HHsearch alignment for GI: 254780802 and conserved domain: PRK05743

>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed.
Probab=100.00  E-value=0  Score=1247.03  Aligned_cols=679  Identities=24%  Similarity=0.365  Sum_probs=521.7

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCCC--CCCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             765689998999999998598036--767888838998077897898740047797789999997771898556768814
Q gi|254780802|r    4 RSYSPQETDSIWQSAWYDSNIFKA--ENGKNKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWD   81 (869)
Q Consensus         4 ~~y~~~~iE~kwq~~W~~~~~fe~--~~~~~~~kf~i~~~pPy~nG~lHiGH~~~~t~~Dv~aRy~rm~G~~Vl~~~G~d   81 (869)
T Consensus        17 mr~n~~~~E~~~~~~W~~~~~y~~~~~~~~~~~~f~l~dgPPyanG~lH~GHaln~tlkDii~Rykrm~G~~v~~~pGwD   96 (910)
T PRK05743         17 MRGNLPKREPEILKRWEENDLYQKIREANKGKPKFILHDGPPYANGDIHIGHALNKILKDIIVKSKTMSGFDAPYVPGWD   96 (910)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             88895777499999998779076678616998977982799998986424477878999999999875899679999658


Q ss_pred             CCCHHHHHHHHHHC-------------CCHHHHHHHHHHHHHHHHHHCCCEEECCCCEECCCHHHHHHHHHHHHHHHHCC
Q ss_conf             02058999999809-------------99999999999999999998191766469821477359999999999999889
Q gi|254780802|r   82 AFGMPAENAAREHN-------------VHPKMWTYQNIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHN  148 (869)
Q Consensus        82 ~~GlPie~~~~e~~-------------~~~~~~~~~~i~~~k~~~~~lG~~~DW~r~y~T~d~~y~~~v~w~f~~L~~kG  148 (869)
T Consensus        97 ~hGLPiE~~v~k~~g~~~~~~~~~~f~~~cr~~a~~~i~~~~~q~~rlG~~~DW~~~y~T~d~~y~~~~~~~F~~l~ekG  176 (910)
T PRK05743         97 CHGLPIELKVEKKLGKKRKKLSAAEFRKKCREYALEQVDIQREDFKRLGVLGDWDNPYLTMDFEYEANIIRVLGKMAKKG  176 (910)
T ss_pred             CCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCEEEECCCCEECCCHHHHHHHHHHHHHHHHCC
T ss_conf             68699999999961998131999999999999999999999999997190264589726689889999999999999869


Q ss_pred             CEEECCEEEECCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             63412213321477676778989843853345643223347523343034445443210022554322222100014557
Q gi|254780802|r  149 VIVRKTAQVNWDPVEQTVLANEQVINGRGWRSDAPVEQRSLPQWFFKISDLSQELLDSIETLSEWPEKVKIMQKNWIGRS  228 (869)
Q Consensus       149 liyrg~~pV~wcp~~~t~la~~Ev~~g~~~~~~~~v~~~~~~~~~~~~~~~~~~l~~~~~~l~~~p~~v~~~~~~~i~~~  228 (869)
T Consensus       177 liYr~~kpV~Wcp~~~TaLA~~EVey~d----------~~s~si~v~f--------------------------------  214 (910)
T PRK05743        177 YLYKGLKPVYWSPDCGSALAEAEVEYHD----------KTSPSIYVAF--------------------------------  214 (910)
T ss_pred             CEEECCCCCEECCCCCCCCCCHHEECCC----------EECCEEEEEE--------------------------------
T ss_conf             9685782320489999440010100577----------5432599998--------------------------------


Q ss_pred             CCCCCCCCCCCCC----CCCCCEEEEEEECCCCCCCCCEEEEECCCCCCHHHHHCCHHH-HHHHHHHHHH-HHHHHHHHH
Q ss_conf             6754535556777----777513653200134443232003302443203454131458-9998865311-112455543
Q gi|254780802|r  229 EGMEIRWEIVSNT----IDQIEEILVYTTRPETIFGASFIAIAVDHSISEKLSCDNTDI-KEFCDEEKQK-GTSLSVLDK  302 (869)
Q Consensus       229 ~~~~~~~~~~~~~----~~~~~~l~~~TtrPeTl~g~~~i~v~~~~~~~~~~~~~~~~~-~~~~~~~~~~-~~~~~~~~~  302 (869)
T Consensus       215 -------~l~~~~~~~~~~~~~~~~iwTTtPwTl~~n~avav~p~~~Y~~~~~~~~~iva~~l~~~~~~~~~~~~~~~~~  287 (910)
T PRK05743        215 -------PVVDGKAGLDGLKDASLVIWTTTPWTLPANQAIAVHPELDYALVEVGEKLILAKDLVESVLKRLGWEDYEVLA  287 (910)
T ss_pred             -------EECCCCCCCCCCCCCEEEEEECCHHHHHCCCEEEECCCCCEEECCCCCEEEEHHHHHHHHHHHHCCCCEEEEE
T ss_conf             -------9437633334567743999708840342064688778750564036745541998999999984774306653


Q ss_pred             HCCCCCCCCCEECCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCH---
Q ss_conf             02553237861037777741577631123454533322211134672110122103544321016776555422211---
Q gi|254780802|r  303 TEKKGIYTGIHVKHPLNPNVVIPVYIANFVFMNYGTGAIFGCPFADQRDMDFAKKYGLPIIPIMKRSINHSQDIEEG---  379 (869)
Q Consensus       303 ~~~~~~~~G~~~~~P~~~~~~ipv~~~~~V~~~~GTG~V~~~P~h~~~D~~~~~k~glpi~~v~~~~~~~~~~~~~~---  379 (869)
T Consensus       288 ~~~G~~L~g~~~~~P~~~-~~~pii~~d~V~~~~GTG~Vh~aPaHg~~D~~~~~~~~L~~~~~vd~~G~~~~~~~~~~G~  366 (910)
T PRK05743        288 TFKGAELEGLVAQHPFYD-RDSPVILGDHVTLDAGTGLVHTAPGHGEDDYVVGQKYGLEVLNPVDDDGVYTEEAPLFAGL  366 (910)
T ss_pred             EEECCEECCCEEECCCCC-CEEEEEECCCCCCCCCCCEEEECCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             220535037689767789-6522784473267777611885787984367788764998654458776343677445883


Q ss_pred             ----------------HHCCCCCCCCCCHHHCCCCH-----------------HHHHHHHHHHHHHHCCCCCCHHHHHHH
Q ss_conf             ----------------21012334458300013564-----------------665488899997404677520222111
Q gi|254780802|r  380 ----------------KAFSGDGIMINSSFLDGMTN-----------------TEALQAVMSHLEKQNIKNSPIGKRKIN  426 (869)
Q Consensus       380 ----------------~~~~~~~~~~~~~~~~g~~~-----------------~~~~~~i~~~l~~~~~~~~~~~~~~~~  426 (869)
T Consensus       367 ~v~~a~~~Ii~~L~~~g~L~~~~~~~Hsyp~cwR~~~Pvi~rat~QWFi~~d~~~~r~~~l~~i~~v~~~P~-~~~~r~~  445 (910)
T PRK05743        367 FVFKANPKIIELLEEKGALLKLEKITHSYPHCWRTKKPIIFRATPQWFISMDKKTLREQALKAIEKVKWIPS-WGKNRIE  445 (910)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEECCCCCCCEEEECCHHHHHCCCHHHHHHHHHHHHHCCEECH-HHHHHHH
T ss_conf             499889999999987798543421013675332668862676310034234718899999999984674151-6787999


Q ss_pred             HHC---CCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCC------CHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             000---111221123222223422333468463474200------01110010002245421002456421101367644
Q gi|254780802|r  427 FRL---RDWCISRQRSWGCPIPVIHCQKCGIVELPKEDL------PVQLPEDLDFTLPGNPLENHPTWKKIFCVKCGSEA  497 (869)
Q Consensus       427 ~~l---~DW~ISRqr~WG~piPv~~~~~~~~~~~~~~~l------~v~~~~d~~~~~~~~~l~~~~~~~~~~~~~~~~~~  497 (869)
T Consensus       446 ~~i~~r~DWcISRQR~WG~PIPv~~~~~~~~~~~~~~~~~~i~~~~~~~G~d~w~~~~~~------~~--l~~~~~~~~~  517 (910)
T PRK05743        446 SMVENRPDWCISRQRTWGVPIPIFYHKETGELHRTPELIEHVAKLFEKEGIDAWFELDAK------EL--LPEGYPADQY  517 (910)
T ss_pred             HHHHCCCCCEEECCCCCCCCEEEEEECCCCEECCCHHHHHHHHHHHHHCCCCCCCCCCHH------HH--CCCCCCCHHE
T ss_conf             997079886252135668822599978997004768889999998875076411239998------83--7898983100


Q ss_pred             CCCCCCCCCCCCCC--CCCCCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHHHHCCCCCC-CCCCCCCC
Q ss_conf             35643234566643--3322335556544101356641143344014555443320234555320134787-32232002
Q gi|254780802|r  498 LRETDTMDTFVDSS--WYYMRYMTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKIGY-IEIDEPFK  574 (869)
Q Consensus       498 ~r~~dvld~w~dS~--~~~~~~~~~~~~~~~~~e~~~~~~P~D~~i~g~d~~~~~~~~~r~~~~~l~~~g~-~~~~~pf~  574 (869)
T Consensus       518 ~r~~DvlD~WFdSGss~~~~~-----------~~~~~~~~PaDly~eG~Dq~-------RgWF~s~ll~s~~~~~~~Pfk  579 (910)
T PRK05743        518 EKETDILDVWFDSGSTHAAVL-----------EDRERLGYPADLYLEGSDQH-------RGWFQSSLLTSVATNGKAPYK  579 (910)
T ss_pred             EECCCCCCCEECCCCCCHHHC-----------CCCCCCCCCCCEEECCCCHH-------HEEHHHHHHHEEEECCCCCEE
T ss_conf             644755321002798631111-----------46621168432323376522-------102366221224521788841


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEECCCHHHCCCCCCCCCCCEECCCCEEEECCCCCCHHHCCCCCCCCCCCCCCCHHHHH
Q ss_conf             22235532322433235870013062022102567775441104897064047421000000122221001234633566
Q gi|254780802|r  575 RLFTQGMVVHETYYQLEGIKKKYLKPDEVILRNIEGENCAFRLSDNSKVVIGPLEKMSKSKKNVIDPMKVIKSYGADTAR  654 (869)
Q Consensus       575 ~l~~~G~v~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~g~KMSKSkGNvi~p~~~i~~yGaD~lR  654 (869)
T Consensus       580 ~v~~hG~vlD~-----------------------------------------~G~KMSKS~GNvidP~~ii~~yGAD~lR  618 (910)
T PRK05743        580 QVLTHGFTVDG-----------------------------------------KGRKMSKSLGNVIDPQDVIKKYGADILR  618 (910)
T ss_pred             EEEECCEEECC-----------------------------------------CCCCCCCCCCCCCCHHHHHHHCCCHHHH
T ss_conf             79861328989-----------------------------------------8888888787779989998654940999


Q ss_pred             HHHHHCCCCCCCCCCCCCCHH---HHHHHHHHHHHHHHHHHCCCCCC--------CCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             655301332111113432101---14556778899999763024667--------8975699999999999999999881
Q gi|254780802|r  655 LFVLSDSPPDRDIIWSNKGVD---STYQFIQQIWRLIYNAKDELQTS--------STKKDISLISKSTKFLERIEENYQN  723 (869)
Q Consensus       655 l~~~~~~~~~~d~~~s~~~i~---~~~rfl~kl~~l~~~~~~~~~~~--------~~~~D~~ils~~~~~i~~v~~~~e~  723 (869)
T Consensus       619 lwvas-~d~~~d~~~s~~il~~~~~~yrKi~Nt~rf~l~nl~~f~~~~~~~~~~~l~~lD~wiL~~l~~~~~~v~~~~~~  697 (910)
T PRK05743        619 LWVAS-TDYSGDVRISDEILKQVAESYRRIRNTLRFLLGNLNDFDPAKDAVPYEELVELDRWALHRLNELQEEIIEAYEN  697 (910)
T ss_pred             HHHHH-CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99872-57434545568999889999999999999998632168832245892446576899999999999999999863


Q ss_pred             CCHHHHHHHHHHHH-HHHHHHHHHHCCCCCCCC---------HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCC-CCCCE
Q ss_conf             68899999999999-999999986211000221---------79999999999999972234389999999828-99835
Q gi|254780802|r  724 LSFNKAVANIHELV-NVISKPLMEIAKKKSNAD---------RISTIRYILEKLIIMMSPMIPHLAEECWQLLG-NAGLV  792 (869)
Q Consensus       724 ~~f~~ai~~i~~f~-n~ls~~y~~~~k~~~~~~---------~~~~l~~vl~~l~~lLaPi~PhiaEEiw~~Lg-~~~~i  792 (869)
T Consensus       698 y~f~~a~~~l~~F~~~dls~~Y~~~~Kdrly~~~~~~~~R~s~q~~L~~vl~~l~~llaPi~Pf~~EEiw~~l~~~~~SV  777 (910)
T PRK05743        698 YDFHKVYQALHNFCSVDLSSFYLDIIKDRLYTDKADSLARRSAQTALYHILEALVRWLAPILSFTAEEIWQYLPEREESV  777 (910)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCE
T ss_conf             55889999999885756879998761244414789849999999999999999999998664699999997388999976


Q ss_pred             EECCCCCCC
Q ss_conf             517886659
Q gi|254780802|r  793 AQQKWPKLD  801 (869)
Q Consensus       793 ~~~~WP~~d  801 (869)
T Consensus       778 ~l~~wp~~~  786 (910)
T PRK05743        778 FLEEWPEGP  786 (910)
T ss_pred             ECCCCCCCC
T ss_conf             826799996