HHsearch alignment for GI: 254780802 and conserved domain: cd00802

>cd00802 class_I_aaRS_core Class I amino acyl-tRNA synthetase (aaRS) catalytic core domain. These enzymes are mostly monomers, which aminoacylate the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.
Probab=99.39  E-value=3.1e-13  Score=108.67  Aligned_cols=73  Identities=34%  Similarity=0.621  Sum_probs=69.8

Q ss_pred             EEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Q ss_conf             998077897898740047797789999997771898556768814020589999998099999999999999999999
Q gi|254780802|r   37 FVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENAAREHNVHPKMWTYQNIKVMRKQLQ  114 (869)
Q Consensus        37 ~i~~~pPy~nG~lHiGH~~~~t~~Dv~aRy~rm~G~~Vl~~~G~d~~GlPie~~~~e~~~~~~~~~~~~i~~~k~~~~  114 (869)
T Consensus         1 ~i~~~~p~ptG~lHiGh~~~~~~~~~~ar~~-----~~~~~~~idd~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~   73 (142)
T cd00802           1 VITRPGPYPTGPLHIGHARTALLNDVLARYG-----NVLFILGIDDTGLPIEDKAEKEGKLPKEEVEENIEEIKEDLK   73 (142)
T ss_pred             CEECCCCCCCCCCCHHHHHHHHHHHHHHHHC-----CCEEEEEECCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHCE
T ss_conf             9141488989964188999999999999981-----998999865799200116788444889999999999998652