HHsearch alignment for GI: 254780802 and conserved domain: TIGR00456

>TIGR00456 argS arginyl-tRNA synthetase; InterPro: IPR001278 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases . Arginyl-tRNA synthetase (6.1.1.19 from EC) has been crystallized and preliminary X-ray crystallographic analysis of yeast arginyl-tRNA synthetase-yeast tRNAArg complexes is available . ; GO: 0000166 nucleotide binding, 0004814 arginine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006420 arginyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=98.42  E-value=6.3e-06  Score=58.56  Aligned_cols=204  Identities=21%  Similarity=0.232  Sum_probs=132.9

Q ss_pred             HHCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCHHHCCCCCCCCCCCEEC
Q ss_conf             40145554433202345553201347873223200222235532322433235870013062022102567775441104
Q gi|254780802|r  539 QYIGGIEHAVLHLLYARFFAHILKKIGYIEIDEPFKRLFTQGMVVHETYYQLEGIKKKYLKPDEVILRNIEGENCAFRLS  618 (869)
Q Consensus       539 ~~i~g~d~~~~~~~~~r~~~~~l~~~g~~~~~~pf~~l~~~G~v~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~  618 (869)
T Consensus       353 i~V~gsdh~-~h~--~q~~-~~~e~LG~~~~~-~~L~~~~f~~v~~~~GKkmkTR~G~~i~ld~ll~-------------  414 (600)
T TIGR00456       353 IYVWGSDHK-LHI--AQVF-AILEKLGYLSKK-KELEHLEFGMVPLGSGKKMKTRRGNVISLDNLLD-------------  414 (600)
T ss_pred             EEEEECCHH-HHH--HHHH-HHHHHCCCCCCC-CCEEEEEEEEEECCCCCCCCCCCCCCEEHHHHHH-------------
T ss_conf             987405188-899--9999-999971653788-6168998764325788854345566022344689-------------


Q ss_pred             CCCEEEECCCCCCHHHCCCCCCCC-----------CCCCCCCHHHHHHHHHHCCCCCCCCCCCCC-CHH-----------
Q ss_conf             897064047421000000122221-----------001234633566655301332111113432-101-----------
Q gi|254780802|r  619 DNSKVVIGPLEKMSKSKKNVIDPM-----------KVIKSYGADTARLFVLSDSPPDRDIIWSNK-GVD-----------  675 (869)
Q Consensus       619 ~~~~~~~~~g~KMSKSkGNvi~p~-----------~~i~~yGaD~lRl~~~~~~~~~~d~~~s~~-~i~-----------  675 (869)
T Consensus       415 -----------e~~~RA~~~~~~~~~~~~~~e~~e~~a~~vG~gAvry~~l~-~~~~~~~~Fd~d~~~L~f~~n~~pY~Q  482 (600)
T TIGR00456       415 -----------EASKRAGNVITKRNTDLEQDEAEEKVADAVGIGAVRYADLS-KNRETHYVFDWDTAMLSFEGNTAPYIQ  482 (600)
T ss_pred             -----------HHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHH-HCCCCCCEEECCCHHHCCCCCCCCHHH
T ss_conf             -----------99999999996110135222037899999736799999997-278988155012011115788743258


Q ss_pred             HHHHHHHHHHH-HHHHHHC----CCCCCC-CHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHC-
Q ss_conf             14556778899-9997630----246678-9756999999999999999998816889999999999999999998621-
Q gi|254780802|r  676 STYQFIQQIWR-LIYNAKD----ELQTSS-TKKDISLISKSTKFLERIEENYQNLSFNKAVANIHELVNVISKPLMEIA-  748 (869)
Q Consensus       676 ~~~rfl~kl~~-l~~~~~~----~~~~~~-~~~D~~ils~~~~~i~~v~~~~e~~~f~~ai~~i~~f~n~ls~~y~~~~-  748 (869)
T Consensus       483 YAhaR~~Silr~~~~~~~~~~~~~~~~~~~~~~E~~L~~~L~~fp~~~~~~~~~~~p~~l~~Yly~LA~~F~sfY~~~~v  562 (600)
T TIGR00456       483 YAHARICSILRKKAEIDGEKLIADDFLLLKEEKEKELLKLLLQFPEVIEEAAEEREPHVLTNYLYELAKLFSSFYKACPV  562 (600)
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             88999999876310233134553200036888899999998564899999998547188899999997764236641778


Q ss_pred             -CCC---CCCCHHH---HHHHHHHHHHHHHC
Q ss_conf             -100---0221799---99999999999972
Q gi|254780802|r  749 -KKK---SNADRIS---TIRYILEKLIIMMS  772 (869)
Q Consensus       749 -k~~---~~~~~~~---~l~~vl~~l~~lLa  772 (869)
T Consensus       563 ~~~~~~~~~~~RL~L~~~~~~~L~n~L~LLG  593 (600)
T TIGR00456       563 LDAENEELAKARLALLKATRQTLKNGLELLG  593 (600)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             8986266899999999999999999887608