HHsearch alignment for GI: 254780802 and conserved domain: PRK12410

>PRK12410 glutamyl-tRNA synthetase; Provisional.
Probab=97.57  E-value=0.00028  Score=47.31  Aligned_cols=87  Identities=17%  Similarity=0.235  Sum_probs=62.2

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCEEE
Q ss_conf             78978987400477977899999977718985567688140205899999980999999999999999999998191766
Q gi|254780802|r   42 FPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENAAREHNVHPKMWTYQNIKVMRKQLQSIGLSID  121 (869)
Q Consensus        42 pPy~nG~lHiGH~~~~t~~Dv~aRy~rm~G~~Vl~~~G~d~~GlPie~~~~e~~~~~~~~~~~~i~~~k~~~~~lG~~~D  121 (869)
T Consensus         5 APSPTG~lHiG~~rtAl~n~l~Ar~--~~G~fiLRIEDtD----------------~~R~~~~~~~~i~~~L~wlGl--~   64 (433)
T PRK12410          5 APSPTGDMHIGNLRAAIFNYIVAKQ--QNEDFIIRIEDTD----------------KERNIEGKDKEILEILNLFGI--S   64 (433)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEEECCCC----------------CCCCCHHHHHHHHHHHHHCCC--C
T ss_conf             9797996427899999999999985--5998999878789----------------998986999999999998599--9


Q ss_pred             CCCCEECCC--HHHHHHHHHHHHHHHHCCCEEE
Q ss_conf             469821477--3599999999999998896341
Q gi|254780802|r  122 WSKDFATCD--VDYYHCQQLLFLDFMKHNVIVR  152 (869)
Q Consensus       122 W~r~y~T~d--~~y~~~v~w~f~~L~~kGliyr  152 (869)
T Consensus        65 wDe~~~QS~R~~~Y~----~~~~~L~~~g~aY~   93 (433)
T PRK12410         65 WDKLVYQSENLKFHR----QMAEKLLSEKKAFA   93 (433)
T ss_pred             CCCCEECCCCHHHHH----HHHHHHHHCCCEEE
T ss_conf             998831257899999----99999998099689