HHsearch alignment for GI: 254780802 and conserved domain: TIGR00396

>TIGR00396 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases . Leucyl tRNA synthetase (6.1.1.4 from EC) is an alpha monomer that belongs to class Ia. There are two different families of leucyl-tRNA synthetases. This family includes the eubacterial and mitochondrial synthetases. The crystal structure of leucyl-tRNA synthetase from the hyperthermophile Thermus thermophilus has an overall architecture that is similar to that of isoleucyl-tRNA synthetase, except that the putative editing domain is inserted at a different position in the primary structure. This feature is unique to prokaryote-like leucyl-tRNA synthetases, as is the presence of a novel additional flexibly inserted domain . ; GO: 0000166 nucleotide binding, 0004823 leucine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006429 leucyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=1752.89  Aligned_cols=851  Identities=44%  Similarity=0.845  Sum_probs=800.9

Q ss_pred             CCHHHHHHHHHHHHHHCCCCCCCCC--CCCCCEEEEECCCCCCCC-CCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             5689998999999998598036767--888838998077897898-7400477977899999977718985567688140
Q gi|254780802|r    6 YSPQETDSIWQSAWYDSNIFKAENG--KNKKKYFVLEMFPYPSGN-IHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDA   82 (869)
Q Consensus         6 y~~~~iE~kwq~~W~~~~~fe~~~~--~~~~kf~i~~~pPy~nG~-lHiGH~~~~t~~Dv~aRy~rm~G~~Vl~~~G~d~   82 (869)
T Consensus         1 y~~~~IE~KWq~~W~~~~~~~~~~dpi~~~~K~YiL~MFPYPSG~GLH~GHvR~YTItDvl~Ry~r~~GynVLHP~GwDA   80 (916)
T TIGR00396         1 YNHIEIEKKWQQKWAENKTFKTTDDPISNKPKYYILSMFPYPSGAGLHMGHVRNYTITDVLSRYKRMKGYNVLHPMGWDA   80 (916)
T ss_pred             CCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             97000115788873237856520055455786466237879560775016514235764999999862883247667574


Q ss_pred             CCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCEEECCCCEECCCHHHHHHHHHHHHHHHHCCCEEECCEEEECCCC
Q ss_conf             20589999998099999999999999999999819176646982147735999999999999988963412213321477
Q gi|254780802|r   83 FGMPAENAAREHNVHPKMWTYQNIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVNWDPV  162 (869)
Q Consensus        83 ~GlPie~~~~e~~~~~~~~~~~~i~~~k~~~~~lG~~~DW~r~y~T~d~~y~~~v~w~f~~L~~kGliyrg~~pV~wcp~  162 (869)
T Consensus        81 FGLPAEnaAI~~~~~P~~WT~~NI~~m~~Ql~~LGf~yDw~RE~~T~~P~YYkwtQWiF~~Lf~kGLaY~ke~~VNWCP~  160 (916)
T TIGR00396        81 FGLPAENAAIKRGIHPAKWTYENIANMKKQLQALGFSYDWDREIATCDPEYYKWTQWIFLELFEKGLAYVKEATVNWCPN  160 (916)
T ss_pred             CCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCHHCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEEEEECCC
T ss_conf             56425899986489870037899999999999845564411053238887433666888999762852763111330677


Q ss_pred             CCCCCCHHHHH---CC--CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             67677898984---38--533456432233475233430344454432100225-5432222210001455767545355
Q gi|254780802|r  163 EQTVLANEQVI---NG--RGWRSDAPVEQRSLPQWFFKISDLSQELLDSIETLS-EWPEKVKIMQKNWIGRSEGMEIRWE  236 (869)
Q Consensus       163 ~~t~la~~Ev~---~g--~~~~~~~~v~~~~~~~~~~~~~~~~~~l~~~~~~l~-~~p~~v~~~~~~~i~~~~~~~~~~~  236 (869)
T Consensus       161 d~TVLANEqVi~DS~Gna~SwR~~~~Vekk~l~QW~LKIT~YAe~LL~dLe~L~D~WP~~VK~MQrNWIGkS~Gv~~~F~  240 (916)
T TIGR00396       161 DGTVLANEQVIIDSDGNARSWRGGTPVEKKELKQWFLKITAYAEELLNDLEELDDHWPESVKEMQRNWIGKSEGVEITFK  240 (916)
T ss_pred             CCCCCCCHHEEECCCCCCEEECCCCCEEEEECCCCEEHHHHHHHHHHHHHHCCCCCCCHHHHHCCCCCCCEEEEEEEEEE
T ss_conf             78451020301227898532248784466306751011337889854114204678873136404545655520489974


Q ss_pred             CCCC---CCCCCCEEEEEEECCCCCCCCCEEEEECCCCCCHHHHHCCHH--HHHHHHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             5677---777751365320013444323200330244320345413145--89998865311112455543025532378
Q gi|254780802|r  237 IVSN---TIDQIEEILVYTTRPETIFGASFIAIAVDHSISEKLSCDNTD--IKEFCDEEKQKGTSLSVLDKTEKKGIYTG  311 (869)
Q Consensus       237 ~~~~---~~~~~~~l~~~TtrPeTl~g~~~i~v~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~G  311 (869)
T Consensus       241 i~d~clkacn~~e~i~VFTTRPdT~fGvtYlalA~~HpLv~~~~~~~~~~~v~~fi~~~~~~~~~~~~~~~~~k~Gv~tg  320 (916)
T TIGR00396       241 IADHCLKACNKKEKIAVFTTRPDTIFGVTYLALAPEHPLVEKIAKNNPKEEVAAFIKKIAQKSDLERTKETKEKKGVFTG  320 (916)
T ss_pred             ECCCHHHHCCCCCEEEEEECCCCCEEEEEEEEECCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCC
T ss_conf             25731210378751699866863010026576615785899997408467899999998730705555664201464668


Q ss_pred             CEECCCCCCCEEEEEEECCCCCCCCCCC--CCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCC
Q ss_conf             6103777774157763112345453332--22111346721101221035443210167765554222112101233445
Q gi|254780802|r  312 IHVKHPLNPNVVIPVYIANFVFMNYGTG--AIFGCPFADQRDMDFAKKYGLPIIPIMKRSINHSQDIEEGKAFSGDGIMI  389 (869)
Q Consensus       312 ~~~~~P~~~~~~ipv~~~~~V~~~~GTG--~V~~~P~h~~~D~~~~~k~glpi~~v~~~~~~~~~~~~~~~~~~~~~~~~  389 (869)
T Consensus       321 ~~AihPlT~e-~iPiwvAnYVl~~YGTgPsAVMGVPaHDeRDF~FA~~~~Lpi~~Vi~~~~~~~~~~~~~~A~t~~g~~~  399 (916)
T TIGR00396       321 IYAIHPLTGE-KIPIWVANYVLASYGTGPSAVMGVPAHDERDFEFAQKYKLPIKVVIDPADADGKNLKLEQAYTEDGVLV  399 (916)
T ss_pred             CEEECCCCCC-CCCEEEECEEECCCCCCCHHCCCCCCCCCCHHHHHHHCCCCCEEEECCCCCCCCCHHHHHHHHHCCCEE
T ss_conf             6363476776-445576330011578985020358888741279998578971587527776675115667676465221


Q ss_pred             CC------------HHHCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEC
Q ss_conf             83------------000135646654888999974046775202221110001112211232222234223334684634
Q gi|254780802|r  390 NS------------SFLDGMTNTEALQAVMSHLEKQNIKNSPIGKRKINFRLRDWCISRQRSWGCPIPVIHCQKCGIVEL  457 (869)
Q Consensus       390 ~~------------~~~~g~~~~~~~~~i~~~l~~~~~~~~~~~~~~~~~~l~DW~ISRqr~WG~piPv~~~~~~~~~~~  457 (869)
T Consensus       400 ns~tstdGvltkeC~~f~Gl~~~~A~~~I~~~L~~~~~-----gk~~v~YrLRDW~~SRQRYWG~PIPiih~e~g~~~P~  474 (916)
T TIGR00396       400 NSSTSTDGVLTKECGEFNGLNSSEAKEAIIKMLEKEGK-----GKRKVNYRLRDWLFSRQRYWGEPIPIIHCEDGGAVPV  474 (916)
T ss_pred             CCCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHCCC-----CCEEEEEEEECCCEEEECCCCCCCCEEEECCCCCCCC
T ss_conf             68765344101000222377617899999999986388-----5021234653253440002688987788067684244


Q ss_pred             CCCCCCHHHHCCCCCCCCC---CCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC------CCCH
Q ss_conf             7420001110010002245---421002456421101367644356432345666433322335556-54------4101
Q gi|254780802|r  458 PKEDLPVQLPEDLDFTLPG---NPLENHPTWKKIFCVKCGSEALRETDTMDTFVDSSWYYMRYMTPH-AK------DPIN  527 (869)
Q Consensus       458 ~~~~l~v~~~~d~~~~~~~---~~l~~~~~~~~~~~~~~~~~~~r~~dvld~w~dS~~~~~~~~~~~-~~------~~~~  527 (869)
T Consensus       475 ~~~dLPv~LP~~~~~~~~G~~~sPL~~~~~W~~v~~~~~~~~A~RETdTMdtf~~SsWYylRY~~p~~n~~FWPi~~~~d  554 (916)
T TIGR00396       475 PEEDLPVKLPELVNYDGSGTGESPLSRIKEWVNVTCPSCGKPALRETDTMDTFIGSSWYYLRYLDPKNNTNFWPIDQPFD  554 (916)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCC
T ss_conf             34468710750023578889888043074632414788798754337876305777899986035001766687321302


Q ss_pred             HHHHHHCCCHHHHCCCCCCCCCCCHHHHHHHHHCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCC-EEECC-C
Q ss_conf             356641143344014555443320234555320134787322----32002222355323224332358700-13062-0
Q gi|254780802|r  528 KELVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKIGYIEI----DEPFKRLFTQGMVVHETYYQLEGIKK-KYLKP-D  601 (869)
Q Consensus       528 ~e~~~~~~P~D~~i~g~d~~~~~~~~~r~~~~~l~~~g~~~~----~~pf~~l~~~G~v~~~~~~~~~~~~~-~~~~p-~  601 (869)
T Consensus       555 ~e~~~~wlPVD~YiGG~EHAiLHLLY~RF~hK~L~D~g~v~~PaGi~EPFkKL~~QGMVlg~~f~y~~~~g~~~W~~p~d  634 (916)
T TIGR00396       555 KEKAEYWLPVDLYIGGIEHAILHLLYARFFHKFLYDLGLVSTPAGIKEPFKKLINQGMVLGDAFYYKKPNGKRIWVVPAD  634 (916)
T ss_pred             HHHHHHCCCCCEEECCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHCCEEECCCEEECCCCCCEEEEECCC
T ss_conf             78897558844102626899899888899999997457615877665714554200002116134138997367764575


Q ss_pred             HHHCCCCCCCCCCCEECCCCEEEECCCCCCHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             22102567775441104897064047421000000122221001234633566655301332111113432101145567
Q gi|254780802|r  602 EVILRNIEGENCAFRLSDNSKVVIGPLEKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPDRDIIWSNKGVDSTYQFI  681 (869)
Q Consensus       602 ~~~~~~~~~~~~~~~~~~~~~~~~~~g~KMSKSkGNvi~p~~~i~~yGaD~lRl~~~~~~~~~~d~~~s~~~i~~~~rfl  681 (869)
T Consensus       635 ~~~~~d~~~d~~~~~d~~~~~~~~~~~~KMSKSK~N~i~P~e~~~~yGADa~Rlf~mF~~P~~~~L~W~~~g~~G~~RFL  714 (916)
T TIGR00396       635 ELIERDEKGDIKKAKDKSGGELVVVGYEKMSKSKGNGIDPQEIVKKYGADALRLFIMFMGPIAASLEWNESGLEGARRFL  714 (916)
T ss_pred             CEEECCCCCCCCCCEECCCCCEEEEEEEEECCCCCCCCCCHHHHHHCCHHHHHHHHHHCCCHHHCCCCCCCCHHHHHHHH
T ss_conf             16610466786542325888247887776202367988703897404802799999704883141477711101356888


Q ss_pred             HHHHHHHHHHHCCCCC--------------CCCHHHHHHHHHHHHHHHHHHHHHHHCC--HHHHHHHHHHHHHHHHHHHH
Q ss_conf             7889999976302466--------------7897569999999999999999988168--89999999999999999998
Q gi|254780802|r  682 QQIWRLIYNAKDELQT--------------SSTKKDISLISKSTKFLERIEENYQNLS--FNKAVANIHELVNVISKPLM  745 (869)
Q Consensus       682 ~kl~~l~~~~~~~~~~--------------~~~~~D~~ils~~~~~i~~v~~~~e~~~--f~~ai~~i~~f~n~ls~~y~  745 (869)
T Consensus       715 ~RVw~l~~~~~~~~~~~~~avrP~~~~~~~~l~~~~~~~~~~~~~~lk~v~e~~~~~~~~fNT~IS~~M~l~N~L~k~~~  794 (916)
T TIGR00396       715 DRVWNLVKEILGELSGIISAVRPKTELTETALEEAQKELRREVHKFLKKVTEDLEKLELSFNTAISAMMELLNALYKATK  794 (916)
T ss_pred             HHHHHHHHHHCCCHHHEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999998732660002554246100343112304689999999999888753176201355899999999999873102


Q ss_pred             HHCCCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCC-CCCCEEECCCCCCCHHHHHCCC-CEEEEEECCEE--E
Q ss_conf             621100022179999999999999972234389999999828-9983551788665967860377-14989973816--6
Q gi|254780802|r  746 EIAKKKSNADRISTIRYILEKLIIMMSPMIPHLAEECWQLLG-NAGLVAQQKWPKLDPILEVNTD-IILPIQVNGKK--R  821 (869)
Q Consensus       746 ~~~k~~~~~~~~~~l~~vl~~l~~lLaPi~PhiaEEiw~~Lg-~~~~i~~~~WP~~d~~~~~~~~-~~~~iqingk~--r  821 (869)
T Consensus       795 -------~ge~~~~~~e~~~~~~~~L~P~aPhlaeELwe~lg~~~~~~~~~~w~~~D~~~l~~d~k~~iv~~~nGK~my~  867 (916)
T TIGR00396       795 -------DGEDRALYLEYLKGLVTVLSPFAPHLAEELWEKLGSEPSIIKQAKWPKVDETALVEDKKVEIVVQVNGKVMYR  867 (916)
T ss_pred             -------CCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCHHHHHCCHHHCHHHHHCCCEEEEEEEEEEEEEEE
T ss_conf             -------3411588999999899885152016899999985777001544112021246541252058999974268986


Q ss_pred             EEEECCCCCCHHHHHHHHHCCHHHHHHHCCCCCEEEEECCCCEEEEEC
Q ss_conf             799808888999999999747888998469982599981890575779
Q gi|254780802|r  822 ACITVSMNTDDDFIKKTVLELNVIKNILQGKSPKKIIIISKRIVNIVV  869 (869)
Q Consensus       822 ~~i~v~~~~~~~~i~~~~~~~~~i~~~l~~k~~~k~I~v~~klin~vi  869 (869)
T Consensus       868 a~~~v~~~a~e~~~~~~a~~d~~~~~~L~n~~i~Kvi~V~~klvN~v~  915 (916)
T TIGR00396       868 AKITVPKDADEEQVEELAKADEEVKKYLENKTIKKVIYVPGKLVNFVI  915 (916)
T ss_pred             EEEEECCCCCHHHHHHHHHCCHHHHHHHCCCCEEEEEEECCCEEEEEE
T ss_conf             767750678889999997129688985358961799997483898874