = 25.1 bits (55), Expect = 4.3 Identities = 7/32 (21%), Positives = 13/32 (40%) Query: 106 NAILWLIRNYPRLKDAQISHLVGTTGSTIEQI 137 A+ LI + +S L ++I +I Sbjct: 8 GAVYRLIDQLGPVSRIDLSRLAQLAPASITKI 39 >d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Length = 71 Score = 24.0 bits (52), Expect = 8.0 Identities = 5/34 (14%), Positives = 11/34 (32%) Query: 107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNR 140 + LI + +S ++I +I Sbjct: 10 RVYKLIDQKGPISRIDLSKESELAPASITKITRE 43 >d2yzca2 d.96.1.4 (A:142-297) Urate oxidase (uricase) {Arthrobacter globiformis [TaxId: 1665]} Length = 156 Score = 23.9 bits (52), Expect = 9.6 Identities = 12/44 (27%), Positives = 17/44 (38%) Query: 4 RPLMPKASAVWLIDNTSLSFDQIAEFCGLHLLEVMAIADGESLQ 47 R L SA W + + FD + LL+ A +LQ Sbjct: 39 RILATDVSARWRYNTVEVDFDAVYASVRGLLLKAFAETHSLALQ 82 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.316 0.132 0.383 Gapped Lambda K H 0.267 0.0643 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 687,655 Number of extensions: 29619 Number of successful extensions: 78 Number of sequences better than 10.0: 1 Number of HSP's gapped: 78 Number of HSP's successfully gapped: 17 Length of query: 192 Length of database: 2,407,596 Length adjustment: 80 Effective length of query: 112 Effective length of database: 1,309,196 Effective search space: 146629952 Effective search space used: 146629952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.2 bits)