HHsearch alignment of GI: 254780801 and MMDB domain: 2j66_A_40-274

>2j66_A (A:40-274) BTRK, decarboxylase; butirosin, AHBA biosynthesis, lyase; HET: PLP; 1.65A {Bacillus circulans}
Probab=98.40  E-value=3e-06  Score=62.91  Aligned_cols=167  Identities=9%  Similarity=0.007  Sum_probs=118.4

Q ss_pred             HCEEEEECCCCCHHHHHHHH-HCCCCCCCCCCCHHHHHH-HHCCCCCCCCCEEEECCCCC-CHHHHHCCCCHHCCCCCCC
Q ss_conf             41899871899999999999-729810001210001111-00000125873023024432-0013201110000122222
Q gi|254780801|r   27 SVSLVAVSKMVDSKKIRVAL-SCGQVIFAENKLQEAKKK-WIPLRKEWDVQLRFIGSLQS-NKVSEIVSLFDVIETVSRE  103 (222)
Q Consensus        27 ~v~LiaVtK~~~~e~I~~~~-~~G~~~fGENrvQE~~~K-~~~l~~~~~i~wHfIG~LQs-NKvk~i~~~~~~Ihsvds~  103 (222)
                      .+++.-..|.-|...|...+ +.|. .|==.-..|+..- ...++   .-++.|-|+.-+ .-++.++..-..+=++||.
T Consensus         2 ~~~~~yavKaN~~~~il~~l~~~g~-g~dv~S~~El~~al~~G~~---~~~ii~~g~~k~~~~l~~a~~~g~~~i~iDs~   77 (235)
T 2j66_A            2 AIQFYLSLKANNNIHLAKLFRQWGL-GVEVASAGELALARHAGFS---AENIIFSGPGKKRSELEIAVQSGIYCIIAESV   77 (235)
T ss_dssp             TEEEEEEGGGCCCHHHHHHHHHTTC-EEEESSHHHHHHHHHTTCC---GGGEEECCSCCCHHHHHHHHHHTCSEEEECSH
T ss_pred             CCEEEEEECCCCCHHHHHHHHHCCC-CEEEECHHHHHHHHHCCCC---HHHEEECCCCCCCCCCCCCCCCCEEEEECCCH
T ss_conf             9779999742799999999998199-4897599999999984998---78833033334432112211266226631312


Q ss_pred             CHHHHHHHHHHHHCCCEEEEEEEECC-----------CCCCCCCCCCCHHHHHHHHHHCCCCCCHHHHEE-CCCCCCCCH
Q ss_conf             00134433333311430368897004-----------665634657000122234431043110011101-154334520
Q gi|254780801|r  104 KTASLLSLEMIKQSRFLPVYIQVNTG-----------YEIQKSGIMPNQTKDFVILCRQKYQLNVEGLMC-IPPAMGNPK  171 (222)
Q Consensus       104 ~~a~~L~~~~~~~~~~~~vliQVN~~-----------~e~~K~G~~p~el~~l~~~i~~~~~L~i~GLMt-i~p~~~d~~  171 (222)
                      ..++.|...+.+.++..++.|-||++           +.++|+|++++++.++++.+...+++++.||.+ +++...|+.
T Consensus        78 ~el~~i~~~a~~~~~~~~i~lRin~~~~~~~~~~~~~~~~skFGi~~~~~~~~~~~~~~~~~~~l~GlH~H~gs~~~~~~  157 (235)
T 2j66_A           78 EELFYIEELAEKENKTARVAIRINPDKSFGSTAIKMGGVPRQFGMDESMLDAVMDAVRSLQFTKFIGIHVYTGTQNLNTD  157 (235)
T ss_dssp             HHHHHHHHHHHHHTCCEEEEEEEECSSCC--CCCSSSCCCCSSSEEGGGHHHHHHHHHHCTTEEEEEEECCCCSCBCCHH
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCH
T ss_conf             67788777887538752112222235442211122466764443210046889998765312443121000023642201


Q ss_pred             ---HHHHHHHHH----HHH--CCCCEECC--CCCHHH
Q ss_conf             ---589999999----887--58947224--777348
Q gi|254780801|r  172 ---PHFYLLSEI----ARE--CKLTKLSM--GMTRDF  197 (222)
Q Consensus       172 ---~~F~~l~~l----~~~--~~~~~LSm--GMS~D~  197 (222)
                         ..+..+.++    ..+  ..+..+++  |+..+|
T Consensus       158 ~~~~~~~~~~~~~~~l~~~~~~~~~~id~GGG~~~~y  194 (235)
T 2j66_A          158 SIIESMKYTVDLGRNIYERYGIVCECINLGGGFGVPY  194 (235)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCCCCSEEECCCCBCCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCC
T ss_conf             2999999989998767763287643554136643454