HHsearch alignment for GI: 254780802 and conserved domain: KOG0437

>KOG0437 consensus.
Probab=98.34  E-value=9.3e-08  Score=71.14  Aligned_cols=150  Identities=16%  Similarity=0.260  Sum_probs=87.1

Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCHHHHCCCCCCCCCCCCCHHHHHHHHHHCCC---------
Q ss_conf             21110001112211232222234223334684634742000111001000224542100245642110136---------
Q gi|254780802|r  423 RKINFRLRDWCISRQRSWGCPIPVIHCQKCGIVELPKEDLPVQLPEDLDFTLPGNPLENHPTWKKIFCVKC---------  493 (869)
Q Consensus       423 ~~~~~~l~DW~ISRqr~WG~piPv~~~~~~~~~~~~~~~l~v~~~~d~~~~~~~~~l~~~~~~~~~~~~~~---------  493 (869)
T Consensus       559 E~tLdWL~~wacsRsyGLGTrlP-W---------------------D~qyLv--ESLSDSTIYmAyYTvaHll~~d~~g~  614 (1080)
T KOG0437         559 EDTLDWLGQWACSRSYGLGTRLP-W---------------------DEQYLV--ESLSDSTIYMAYYTVAHLLHRDLYGK  614 (1080)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCC-C---------------------CHHHHH--HHCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             88889987510120116777788-7---------------------678887--76031289999999999987764067


Q ss_pred             -CCCCCCCCCCCCCCCCCCCCCCCCCCC--------CCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHHHHCCCC
Q ss_conf             -764435643234566643332233555--------65441013566411433440145554433202345553201347
Q gi|254780802|r  494 -GSEALRETDTMDTFVDSSWYYMRYMTP--------HAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKI  564 (869)
Q Consensus       494 -~~~~~r~~dvld~w~dS~~~~~~~~~~--------~~~~~~~~e~~~~~~P~D~~i~g~d~~~~~~~~~r~~~~~l~~~  564 (869)
T Consensus       615 ~~~plgi~~---~QMtdeVwdYvF~~~~~~k~t~i~~e~L~~lr~eF~Y~YPiDlrvsGKDLi~NHLtfflynHvAl~~~  691 (1080)
T KOG0437         615 VEGPLGIKP---DQMTDEVWDYVFLNEPYPKNTAIPEEALSNLRREFEYFYPIDLRVSGKDLIPNHLTFFLYNHVALFPE  691 (1080)
T ss_pred             CCCCCCCCH---HHCCHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCEEEEEEEHHHHCCC
T ss_conf             766577894---65478988786506998767784099999999763100301344234213523136755400231540


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCHHHC
Q ss_conf             87322320022223553232243323587001306202210
Q gi|254780802|r  565 GYIEIDEPFKRLFTQGMVVHETYYQLEGIKKKYLKPDEVIL  605 (869)
Q Consensus       565 g~~~~~~pf~~l~~~G~v~~~~~~~~~~~~~~~~~p~~~~~  605 (869)
T Consensus       692 k----~WP-kgiraNGHLmL-NsEKMSKSTGNfmTL~qaie  726 (1080)
T KOG0437         692 K----KWP-KGIRANGHLML-NSEKMSKSTGNFMTLEQAIE  726 (1080)
T ss_pred             C----CCC-CCCCCCCEEEE-CCHHCCCCCCCEEEHHHHHH
T ss_conf             0----286-53111766773-31220545677245999898