>cd00807 Gln_GluRS_non_core Glutaminyl-tRNA synthetase (GlnRS) and non-descriminating Glutamyl-tRNA synthetase (GluRS) cataytic core domain. These enzymes attach Gln or Glu, respectively, to the appropriate tRNA. Like other class I tRNA synthetases, they aminoacylate the 2'-OH of the nucleotide at the 3' end of the tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. These enzymes function as monomers. Archaea and most bacteria lack GlnRS. In these organisms, the "non-descriminating" form of GluRS aminoacylates both tRNA(Glu) and tRNA(Gln) with Glu, which is converted to Gln when appropriate by a transamidation enzyme.

Probab=98.01 E-value=1.4e-05 Score=56.23 Aligned_cols=90 Identities=20% Similarity=0.242 Sum_probs=67.1 Q ss_pred EEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCC Q ss_conf 98077897898740047797789999997771898556768814020589999998099999999999999999999819 Q gi|254780802|r 38 VLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENAAREHNVHPKMWTYQNIKVMRKQLQSIG 117 (869) Q Consensus 38 i~~~pPy~nG~lHiGH~~~~t~~Dv~aRy~rm~G~~Vl~~~G~d~~GlPie~~~~e~~~~~~~~~~~~i~~~k~~~~~lG 117 (869) T Consensus 3 ~tRFAPsPtG~lHiG~artal~n~l~Ar~--~~G~~iLRiEDT----------------D~~r~~~e~~~~I~~~L~wLG 64 (238) T cd00807 3 VTRFPPEPNGYLHIGHAKAAILNFEYAKR--YGGKLILRFDDT----------------NPKKEDEEAYDSILEDLEWLG 64 (238) T ss_pred EEECCCCCCCCCCHHHHHHHHHHHHHHHH--HCCEEEEEECCC----------------CCCCCCCHHHHHHHHHHHHHC T ss_conf 69608898986438999999999999998--299699986778----------------987676168999999999848 Q ss_pred CEEECCCCEECCCH--HHHHHHHHHHHHHHHCCCEE Q ss_conf 17664698214773--59999999999999889634 Q gi|254780802|r 118 LSIDWSKDFATCDV--DYYHCQQLLFLDFMKHNVIV 151 (869) Q Consensus 118 ~~~DW~r~y~T~d~--~y~~~v~w~f~~L~~kGliy 151 (869) T Consensus 65 l--~~De~~~QS~r~~~y~~~----a~~Li~~G~AY 94 (238) T cd00807 65 I--KPDEITYASDYFDLYYEY----AEKLIKMGKAY 94 (238) T ss_pred C--CCCCCEECCCCHHHHHHH----HHHHHHCCCCC T ss_conf 9--999315636679999999----99999879987

HHsearch alignment for GI: 254780802 and conserved domain: cd00807