HHsearch alignment for GI: 254780802 and conserved domain: TIGR00392

>TIGR00392 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases . Isoleucyl-tRNA synthetase (6.1.1.5 from EC) is an alpha monomer that belongs to class Ia. The enzyme, isoleucyl-transfer RNA synthetase, activates not only the cognate substrate L-isoleucine but also the minimally distinct L-valine in the first, aminoacylation step. Then, in a second, "editing" step, the synthetase itself rapidly hydrolyzes only the valylated products , as shown from the crystal structures. ; GO: 0000166 nucleotide binding, 0004822 isoleucine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006428 isoleucyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=1310.09  Aligned_cols=715  Identities=24%  Similarity=0.378  Sum_probs=568.1

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCCC--CCCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             88765689998999999998598036--7678888389980778978987400477977899999977718985567688
Q gi|254780802|r    2 ETRSYSPQETDSIWQSAWYDSNIFKA--ENGKNKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMG   79 (869)
Q Consensus         2 ~~~~y~~~~iE~kwq~~W~~~~~fe~--~~~~~~~kf~i~~~pPy~nG~lHiGH~~~~t~~Dv~aRy~rm~G~~Vl~~~G   79 (869)
T Consensus         2 ~~~~~nl~~~E~~~~~~W~~~dif~~~~~~~~~~~~F~lhDGPPYAnG~iHlGHalNKilKDii~Ryk~m~G~~v~~~pG   81 (938)
T TIGR00392         2 FPMRGNLSKREEKILKFWQEKDIFEKVKKRNKDKPEFVLHDGPPYANGAIHLGHALNKILKDIILRYKTMQGYNVTYKPG   81 (938)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEECCCCCC
T ss_conf             88778821257577766778999999998508998358744858767997402556667611232101122500320478


Q ss_pred             CCCCCHHHHHHHHH------------------HCCCHHHHHHHHHHHHHHHHHHCCCEEECCCCEECCCHHHHHHHHHHH
Q ss_conf             14020589999998------------------099999999999999999999819176646982147735999999999
Q gi|254780802|r   80 WDAFGMPAENAARE------------------HNVHPKMWTYQNIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLF  141 (869)
Q Consensus        80 ~d~~GlPie~~~~e------------------~~~~~~~~~~~~i~~~k~~~~~lG~~~DW~r~y~T~d~~y~~~v~w~f  141 (869)
T Consensus        82 WDtHGLPIE~~Vek~lg~~~~~~~~~~~g~E~fr~~Cr~~A~~~~~~q~~~F~rLG~w~Dwe~pY~T~d~~y~~~~w~~l  161 (938)
T TIGR00392        82 WDTHGLPIELKVEKKLGISGKKEIESLEGIEEFREKCREFALKQIEEQREQFQRLGVWGDWENPYKTMDPSYEESQWWLL  161 (938)
T ss_pred             CCCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCEEECCCCCCCCCCCHHHHHHHHHHH
T ss_conf             66578702445640478764000220443899999999999999999998888531202255785067889999999999


Q ss_pred             HHHHHCCCEEECCEEEECCCCCCCCCCHHHHHCCCCCCCCCCCCC-CCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             999988963412213321477676778989843853345643223-3475233430344454432100225543222221
Q gi|254780802|r  142 LDFMKHNVIVRKTAQVNWDPVEQTVLANEQVINGRGWRSDAPVEQ-RSLPQWFFKISDLSQELLDSIETLSEWPEKVKIM  220 (869)
Q Consensus       142 ~~L~~kGliyrg~~pV~wcp~~~t~la~~Ev~~g~~~~~~~~v~~-~~~~~~~~~~~~~~~~l~~~~~~l~~~p~~v~~~  220 (869)
T Consensus       162 ~~~~eKGL~~~~~kpv~WSp~~~TaLAeaE~ey~~~Y~------d~v~dpS~yv~F~~~~~~~~~r--------------  221 (938)
T TIGR00392       162 KELHEKGLLYRGLKPVYWSPRCETALAEAEVEYKEEYK------DNVKDPSIYVKFPVKKDSKTER--------------  221 (938)
T ss_pred             HHHHHCCCEEECCEEECCCCCCCCHHHHHHHCCCCCCC------CCCCCCEEEEEEEEECCCHHHH--------------
T ss_conf             99975242022552211441446702476305887321------5760622889875315612567--------------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCEEEEECCCCCCHHHHHC----CHHH----HHHHHHHHH
Q ss_conf             00014557675453555677777751365320013444323200330244320345413----1458----999886531
Q gi|254780802|r  221 QKNWIGRSEGMEIRWEIVSNTIDQIEEILVYTTRPETIFGASFIAIAVDHSISEKLSCD----NTDI----KEFCDEEKQ  292 (869)
Q Consensus       221 ~~~~i~~~~~~~~~~~~~~~~~~~~~~l~~~TtrPeTl~g~~~i~v~~~~~~~~~~~~~----~~~~----~~~~~~~~~  292 (869)
T Consensus       222 --------h-~~~~---~~~~n~~~~~l~iWTTTPWTLPaN~Aiav~pd~eY~~~~~~~~y~g~~~~~i~a~~L~e~l~~  289 (938)
T TIGR00392       222 --------H-AKVK---LSGVNGLDISLVIWTTTPWTLPANLAIAVHPDFEYALVQLETDYSGKEEYLILAKKLVEKLLN  289 (938)
T ss_pred             --------H-HHHH---CCCCCCCCCEEEEECCCCCHHHHHHHEEECCCEEEEEEEECCCCCCCEEEEEEHHHHHHHHHH
T ss_conf             --------8-8742---687578886899966887144664160114450689998668746631255512567898864


Q ss_pred             -HHH----HHHHHHHHCCCCCCCCCEECCCCCCCEE--------------------EEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             -111----2455543025532378610377777415--------------------776311234545333222111346
Q gi|254780802|r  293 -KGT----SLSVLDKTEKKGIYTGIHVKHPLNPNVV--------------------IPVYIANFVFMNYGTGAIFGCPFA  347 (869)
Q Consensus       293 -~~~----~~~~~~~~~~~~~~~G~~~~~P~~~~~~--------------------ipv~~~~~V~~~~GTG~V~~~P~h  347 (869)
T Consensus       290 ~~g~~h~~~~~e~~~~~kG~~Le~l~Y~hpl~~~~~~~~~m~~~~L~~~~~~~e~~~~v~~gdhVT~~~GTG~VHtAPgh  369 (938)
T TIGR00392       290 KLGVEHDITDYEIIKTFKGSDLEGLEYEHPLYDKVSQLKGMVVEELIERVDEKEGAPVVIGGDHVTTEDGTGIVHTAPGH  369 (938)
T ss_pred             HCCCCCCCCCEEEEEEECCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCEEEEECCEEECCCCCEEEECCCCC
T ss_conf             21553453110786555164416524652665322011563252322310689864489840045468897226878898


Q ss_pred             CCCCCHHHHCCCC--CCCCCCCCCCCCCCCCCC---------H-H--HCC-----------C----------------CC
Q ss_conf             7211012210354--432101677655542221---------1-2--101-----------2----------------33
Q gi|254780802|r  348 DQRDMDFAKKYGL--PIIPIMKRSINHSQDIEE---------G-K--AFS-----------G----------------DG  386 (869)
Q Consensus       348 ~~~D~~~~~k~gl--pi~~v~~~~~~~~~~~~~---------~-~--~~~-----------~----------------~~  386 (869)
T Consensus       370 G~eDy~~g~kygl~~e~~~pvD~~G~y~~~~~~~~G~~v~~~d~~yi~~~~R~V~~Ayd~~An~~I~~~L~~~~~Ll~~e  449 (938)
T TIGR00392       370 GEEDYEIGKKYGLPDEVLSPVDEKGVYTEEVADFKGRFVKDADKDYIIIKGRYVKDAYDDEANKIIIEQLKDKGLLLKAE  449 (938)
T ss_pred             CHHHHHHHHHHCCCCCCCCCCCCCCEECCCCCCCCCCEEEECCCCEEEECCCEEECHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             73289999982898643146687760336677744541664487224543741000433468999999984269778876


Q ss_pred             CCCCCHHHCCC---------------CH--HHHHHHHHHHHHHHCCCCCCHHHHHHHHHC---CCCCCCCCCCCCCCCCC
Q ss_conf             44583000135---------------64--665488899997404677520222111000---11122112322222342
Q gi|254780802|r  387 IMINSSFLDGM---------------TN--TEALQAVMSHLEKQNIKNSPIGKRKINFRL---RDWCISRQRSWGCPIPV  446 (869)
Q Consensus       387 ~~~~~~~~~g~---------------~~--~~~~~~i~~~l~~~~~~~~~~~~~~~~~~l---~DW~ISRqr~WG~piPv  446 (869)
T Consensus       450 ~i~H~YPhcWRtk~P~IYRAt~QWF~~~D~~~~k~~~L~~i~~v~W~P~~~k~~R~~~~~~n~~DWcISRQR~WG~PIP~  529 (938)
T TIGR00392       450 KITHSYPHCWRTKTPVIYRATEQWFIKIDEKKIKDQMLEEIKKVKWVPEWGKEGRFKNWLENRKDWCISRQRYWGVPIPV  529 (938)
T ss_pred             EEECCCCCCCCCCCCEEEECCCCCEEECCHHHHHHHHHHHCCCEEECCCCCCCHHHHHHHHCCCCCEEECCCCCCCCCEE
T ss_conf             65505877077898457204722146635477789999862832761463221467887611676526335625897406


Q ss_pred             CCCCCCCCE--ECCC--CCC---C-HHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC-CCCCCC
Q ss_conf             233346846--3474--200---0-111001000224542100245642110136764435643234566643-332233
Q gi|254780802|r  447 IHCQKCGIV--ELPK--EDL---P-VQLPEDLDFTLPGNPLENHPTWKKIFCVKCGSEALRETDTMDTFVDSS-WYYMRY  517 (869)
Q Consensus       447 ~~~~~~~~~--~~~~--~~l---~-v~~~~d~~~~~~~~~l~~~~~~~~~~~~~~~~~~~r~~dvld~w~dS~-~~~~~~  517 (869)
T Consensus       530 w~~e~~~~~~l~~~gsi~el~~~~~~~~G~~~w~~d~~~~~~---d~~~~~~~~g~~~y~r~~DvlDVWFDSGs~~~A~~  606 (938)
T TIGR00392       530 WYCEDTGEPVLIVVGSIEELEELIEVEKGIDAWFEDLHKDLL---DKITLESGSGGGEYRRVPDVLDVWFDSGSMPYAVL  606 (938)
T ss_pred             EEECCCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCCCCCCC---CCCCCCCCCCCCCEEEECEEEEEECCCCHHHHHHH
T ss_conf             886678832677604089999999987256632223444457---74134588998425871215545114001179986


Q ss_pred             CCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHHHHCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             5556544101356641143344014555443320234555320134787322---3200222235532322433235870
Q gi|254780802|r  518 MTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKIGYIEI---DEPFKRLFTQGMVVHETYYQLEGIK  594 (869)
Q Consensus       518 ~~~~~~~~~~~e~~~~~~P~D~~i~g~d~~~~~~~~~r~~~~~l~~~g~~~~---~~pf~~l~~~G~v~~~~~~~~~~~~  594 (869)
T Consensus       607 ~~-----~~~~~~~~~~~pAD~i~EG~DQ~-------RGWFySsl~~~~~~~nv~~~PYK~Vi~hGF~LDe---------  665 (938)
T TIGR00392       607 HY-----PFENEKFKEVFPADFILEGSDQT-------RGWFYSSLLIGVALFNVGKAPYKNVITHGFTLDE---------  665 (938)
T ss_pred             HC-----CCCCHHHCCCCCCEEEEECCCCC-------CHHHHHHHHHHHHHHCCCCCCCCEEEECCEEECC---------
T ss_conf             32-----32100103578302686033555-------3277999999999870788543634531548857---------


Q ss_pred             CEEECCCHHHCCCCCCCCCCCEECCCCEEEECCCCCCHHHCCCCCCCCCCCC--------CCCHHHHHHHHHHC-CCCCC
Q ss_conf             0130620221025677754411048970640474210000001222210012--------34633566655301-33211
Q gi|254780802|r  595 KKYLKPDEVILRNIEGENCAFRLSDNSKVVIGPLEKMSKSKKNVIDPMKVIK--------SYGADTARLFVLSD-SPPDR  665 (869)
Q Consensus       595 ~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~g~KMSKSkGNvi~p~~~i~--------~yGaD~lRl~~~~~-~~~~~  665 (869)
T Consensus       666 --------------------------------~G~KMSKSlGNvV~P~~v~~G~~N~~~P~yGAD~LRlyv~~~P~~~~~  713 (938)
T TIGR00392       666 --------------------------------KGRKMSKSLGNVVDPEKVINGDENLKLPKYGADILRLYVASSPSDYWE  713 (938)
T ss_pred             --------------------------------CCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCHHHHHHHHHCCCCCHH
T ss_conf             --------------------------------785445325870385997088433588753304877778846874000


Q ss_pred             CCCCCCCCHHHHHH----HHHHHHHHHH--HHHCCCCCCC--------CHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHH
Q ss_conf             11134321011455----6778899999--7630246678--------97569999999999999999988168899999
Q gi|254780802|r  666 DIIWSNKGVDSTYQ----FIQQIWRLIY--NAKDELQTSS--------TKKDISLISKSTKFLERIEENYQNLSFNKAVA  731 (869)
Q Consensus       666 d~~~s~~~i~~~~r----fl~kl~~l~~--~~~~~~~~~~--------~~~D~~ils~~~~~i~~v~~~~e~~~f~~ai~  731 (869)
T Consensus       714 Dl~~~~~~~~~v~~~~~~~~~N~~~Fl~~YanL~~f~p~~~~~~~~~~~~~Drw~L~~l~~l~~~v~~~~e~Y~f~~~~~  793 (938)
T TIGR00392       714 DLRFSDEILKQVAEKYRKIRWNTYRFLLTYANLDKFDPEEKAVAVEKFRELDRWILSRLNSLVEEVNEALEKYNFHKVLR  793 (938)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHH
T ss_conf             22006689999999876889999999999887607787300231120301139999999999999999862632467888


Q ss_pred             HHHHHHH-HHHHHHHHHCCCCCCCC---------HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCC-----------CC
Q ss_conf             9999999-99999986211000221---------799999999999999722343899999998289-----------98
Q gi|254780802|r  732 NIHELVN-VISKPLMEIAKKKSNAD---------RISTIRYILEKLIIMMSPMIPHLAEECWQLLGN-----------AG  790 (869)
Q Consensus       732 ~i~~f~n-~ls~~y~~~~k~~~~~~---------~~~~l~~vl~~l~~lLaPi~PhiaEEiw~~Lg~-----------~~  790 (869)
T Consensus       794 ~l~~F~~~~LS~wY~~~~rdr~y~~~~~~~~rr~~q~tL~~~l~~l~~~lAP~~Ph~ae~~y~~l~~~~~~~l~~~~~~~  873 (938)
T TIGR00392       794 ALQDFIVEELSNWYIRIIRDRLYIEAKDNDKRRAAQTTLYYALLTLVKLLAPILPHTAEEIYQNLKGEKPELLKYEEDEE  873 (938)
T ss_pred             HHHHHHHHHCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHCCCCCCC
T ss_conf             89876312000456666543422578981789999999999999999987011579999998642401022300267877


Q ss_pred             CEEECCCCCCCHHH
Q ss_conf             35517886659678
Q gi|254780802|r  791 LVAQQKWPKLDPIL  804 (869)
Q Consensus       791 ~i~~~~WP~~d~~~  804 (869)
T Consensus       874 sv~~~~~~~~~~e~  887 (938)
T TIGR00392       874 SVHLNDWPEVDEEF  887 (938)
T ss_pred             CCCCCCCCCCCHHH
T ss_conf             50236676631455