>cd00674 LysRS_core_class_I This is the catalytic core domain of lysyl tRNA synthetase (LysRS). This class I enzyme is a monomer, which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. The class I LysRS is found only in archaea and some bacteria and has evolved separately from class II LysRS, as the two do not share structural or sequence similarity.

Probab=97.71 E-value=0.00014 Score=49.31 Aligned_cols=48 Identities=25% Similarity=0.297 Sum_probs=40.3 Q ss_pred EEECCCCCCHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCC-CCCCCCCCC Q ss_conf 6404742100000012222100123463356665530133-211111343 Q gi|254780802|r 623 VVIGPLEKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSP-PDRDIIWSN 671 (869) Q Consensus 623 ~~~~~g~KMSKSkGNvi~p~~~i~~yGaD~lRl~~~~~~~-~~~d~~~s~ 671 (869) T Consensus 268 ~~~kgg~KmSsSkGn~it~~e~L~~~~pE~lr~l~~-~~p~~~k~i~fD~ 316 (354) T cd00674 268 IGLKGGGKMSSSKGNVITPRDWLEVAPPESLRFLYA-RRKNPAKHIGFDL 316 (354) T ss_pred EEECCCCCCCCCCCCCCCHHHHHHHCCHHHHHHHHH-HCCCCCCCCCCCC T ss_conf 990699872246786128999997659999999986-0998553224675

HHsearch alignment for GI: 254780802 and conserved domain: cd00674