HHsearch alignment for GI: 254780802 and conserved domain: cd07375

>cd07375 Anticodon_Ia_like Anticodon-binding domain of class Ia aminoacyl tRNA synthetases and similar domains. This domain is found in a variety of class Ia aminoacyl tRNA synthetases, C-terminal to the catalytic core domain. It recognizes and specifically binds to the anticodon of the tRNA. Aminoacyl tRNA synthetases catalyze the transfer of cognate amino acids to the 3'-end of their tRNAs by specifically recognizing cognate from non-cognate amino acids. Members include valyl-, leucyl-, isoleucyl-, cysteinyl-, arginyl-, and methionyl-tRNA synthethases. This superfamily also includes a domain from MshC, an enzyme in the mycothiol biosynthetic pathway.
Probab=99.65  E-value=2.5e-15  Score=122.99  Aligned_cols=104  Identities=17%  Similarity=0.326  Sum_probs=88.3

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHCCC---CC-----CCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             3210114556778899999763024---66-----789756999999999999999998816889999999999999999
Q gi|254780802|r  671 NKGVDSTYQFIQQIWRLIYNAKDEL---QT-----SSTKKDISLISKSTKFLERIEENYQNLSFNKAVANIHELVNVISK  742 (869)
Q Consensus       671 ~~~i~~~~rfl~kl~~l~~~~~~~~---~~-----~~~~~D~~ils~~~~~i~~v~~~~e~~~f~~ai~~i~~f~n~ls~  742 (869)
T Consensus         1 eerve~~r~F~nKLWNa~rF~~~~~~~~~~~~~~~~l~~~DrWIls~l~~~i~~v~~~~e~y~f~~a~~~l~~F~w~~-d   79 (117)
T cd07375           1 EERLKQARAFLNRLYRLLSFFRKALGGTQPKWDNELLEEADRELLARLQEFIKRTTNALEALDPTTAVQELFKFTNEL-N   79 (117)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHH-H
T ss_conf             999999999998999999999856887888656322776279999999899999999999278999999999999936-9


Q ss_pred             HHHHHCCCCCCC-----CHHHHHHHHHHHHHHHHCCCH
Q ss_conf             998621100022-----179999999999999972234
Q gi|254780802|r  743 PLMEIAKKKSNA-----DRISTIRYILEKLIIMMSPMI  775 (869)
Q Consensus       743 ~y~~~~k~~~~~-----~~~~~l~~vl~~l~~lLaPi~  775 (869)
T Consensus        80 wYie~~K~r~~~e~~~~~~~~~L~~vl~~~lkLlhPFt  117 (117)
T cd07375          80 WYLDELKPALQTEELREAVLAVLRAALVVLTKLLAPFT  117 (117)
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999656304827579999999999999999819999