HHsearch alignment for GI: 254780802 and conserved domain: PRK12282

>PRK12282 tryptophanyl-tRNA synthetase II; Reviewed.
Probab=95.61  E-value=0.16  Score=28.30  Aligned_cols=25  Identities=44%  Similarity=0.355  Sum_probs=17.0

Q ss_pred             CCCHHHCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             210000001222210012346335666553
Q gi|254780802|r  629 EKMSKSKKNVIDPMKVIKSYGADTARLFVL  658 (869)
Q Consensus       629 ~KMSKSkGNvi~p~~~i~~yGaD~lRl~~~  658 (869)
T Consensus       195 ~KMSKS~~n~I~L~D-----~~~~I~kKI~  219 (333)
T PRK12282        195 AKMSKSLGNAIYLSD-----SADTIKKKVM  219 (333)
T ss_pred             CCCCCCCCCCEECCC-----CHHHHHHHHH
T ss_conf             010599999621448-----9999999988