HHsearch alignment for GI: 254780802 and conserved domain: pfam00133

>pfam00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V). Other tRNA synthetase sub-families are too dissimilar to be included.
Probab=100.00  E-value=0  Score=1054.06  Aligned_cols=546  Identities=26%  Similarity=0.416  Sum_probs=422.6

Q ss_pred             HHHHHHHHCCCCCC--CCCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             99999998598036--7678888389980778978987400477977899999977718985567688140205899999
Q gi|254780802|r   14 IWQSAWYDSNIFKA--ENGKNKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENAA   91 (869)
Q Consensus        14 kwq~~W~~~~~fe~--~~~~~~~kf~i~~~pPy~nG~lHiGH~~~~t~~Dv~aRy~rm~G~~Vl~~~G~d~~GlPie~~~   91 (869)
T Consensus         1 eiq~~W~~~~~f~~~~~~~~~k~kf~i~~~pPY~nG~lH~GH~~~~t~~D~~aRy~rm~G~~Vl~p~GwD~~GlPiE~~v   80 (606)
T pfam00133         1 QIYQFWDEQGYFKKSLENGKGKPSFTIHDGPPNATGLLHIGHALNKTLKDIVIRYKRMQGFDVLWVPGWDHHGLPTEQKV   80 (606)
T ss_pred             CHHHHHHHCCCCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             96789875799057633479999589970898978850242668789999999999828997799884561439999999


Q ss_pred             HHH-----CC------------CHHHHHHHHHHHHHHHHHHCCCEEECCCCEECCCHHHHHHHHHHHHHHHHCCCEEECC
Q ss_conf             980-----99------------9999999999999999998191766469821477359999999999999889634122
Q gi|254780802|r   92 REH-----NV------------HPKMWTYQNIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHNVIVRKT  154 (869)
Q Consensus        92 ~e~-----~~------------~~~~~~~~~i~~~k~~~~~lG~~~DW~r~y~T~d~~y~~~v~w~f~~L~~kGliyrg~  154 (869)
T Consensus        81 ek~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lG~~~DW~r~~~T~dp~y~~~~~w~F~~L~~~Gliyr~~  160 (606)
T pfam00133        81 EKKLGIKGKKDRHKLGREKFREKCREWKMEYADEIRSQFKRLGVSGDWDREYFTLDPGLEAAVWRVFVRLHDKGLIYRGK  160 (606)
T ss_pred             HHHHHHCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             99742115998365799999999999999999999999998291264588725278125499999999999779817751


Q ss_pred             EEEECCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             13321477676778989843853345643223347523343034445443210022554322222100014557675453
Q gi|254780802|r  155 AQVNWDPVEQTVLANEQVINGRGWRSDAPVEQRSLPQWFFKISDLSQELLDSIETLSEWPEKVKIMQKNWIGRSEGMEIR  234 (869)
Q Consensus       155 ~pV~wcp~~~t~la~~Ev~~g~~~~~~~~v~~~~~~~~~~~~~~~~~~l~~~~~~l~~~p~~v~~~~~~~i~~~~~~~~~  234 (869)
T Consensus       161 ~~V~wcp~~~T~La~~Ev~~~d~----------~~~~---------------------------------------~~v~  191 (606)
T pfam00133       161 KPVNWSPALNTALSEAEVEYKDV----------KGPS---------------------------------------IHVA  191 (606)
T ss_pred             EEECCCCCCCEECCCCCEEECCC----------CCCE---------------------------------------EEEE
T ss_conf             55012442541224440210003----------3303---------------------------------------5650


Q ss_pred             CCCCCCCCCCCCEEEEEEECCCCCCCCCEEEEECCCCCCHHHHHCCHHH--HHHHHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             5556777777513653200134443232003302443203454131458--99988653111124555430255323786
Q gi|254780802|r  235 WEIVSNTIDQIEEILVYTTRPETIFGASFIAIAVDHSISEKLSCDNTDI--KEFCDEEKQKGTSLSVLDKTEKKGIYTGI  312 (869)
Q Consensus       235 ~~~~~~~~~~~~~l~~~TtrPeTl~g~~~i~v~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~G~  312 (869)
T Consensus       192 f~l~~---~~~~~l~i~TTrPeTl~g~~~l~v~p~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~l~G~  268 (606)
T pfam00133       192 FPLAD---GKGASLVIWTTTPWTLPGNTAVAVNPEFNYVKIRVTGEYYILAEALLKSLYKKKKEDGEILEDFRGKELIGK  268 (606)
T ss_pred             CCCCC---CCCCEEEEEECCCCCCCCCEEEEECCCCCEEEEECCCCHHHHHHHHHHHHHHCCCHHHHHHHCCCCCEECCC
T ss_conf             44578---987669999435420036536898888765104438606789999999997403302433313345231277


Q ss_pred             EECCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCH-------------
Q ss_conf             1037777741577631123454533322211134672110122103544321016776555422211-------------
Q gi|254780802|r  313 HVKHPLNPNVVIPVYIANFVFMNYGTGAIFGCPFADQRDMDFAKKYGLPIIPIMKRSINHSQDIEEG-------------  379 (869)
Q Consensus       313 ~~~~P~~~~~~ipv~~~~~V~~~~GTG~V~~~P~h~~~D~~~~~k~glpi~~v~~~~~~~~~~~~~~-------------  379 (869)
T Consensus       269 ~~~~P~~~~-~ipv~~~~~V~~~~GTG~V~~vPah~~~D~~~~~k~~l~~~~~i~~~g~~~~~~~~~~G~~v~~a~~~ii  347 (606)
T pfam00133       269 KYIHPFVNR-EIPIIADDYVDMEFGTGAVHIAPAHGEDDYEVGKRHNLEFINPVDDDGTYNEEAPEFQGLKRFKARKKIV  347 (606)
T ss_pred             EEECCCCCC-EEEEEECCCCCCCCCCCCEECCCCCCHHHHHHHHHCCCCCEEEECCCCEECCCCCCCCCCEEEECCHHHH
T ss_conf             897887897-5789954641566687713336777779999999839985024489884667651115852560218999


Q ss_pred             HHCCCCCCCC------CCHHH---------------CCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHH---HCCCCCCC
Q ss_conf             2101233445------83000---------------135646654888999974046775202221110---00111221
Q gi|254780802|r  380 KAFSGDGIMI------NSSFL---------------DGMTNTEALQAVMSHLEKQNIKNSPIGKRKINF---RLRDWCIS  435 (869)
Q Consensus       380 ~~~~~~~~~~------~~~~~---------------~g~~~~~~~~~i~~~l~~~~~~~~~~~~~~~~~---~l~DW~IS  435 (869)
T Consensus       348 ~~L~~~g~l~~~~~~~~~~p~~~R~~~~vi~~~~~QWFi~~~~~k~~~~~~~~~~~~~P~~-~~~~~~~~l~~l~DW~iS  426 (606)
T pfam00133       348 ELLTEKGLLLKIEPIEHSYPHCWRSGTPIIYRATPQWFVRMKNLAEAALKAVEKVQFVPKW-GEKRYGNWLENIQDWCIS  426 (606)
T ss_pred             HHHHHCCCEEEEEEECCCCCEECCCCCEEEEEECHHHHHHHHHHHHHHHHHHHHHHCCCHH-HCCHHHEEECCCCCCEEE
T ss_conf             9788689866532201015555478947999602787775599999999864433027501-012033055256563575


Q ss_pred             CCCCCCCCCCCCCCCCCCCEECCCCCCCHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC-CCCC
Q ss_conf             123222223422333468463474200011100100022454210024564211013676443564323456664-3332
Q gi|254780802|r  436 RQRSWGCPIPVIHCQKCGIVELPKEDLPVQLPEDLDFTLPGNPLENHPTWKKIFCVKCGSEALRETDTMDTFVDS-SWYY  514 (869)
Q Consensus       436 Rqr~WG~piPv~~~~~~~~~~~~~~~l~v~~~~d~~~~~~~~~l~~~~~~~~~~~~~~~~~~~r~~dvld~w~dS-~~~~  514 (869)
T Consensus       427 RQR~WGtPIPi~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~-~~~~~~~~~~~~~re~DtmDtwfdSg~~~~  502 (606)
T pfam00133       427 RQRWWGHPIPAWYSKDTGEVYVRGSLKELVAGR---EEEEGIEAWLHRD-AKDLLGKGAGTLEQDEDVLDTWFSSGSWPF  502 (606)
T ss_pred             EECCCCCCCCEEECCCCCCCCCCCHHHHHHHHH---HCCCCCCCCCCCC-HHHHCCCCCCCEEECCEEEECEECCCCCHH
T ss_conf             414678732269837898316750245555443---0466753101212-465535788751567761202111775689


Q ss_pred             CCCCCCCCCCCCHHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHHHHCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2335556544101356641143344014555443320234555320134787-322320022223553232243323587
Q gi|254780802|r  515 MRYMTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKIGY-IEIDEPFKRLFTQGMVVHETYYQLEGI  593 (869)
Q Consensus       515 ~~~~~~~~~~~~~~e~~~~~~P~D~~i~g~d~~~~~~~~~r~~~~~l~~~g~-~~~~~pf~~l~~~G~v~~~~~~~~~~~  593 (869)
T Consensus       503 ~~~~~p~~----~~~~f~~~~PvD~~i~G~D~~-------r~w~~~~~~~~~~~~~~~Pfk~l~~~G~vld~--------  563 (606)
T pfam00133       503 STLGYPFT----NTPEFKRFFPADMLLEGSDQT-------RGWFYRMIVLGTALTGSAPYKNVLVHGLVRDE--------  563 (606)
T ss_pred             HHHCCCHH----CHHHHHCCCCCCEEECCHHHH-------HHHHHHHHHCCCCCCCCCCCCEEEECCEEECC--------
T ss_conf             88478512----769895388984897767688-------48999999700002799765458876618999--------


Q ss_pred             CCEEECCCHHHCCCCCCCCCCCEECCCCEEEECCCCCCHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             00130620221025677754411048970640474210000001222210012346335666553013321111134
Q gi|254780802|r  594 KKKYLKPDEVILRNIEGENCAFRLSDNSKVVIGPLEKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPDRDIIWS  670 (869)
Q Consensus       594 ~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~g~KMSKSkGNvi~p~~~i~~yGaD~lRl~~~~~~~~~~d~~~s  670 (869)
T Consensus       564 ---------------------------------~G~KMSKSkGNvv~p~~~i~~yGaD~~Rl~~~~-a~~~~D~~~S  606 (606)
T pfam00133       564 ---------------------------------QGRKMSKSLGNVIDPLDVIDKYGADALRLWLAS-SDYGRDINFS  606 (606)
T ss_pred             ---------------------------------CCCCCCCCCCCCCCHHHHHHHHCHHHHHHHHHC-CCCHHCCCCC
T ss_conf             ---------------------------------887888888997898999987492999999975-9922046559