HHsearch alignment for GI: 254780802 and conserved domain: TIGR00392

>TIGR00392 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases . Isoleucyl-tRNA synthetase (6.1.1.5 from EC) is an alpha monomer that belongs to class Ia. The enzyme, isoleucyl-transfer RNA synthetase, activates not only the cognate substrate L-isoleucine but also the minimally distinct L-valine in the first, aminoacylation step. Then, in a second, "editing" step, the synthetase itself rapidly hydrolyzes only the valylated products , as shown from the crystal structures. ; GO: 0000166 nucleotide binding, 0004822 isoleucine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006428 isoleucyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=96.34  E-value=0.0055  Score=38.42  Aligned_cols=53  Identities=11%  Similarity=0.166  Sum_probs=36.4

Q ss_pred             HHHHHHHCCCEEECCC-CEECCCHHHHHHHHHHHHHHHHCCCEEECCEEEE---CCC
Q ss_conf             9999998191766469-8214773599999999999998896341221332---147
Q gi|254780802|r  109 MRKQLQSIGLSIDWSK-DFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVN---WDP  161 (869)
Q Consensus       109 ~k~~~~~lG~~~DW~r-~y~T~d~~y~~~v~w~f~~L~~kGliyrg~~pV~---wcp  161 (869)
T Consensus        28 ~~~~~~~~~~F~lhDGPPYAnG~iHlGHalNKilKDii~Ryk~m~G~~v~~~pGWDt   84 (938)
T TIGR00392        28 VKKRNKDKPEFVLHDGPPYANGAIHLGHALNKILKDIILRYKTMQGYNVTYKPGWDT   84 (938)
T ss_pred             HHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEECCCCCCCCC
T ss_conf             998508998358744858767997402556667611232101122500320478665