HHsearch results for GI: 254780801 and protein with PDBid: 1w8g_A

>1w8g_A YGGS, hypothetical UPF0001 protein YGGS; structural genomics, hypothetical protein, putative enzyme with PLP-binding domain; HET: PLP ICT; 2.0A {Escherichia coli}
Probab=100.00  E-value=0  Score=585.55  Aligned_cols=221  Identities=32%  Similarity=0.433  Sum_probs=207.6

Q ss_pred             CC-HHHHHHHHHHHHHHHHHHCCCCHHHCEEEEECCCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCCC--CCCCEE
Q ss_conf             99-899999999999999998198964418998718999999999997298100012100011110000012--587302
Q gi|254780801|r    1 MS-LGNKLQVFKQKIENSAILAKRPKDSVSLVAVSKMVDSKKIRVALSCGQVIFAENKLQEAKKKWIPLRKE--WDVQLR   77 (222)
Q Consensus         1 M~-i~~nl~~i~~~I~~a~~~~gR~~~~v~LiaVtK~~~~e~I~~~~~~G~~~fGENrvQE~~~K~~~l~~~--~~i~wH   77 (222)
                      |+ |++||..|+++|++||.++||+|++|+|||||||+|+++|.++|++|+++||||||||+.+|+..|+..  ++++||
T Consensus         1 M~~i~~nl~~I~~~I~~a~~~~gR~~~~V~LiaVsK~~~~e~I~~a~~~G~r~fGENrvQE~~~K~~~l~~~~~~~i~WH   80 (234)
T 1w8g_A            1 MNDIAHNLAQVRDKISAAATRCGRSPEEITLLAVSKTKPASAIAEAIDAGQRQFGENYVQEGVDKIRHFQELGVTGLEWH   80 (234)
T ss_dssp             --CHHHHHHHHHHHHHHHHHHTTCCGGGCEEEEECTTSCHHHHHHHHHTTCCEEEESSHHHHHHHHHHHHHTTCCSCEEE
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             91799999999999999999809996876999998998999999999869971468741899999999875158880699


Q ss_pred             EECCCCCCHHHHHCCCCHHCCCCCCCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCH
Q ss_conf             30244320013201110000122222001344333333114303688970046656346570001222344310431100
Q gi|254780801|r   78 FIGSLQSNKVSEIVSLFDVIETVSREKTASLLSLEMIKQSRFLPVYIQVNTGYEIQKSGIMPNQTKDFVILCRQKYQLNV  157 (222)
Q Consensus        78 fIG~LQsNKvk~i~~~~~~Ihsvds~~~a~~L~~~~~~~~~~~~vliQVN~~~e~~K~G~~p~el~~l~~~i~~~~~L~i  157 (222)
                      |||||||||+|+++++||+||||||+++|++|++++.+.+++++||||||+++|++|+||.|+++.++++.+..+++|++
T Consensus        81 fIG~LQsNKvk~iv~~~~~IhSVDs~kla~~l~~~~~~~~~~~~vliQVNis~E~~K~G~~p~e~~~~~~~~~~~~~l~~  160 (234)
T 1w8g_A           81 FIGPLQSNKSRLVAEHFDWCHTIDRLRIATRLNDQRPAELPPLNVLIQINISDENSKSGIQLAELDELAAAVAELPRLRL  160 (234)
T ss_dssp             ECSCCCGGGHHHHHHHCSEEEEECSHHHHHHHHHHSCTTSCCEEEEEEECCSCTTCCCSBCGGGHHHHHHHHHTCTTEEE
T ss_pred             EECCCCHHHHHHHCCCCCEEHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCE
T ss_conf             82574101276613321101031027799999854354268751899981377656678527779999999986799756


Q ss_pred             HHHEECCCCCCCCHHHHHHHHHH---HHHC-----CCCEECCCCCHHHHHHHHHCCCEEEECHHHCCCCCCC
Q ss_conf             11101154334520589999999---8875-----8947224777348999980898899711323899999
Q gi|254780801|r  158 EGLMCIPPAMGNPKPHFYLLSEI---AREC-----KLTKLSMGMTRDFELAIASGATSVRIGSGIFGERPCQ  221 (222)
Q Consensus       158 ~GLMti~p~~~d~~~~F~~l~~l---~~~~-----~~~~LSmGMS~D~~~Ai~~Gst~vRiGs~iFG~R~~~  221 (222)
                      +|||||||.++|+.+.|..++++   .+++     ++++||||||+||++||++|||||||||+|||+|+|.
T Consensus       161 ~GLMti~~~~~d~~~~~~~~~~l~~~~~~~~~~~~~~~~LSMGMS~D~~~AI~~GsT~VRiGsaiFG~R~y~  232 (234)
T 1w8g_A          161 RGLMAIPAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLSLGMSDDMEAAIAAGSTMVRIGTAIFGARDYS  232 (234)
T ss_dssp             EEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHSTTCCEEECCCGGGHHHHHHHTCSEEEESHHHHCC----
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCEECCCCHHHHHHHHHCCCCEEECCCCCCCCCCCC
T ss_conf             788643798402789999999999999998732799896677206359999986999698187424699999