HHsearch alignment for GI: 254780802 and conserved domain: PRK12300

>PRK12300 leuS leucyl-tRNA synthetase; Reviewed.
Probab=100.00  E-value=0  Score=1094.88  Aligned_cols=670  Identities=22%  Similarity=0.330  Sum_probs=483.4

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHH------------------------HCCCHHHHHHH
Q ss_conf             740047797789999997771898556768814020589999998------------------------09999999999
Q gi|254780802|r   49 IHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENAARE------------------------HNVHPKMWTYQ  104 (869)
Q Consensus        49 lHiGH~~~~t~~Dv~aRy~rm~G~~Vl~~~G~d~~GlPie~~~~e------------------------~~~~~~~~~~~  104 (869)
T Consensus         1 LH~GH~~~~ti~DiiaRykrM~G~~Vl~p~GwD~~GlPi~~~ae~~~~~~~~~~~~~~~~~~~~~~~i~k~~~~~~~~~~   80 (888)
T PRK12300          1 LHIGHGRTYTIGDIYARYKRMKGYNVLFPMGFHVTGTPILGIAERIAEGDPETIDIYRNLYGIPEEEIEKFKDPEYIVEY   80 (888)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             94055478799999999998079977999988889953899999986044468999877513668888875009999999


Q ss_pred             HHHHHHHHHHHCCCEEECCCCEECCCHHHHHHHHHHHHHHHHCCCEEECCEEEECCCCCCCCCCHHHHHCCCCCCCCCCC
Q ss_conf             99999999998191766469821477359999999999999889634122133214776767789898438533456432
Q gi|254780802|r  105 NIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVNWDPVEQTVLANEQVINGRGWRSDAPV  184 (869)
Q Consensus       105 ~i~~~k~~~~~lG~~~DW~r~y~T~d~~y~~~v~w~f~~L~~kGliyrg~~pV~wcp~~~t~la~~Ev~~g~~~~~~~~v  184 (869)
T Consensus        81 ~~~~~~~q~~rlG~s~DW~re~~T~dp~y~~~v~w~F~kL~ekGliyrg~~~V~WcP~~~T~la~~ev~~~~~~~-----  155 (888)
T PRK12300         81 FSKEAKEAMKRIGYSIDWRREFTTTDPEYSKFIEWQFRKLKEKGLIVKGSHPVGWCPKDENPVGDHDTKDGEEPT-----  155 (888)
T ss_pred             HHHHHHHHHHHHCCEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCEEECCCCCCCCCCCCCHHHCCCCCC-----
T ss_conf             999999999983860636998664888799999999999997799497877867259878482220555087755-----


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCEE
Q ss_conf             23347523343034445443210022554322222100014557675453555677777751365320013444323200
Q gi|254780802|r  185 EQRSLPQWFFKISDLSQELLDSIETLSEWPEKVKIMQKNWIGRSEGMEIRWEIVSNTIDQIEEILVYTTRPETIFGASFI  264 (869)
Q Consensus       185 ~~~~~~~~~~~~~~~~~~l~~~~~~l~~~p~~v~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~l~~~TtrPeTl~g~~~i  264 (869)
T Consensus       156 -~~-----------------------------------------~~~~ikf~------~~~~~l~v~TTrPeTl~g~ta~  187 (888)
T PRK12300        156 -IG-----------------------------------------EYTLIKFE------GDDLILPAATLRPETVFGVTNL  187 (888)
T ss_pred             -EE-----------------------------------------EEEEEEEC------CCCEEEEEEECCHHHHHHHHEE
T ss_conf             -16-----------------------------------------89999971------7982799972680254300003


Q ss_pred             EEECCCCCCHHHHHCCHHH--HHHHHHHHHHHHHHHHHHHHCCCCCCCCCEECCCCCCCEEEEEEECCCCCCCCCCCCCC
Q ss_conf             3302443203454131458--99988653111124555430255323786103777774157763112345453332221
Q gi|254780802|r  265 AIAVDHSISEKLSCDNTDI--KEFCDEEKQKGTSLSVLDKTEKKGIYTGIHVKHPLNPNVVIPVYIANFVFMNYGTGAIF  342 (869)
Q Consensus       265 ~v~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~~~~P~~~~~~ipv~~~~~V~~~~GTG~V~  342 (869)
T Consensus       188 ~v~Pd~~Yv~~~~~~e~~i~~~~~~~~l~~~~~~~~-~~~~~~g~~l~G~~~~~P~~~~-~ipI~~ad~V~~~~GTG~V~  265 (888)
T PRK12300        188 WVNPDAEYVVAEVDGEKWIVSKEAARKLSFQDREVE-IIEEIKGSELIGKKVKNPVTGK-EVPILPAKFVDPDNGTGVVM  265 (888)
T ss_pred             EECCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEE-EEEEECCCEECCEEEECCCCCC-EEEEEECCEECCCCCCCEEE
T ss_conf             777763234564277200899999999862221136-7532026330350898678898-73598614074788977289


Q ss_pred             CCCCCCCCCCHHHHCCCCC------CCCCCCCCCCCCCCCCCHH----------------HCC---CCCCCC-CCHHHCC
Q ss_conf             1134672110122103544------3210167765554222112----------------101---233445-8300013
Q gi|254780802|r  343 GCPFADQRDMDFAKKYGLP------IIPIMKRSINHSQDIEEGK----------------AFS---GDGIMI-NSSFLDG  396 (869)
Q Consensus       343 ~~P~h~~~D~~~~~k~glp------i~~v~~~~~~~~~~~~~~~----------------~~~---~~~~~~-~~~~~~g  396 (869)
T Consensus       266 ~vPaHd~~Dy~~~~~~~~~~~~~i~ii~v~~~g~~p~~~~~~~~~i~~~~d~~l~~a~~~~y~~e~~~G~l~~~~~~~~G  345 (888)
T PRK12300        266 SVPAHAPYDYVALRDLDVEEIELIPLIKVEGYGEFPAKEIVEKMGIKSQKDPELEEATKELYKAEFHKGVLREDTGEYAG  345 (888)
T ss_pred             ECCCCCHHHHHHHHHCCCCCCCCCCCEEECCCCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCEECCCCHHCCC
T ss_conf             65789877899998607242467772320566775277777750776644234777766542223117534156511069


Q ss_pred             CCHHHHHHHHHHHHHHHCCCC-------------------------CCH---H----HH-------HHH-----------
Q ss_conf             564665488899997404677-------------------------520---2----22-------111-----------
Q gi|254780802|r  397 MTNTEALQAVMSHLEKQNIKN-------------------------SPI---G----KR-------KIN-----------  426 (869)
Q Consensus       397 ~~~~~~~~~i~~~l~~~~~~~-------------------------~~~---~----~~-------~~~-----------  426 (869)
T Consensus       346 ~~v~eA~~~i~~~L~~~g~~~~~y~~~~~~v~~R~g~~~v~~~~~dQWFi~~~~~~~k~~~~~~~~~i~~~P~~~~~~~~  425 (888)
T PRK12300        346 KPVREAREKITEDLIESGIAEIMYEFSEKPVYCRCGTECVVKVVKDQWFIDYSNPEWKELAHKCLDRMRIIPEEARAEFE  425 (888)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCEEECCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCEEECCHHHHHHH
T ss_conf             79999999999999977997403035778867899986763416876410478767789999876166565721345578


Q ss_pred             ---HHCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCC-CCCCCCC
Q ss_conf             ---000111221123222223422333468463474200011100100022454210024564211013676-4435643
Q gi|254780802|r  427 ---FRLRDWCISRQRSWGCPIPVIHCQKCGIVELPKEDLPVQLPEDLDFTLPGNPLENHPTWKKIFCVKCGS-EALRETD  502 (869)
Q Consensus       427 ---~~l~DW~ISRqr~WG~piPv~~~~~~~~~~~~~~~l~v~~~~d~~~~~~~~~l~~~~~~~~~~~~~~~~-~~~r~~d  502 (869)
T Consensus       426 ~~l~~l~DW~iSRqr~wGtpiP-wd~--~~~iesl~--------dstiy~~~yt------~--~~~~~~~~~~~~~l~~~  486 (888)
T PRK12300        426 NKIDWLKDRACARRRGLGTPLP-WDE--RWVIESLS--------DSTIYMAYYT------I--AKKIRQYGLDPEQLTPE  486 (888)
T ss_pred             HHHHCCCCCCCCCCCCCCCCCC-CCC--CEEEECCC--------CCCCHHHHHH------H--HHHHHCCCCCHHHCCCH
T ss_conf             7761468865456667697887-048--82342277--------7640010246------8--78763348995675810


Q ss_pred             CCCCCCCCCCCC----CCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             234566643332----2335556544101356641143344014555443320234555320134787322320022223
Q gi|254780802|r  503 TMDTFVDSSWYY----MRYMTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKIGYIEIDEPFKRLFT  578 (869)
Q Consensus       503 vld~w~dS~~~~----~~~~~~~~~~~~~~e~~~~~~P~D~~i~g~d~~~~~~~~~r~~~~~l~~~g~~~~~~pf~~l~~  578 (869)
T Consensus       487 ~~d~v~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~wyP~D~~~~G~D~i~~hl~f~~~~~~aif~~~~----~p-k~v~~  561 (888)
T PRK12300        487 FFDYVFLGKGDPEEISKKTGIPKEILEEMREEFEYWYPLDWRHSGKDLIPNHLTFFIFNHVAIFPEEK----WP-RGIVV  561 (888)
T ss_pred             HCCEEECCCCCHHHHHHHHCCCHHHHHHHHHHHCEECCCCCCCCCEEHHHHHHHHHHHHHHHHHCCCC----CC-CEEEE
T ss_conf             13043148997666666519988899986886464267601435310335679999988688717777----88-75798


Q ss_pred             CCCCCCCCCCCCCCCCCEEECCCHHHCCCCCCCCCCCEECCCCEEEECCCCCCHHHCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             55323224332358700130620221025677754411048970640474210000001222210012346335666553
Q gi|254780802|r  579 QGMVVHETYYQLEGIKKKYLKPDEVILRNIEGENCAFRLSDNSKVVIGPLEKMSKSKKNVIDPMKVIKSYGADTARLFVL  658 (869)
Q Consensus       579 ~G~v~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~g~KMSKSkGNvi~p~~~i~~yGaD~lRl~~~  658 (869)
T Consensus       562 ~G~Vl~------------------------------------------eG~KMSKSkGNvV~P~eiI~~YGADalRl~l~  599 (888)
T PRK12300        562 NGFVLL------------------------------------------EGKKMSKSKGNVLPLREAIEEYGADVVRLYLA  599 (888)
T ss_pred             EEEEEC------------------------------------------CCEECCCCCCCCCCHHHHHHHCCCCHHHHHHH
T ss_conf             328945------------------------------------------98770303489899899997619629999999


Q ss_pred             HCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             01332111113432101145567788999997630246-67897569999999999999999988168899999999999
Q gi|254780802|r  659 SDSPPDRDIIWSNKGVDSTYQFIQQIWRLIYNAKDELQ-TSSTKKDISLISKSTKFLERIEENYQNLSFNKAVANIHELV  737 (869)
Q Consensus       659 ~~~~~~~d~~~s~~~i~~~~rfl~kl~~l~~~~~~~~~-~~~~~~D~~ils~~~~~i~~v~~~~e~~~f~~ai~~i~~f~  737 (869)
T Consensus       600 ~~a~~~~d~~~~~~~v~~~~~~l~~~~~~~~~~~~~~~~~~~~~~D~wils~l~~~i~~v~~~~e~~~f~~a~~~~~~~~  679 (888)
T PRK12300        600 STAELSQDADFREKEAESIRRQLERFYELAVELAEEESEEELRFIDKWLLSRLYSYIKEVTEAMEEFQTRKAIQEIFYNL  679 (888)
T ss_pred             HCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
T ss_conf             71885568645799999999999999999997632677767766789999999999999999998445999999999999


Q ss_pred             HHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCEEECCCCCCCHHHHHCCCCEEEEEEC
Q ss_conf             99999998621100022179999999999999972234389999999828998355178866596786037714989973
Q gi|254780802|r  738 NVISKPLMEIAKKKSNADRISTIRYILEKLIIMMSPMIPHLAEECWQLLGNAGLVAQQKWPKLDPILEVNTDIILPIQVN  817 (869)
Q Consensus       738 n~ls~~y~~~~k~~~~~~~~~~l~~vl~~l~~lLaPi~PhiaEEiw~~Lg~~~~i~~~~WP~~d~~~~~~~~~~~~iqin  817 (869)
T Consensus       680 ~~~~~~Y~~~~~~----~~~~~l~~~l~~~~~LLaP~~PhiaEElW~~Lg~~~sV~~a~wP~~de~~id-~~--------  746 (888)
T PRK12300        680 LNDLRWYLRRGGE----PNNKVLREVIEIWIRLLAPFTPHLAEEIWEKLGGEGFVSLAPWPEPDESKID-EE--------  746 (888)
T ss_pred             HHHHHHHHHHHCC----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCC-HH--------
T ss_conf             9999999987371----8899999999999999604104889999996799983770799999934279-89--------


Q ss_pred             CEEEEEEECCCCCCHHHHHHHHHCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             816679980888899999999974788899846998259998189
Q gi|254780802|r  818 GKKRACITVSMNTDDDFIKKTVLELNVIKNILQGKSPKKIIIISK  862 (869)
Q Consensus       818 gk~r~~i~v~~~~~~~~i~~~~~~~~~i~~~l~~k~~~k~I~v~~  862 (869)
T Consensus       747 ----------~e~~~~~~~~~i~~ir~~~~~~~~~p~~~~i~va~  781 (888)
T PRK12300        747 ----------AELAEEYVKNLIEDIKEIIKVAKINPKRVYIYVAP  781 (888)
T ss_pred             ----------HHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECC
T ss_conf             ----------99999999999999999998619998669999796