HHsearch alignment for GI: 254780802 and conserved domain: PRK05729

>PRK05729 valS valyl-tRNA synthetase; Reviewed.
Probab=100.00  E-value=0  Score=1252.01  Aligned_cols=636  Identities=27%  Similarity=0.469  Sum_probs=510.8

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             87656899989999999985980367678888389980778978987400477977899999977718985567688140
Q gi|254780802|r    3 TRSYSPQETDSIWQSAWYDSNIFKAENGKNKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDA   82 (869)
Q Consensus         3 ~~~y~~~~iE~kwq~~W~~~~~fe~~~~~~~~kf~i~~~pPy~nG~lHiGH~~~~t~~Dv~aRy~rm~G~~Vl~~~G~d~   82 (869)
T Consensus         4 ~~~Y~~~~iE~k~~~~W~~~~~f~~~~~~~~~~f~~~~pPP~~~G~lHiGHa~~~~i~D~i~Ry~rm~G~~V~~~pG~D~   83 (877)
T PRK05729          4 PKTYDPKEVEAKWYQKWEEKGYFKPDGDKSKKPFSIVIPPPNVTGSLHMGHALNNTLQDILIRYKRMQGYNTLWLPGTDH   83 (877)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             57899399999999999857997378778999779972889887986121667488999999998727996688898688


Q ss_pred             CCHHHHHHHHHH----CC------------CHHHHHHHHHHHHHHHHHHCCCEEECCCCEECCCHHHHHHHHHHHHHHHH
Q ss_conf             205899999980----99------------99999999999999999981917664698214773599999999999998
Q gi|254780802|r   83 FGMPAENAAREH----NV------------HPKMWTYQNIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMK  146 (869)
Q Consensus        83 ~GlPie~~~~e~----~~------------~~~~~~~~~i~~~k~~~~~lG~~~DW~r~y~T~d~~y~~~v~w~f~~L~~  146 (869)
T Consensus        84 ~Gl~~e~~vek~l~~~g~~~~~~~re~f~~~~~~w~~~~~~~i~~q~~rlG~s~Dw~~~~~T~d~~~~~~v~~~F~~L~~  163 (877)
T PRK05729         84 AGIATQMVVERQLAAEGKTRHDLGREKFLEKVWEWKEESGGTITNQLRRLGASVDWSRERFTMDEGLSKAVREVFVRLYE  163 (877)
T ss_pred             CCCHHHHHHHHHHHHCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEECCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             86056899999998749983544899999999999999999999999982860335898455898899999999999998


Q ss_pred             CCCEEECCEEEECCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89634122133214776767789898438533456432233475233430344454432100225543222221000145
Q gi|254780802|r  147 HNVIVRKTAQVNWDPVEQTVLANEQVINGRGWRSDAPVEQRSLPQWFFKISDLSQELLDSIETLSEWPEKVKIMQKNWIG  226 (869)
Q Consensus       147 kGliyrg~~pV~wcp~~~t~la~~Ev~~g~~~~~~~~v~~~~~~~~~~~~~~~~~~l~~~~~~l~~~p~~v~~~~~~~i~  226 (869)
T Consensus       164 kGliyr~~~~V~wcp~~~Tals~~EV~~~~~----------~~~~~~---------------------------------  200 (877)
T PRK05729        164 KGLIYRGKRLVNWDPKLQTALSDLEVEYKEV----------KGKLWH---------------------------------  200 (877)
T ss_pred             CCCEEECCEECCCCCCCCCHHHHHHHHCCCC----------CCCEEE---------------------------------
T ss_conf             8997841312366887788435678732456----------673389---------------------------------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCEEEEECCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             57675453555677777751365320013444323200330244320345413145899988653111124555430255
Q gi|254780802|r  227 RSEGMEIRWEIVSNTIDQIEEILVYTTRPETIFGASFIAIAVDHSISEKLSCDNTDIKEFCDEEKQKGTSLSVLDKTEKK  306 (869)
Q Consensus       227 ~~~~~~~~~~~~~~~~~~~~~l~~~TtrPeTl~g~~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  306 (869)
T Consensus       201 ------ikf~l~~----~~~~l~i~TTrPeTl~~~~avav~P~dery---------------------------------  237 (877)
T PRK05729        201 ------IRYPLAD----GSDYLVVATTRPETMLGDTAVAVNPEDERY---------------------------------  237 (877)
T ss_pred             ------EECCCCC----CCCEEEEECCCCCCCCCCEEEEECCCCHHH---------------------------------
T ss_conf             ------8413247----887476501685234464578846887488---------------------------------


Q ss_pred             CCCCCCEECCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCH-------
Q ss_conf             3237861037777741577631123454533322211134672110122103544321016776555422211-------
Q gi|254780802|r  307 GIYTGIHVKHPLNPNVVIPVYIANFVFMNYGTGAIFGCPFADQRDMDFAKKYGLPIIPIMKRSINHSQDIEEG-------  379 (869)
Q Consensus       307 ~~~~G~~~~~P~~~~~~ipv~~~~~V~~~~GTG~V~~~P~h~~~D~~~~~k~glpi~~v~~~~~~~~~~~~~~-------  379 (869)
T Consensus       238 ~~l~Gk~~~~P~~~~-~ipii~d~~V~~~~GTG~V~~~Pah~~~D~~~~~~~~L~~~~~id~~G~~~~~~~~~~G~~~~~  316 (877)
T PRK05729        238 KHLIGKKVILPLVGR-EIPIIADEYVDPEFGTGAVKITPAHDFNDFEVGKRHNLPMINIMDEDGTINENAGEYQGLDRFE  316 (877)
T ss_pred             HHHCCCEEEECCCCC-EEEEEECCCCCCCCCCCCEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHCCCCCHHH
T ss_conf             985598898058897-5328715752677784617971689978999887648874346566764045741029970889


Q ss_pred             ------HHCCCCCC------CCCCHHHCC---------------CCHHHHHHHHHHHHHHHCCCCCCHHHHHHH--H--H
Q ss_conf             ------21012334------458300013---------------564665488899997404677520222111--0--0
Q gi|254780802|r  380 ------KAFSGDGI------MINSSFLDG---------------MTNTEALQAVMSHLEKQNIKNSPIGKRKIN--F--R  428 (869)
Q Consensus       380 ------~~~~~~~~------~~~~~~~~g---------------~~~~~~~~~i~~~l~~~~~~~~~~~~~~~~--~--~  428 (869)
T Consensus       317 ar~~Ii~~L~~~g~l~~~~~~~h~~p~~~R~~~pi~~~~~~QWFi~~~~l~~~~l~~~~~~~i~~~P~~~~~~~~~wl~n  396 (877)
T PRK05729        317 ARKAIVADLEELGLLVKIEPHKHSVGHSDRSGVVIEPYLSDQWFVKMKPLAKPALEAVEDGKIKFVPKRWENTYFHWMEN  396 (877)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCEEEEECCCCCEECCCHHHHHHHHHHHCCCCEECCHHHHHHHHHHHHC
T ss_conf             88999999997799774321356787546778569974130100003357999999860588312577888499998605


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCC-CCCCCCCCCCCC
Q ss_conf             0111221123222223422333468463474200011100100022454210024564211013676-443564323456
Q gi|254780802|r  429 LRDWCISRQRSWGCPIPVIHCQKCGIVELPKEDLPVQLPEDLDFTLPGNPLENHPTWKKIFCVKCGS-EALRETDTMDTF  507 (869)
Q Consensus       429 l~DW~ISRqr~WG~piPv~~~~~~~~~~~~~~~l~v~~~~d~~~~~~~~~l~~~~~~~~~~~~~~~~-~~~r~~dvld~w  507 (869)
T Consensus       397 ~~DWcISRqr~WG~piPvw~~~~~~-~~v~~~~-------------------------~~~~~~~~~~~~~~d~DVlDtW  450 (877)
T PRK05729        397 IQDWCISRQLWWGHRIPAWYDEDGE-VYVGRTE-------------------------PEARAKAGSENLTQDEDVLDTW  450 (877)
T ss_pred             CCCCCCCCCCCCCCCEEEEECCCCC-EEECCCH-------------------------HHHHHHCCCCCCEECCCCCCCH
T ss_conf             6555113554468842589918984-8941675-------------------------6644323876525565322334


Q ss_pred             CCCC-CCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             6643-332233555654410135664114334401455544332023455532013478732232002222355323224
Q gi|254780802|r  508 VDSS-WYYMRYMTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKIGYIEIDEPFKRLFTQGMVVHET  586 (869)
Q Consensus       508 ~dS~-~~~~~~~~~~~~~~~~~e~~~~~~P~D~~i~g~d~~~~~~~~~r~~~~~l~~~g~~~~~~pf~~l~~~G~v~~~~  586 (869)
T Consensus       451 FsSgl~p~s~lg~p-----~~~~~~~~~~P~d~~~~G~D--ii~fWv~rm~~~~~~~~~----~~Pfk~v~~hG~v~D~-  518 (877)
T PRK05729        451 FSSALWPFSTLGWP-----DKTPDLKRFYPTSVLVTGFD--IIFFWVARMIMMGLHFTG----QVPFKDVYIHGLVRDE-  518 (877)
T ss_pred             HHCCCCCCCCCCCC-----CCHHHHCCCCCCCCCCCCCC--HHEEEEEEEECCEEEECC----CCCCHHCCCCCEEECC-
T ss_conf             43166664416686-----52054424788754520655--211344444310320112----3761102004437889-


Q ss_pred             CCCCCCCCCEEECCCHHHCCCCCCCCCCCEECCCCEEEECCCCCCHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             33235870013062022102567775441104897064047421000000122221001234633566655301332111
Q gi|254780802|r  587 YYQLEGIKKKYLKPDEVILRNIEGENCAFRLSDNSKVVIGPLEKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPDRD  666 (869)
Q Consensus       587 ~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~g~KMSKSkGNvi~p~~~i~~yGaD~lRl~~~~~~~~~~d  666 (869)
T Consensus       519 ----------------------------------------~G~KMSKS~GNvidP~~vi~~yGaDalR~~l~~~~~~g~d  558 (877)
T PRK05729        519 ----------------------------------------QGRKMSKSKGNVIDPLDLIDKYGADALRFTLAALASPGRD  558 (877)
T ss_pred             ----------------------------------------CCCCCCCCCCCCCCHHHHHHHCCHHHHHHHHHHCCCCCCC
T ss_conf             ----------------------------------------8877878788989989999871919999999970776766


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHC---CC-------CCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHH
Q ss_conf             113432101145567788999997630---24-------66789756999999999999999998816889999999999
Q gi|254780802|r  667 IIWSNKGVDSTYQFIQQIWRLIYNAKD---EL-------QTSSTKKDISLISKSTKFLERIEENYQNLSFNKAVANIHEL  736 (869)
Q Consensus       667 ~~~s~~~i~~~~rfl~kl~~l~~~~~~---~~-------~~~~~~~D~~ils~~~~~i~~v~~~~e~~~f~~ai~~i~~f  736 (869)
T Consensus       559 i~~~~~~v~~~r~f~nKlwN~~rf~~~~~~~~~~~~~~~~~~~~~~D~WIlskL~~~i~~v~~~~~~y~f~~a~~~ly~F  638 (877)
T PRK05729        559 IRFDEERVEGYRNFANKLWNASRFVLMNLEGQDPGFLPDEAELSLADRWILSRLNRTVAEVTEALDKYRFDEAAQALYEF  638 (877)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHH
T ss_conf             00068999999999999999999999724656644456621067879999999999999998750002099999999998


Q ss_pred             H-HHHHHHHHHHCCCCCCCC-------HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCC-CCCEEECCCCCCCHH
Q ss_conf             9-999999986211000221-------799999999999999722343899999998289-983551788665967
Q gi|254780802|r  737 V-NVISKPLMEIAKKKSNAD-------RISTIRYILEKLIIMMSPMIPHLAEECWQLLGN-AGLVAQQKWPKLDPI  803 (869)
Q Consensus       737 ~-n~ls~~y~~~~k~~~~~~-------~~~~l~~vl~~l~~lLaPi~PhiaEEiw~~Lg~-~~~i~~~~WP~~d~~  803 (869)
T Consensus       639 ~w~d~cdwYlE~~K~rl~~~~~~~~~~~~~~L~~vL~~~L~lLhPfmPFitEElwq~L~~~~~si~~~~wP~~~~~  714 (877)
T PRK05729        639 IWNEFCDWYLELAKPVLNGGDEAAKRGTRATLAYVLEEILRLLHPFMPFITEELWQKLAPEGESIMLAPWPEADEA  714 (877)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCC
T ss_conf             4675578999997997708877889999999999999999985601357599999857788974686379999710