HHsearch alignment for GI: 254780802 and conserved domain: TIGR00456

>TIGR00456 argS arginyl-tRNA synthetase; InterPro: IPR001278 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases . Arginyl-tRNA synthetase (6.1.1.19 from EC) has been crystallized and preliminary X-ray crystallographic analysis of yeast arginyl-tRNA synthetase-yeast tRNAArg complexes is available . ; GO: 0000166 nucleotide binding, 0004814 arginine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006420 arginyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=98.29  E-value=1.8e-06  Score=62.29  Aligned_cols=66  Identities=30%  Similarity=0.520  Sum_probs=50.8

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             989999999985980367678888389980778978987400477977899999977718985567
Q gi|254780802|r   11 TDSIWQSAWYDSNIFKAENGKNKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLH   76 (869)
Q Consensus        11 iE~kwq~~W~~~~~fe~~~~~~~~kf~i~~~pPy~nG~lHiGH~~~~t~~Dv~aRy~rm~G~~Vl~   76 (869)
T Consensus        95 ~~~l~~~~~~~~e~yG~~~~~~~~ki~~EfsSaNp~gplH~GHlR~aiIGD~L~r~l~~~G~~V~r  160 (600)
T TIGR00456        95 LENLIQKILEQKEKYGSKKLKESKKIIIEFSSANPAGPLHIGHLRNAIIGDSLARILEFLGYDVIR  160 (600)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             999988785012024676657870799987658889761100002577788999999875970798