HHsearch alignment for GI: 254780802 and conserved domain: pfam00749

>pfam00749 tRNA-synt_1c tRNA synthetases class I (E and Q), catalytic domain. Other tRNA synthetase sub-families are too dissimilar to be included. This family includes only glutamyl and glutaminyl tRNA synthetases. In some organisms, a single glutamyl-tRNA synthetase aminoacylates both tRNA(Glu) and tRNA(Gln).
Probab=97.78  E-value=7.6e-05  Score=51.17  Aligned_cols=92  Identities=17%  Similarity=0.318  Sum_probs=62.9

Q ss_pred             EECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             80778978987400477977899999977718985567688140205899999980999999999999999999998191
Q gi|254780802|r   39 LEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENAAREHNVHPKMWTYQNIKVMRKQLQSIGL  118 (869)
Q Consensus        39 ~~~pPy~nG~lHiGH~~~~t~~Dv~aRy~rm~G~~Vl~~~G~d~~GlPie~~~~e~~~~~~~~~~~~i~~~k~~~~~lG~  118 (869)
T Consensus         4 tRFAPSPTG~lHiG~~rtAl~n~l~Ar~--~~G~fiLRIEDtD----------------~~R~~~e~~~~I~~dL~wLGl   65 (314)
T pfam00749         4 TRFAPSPTGYLHIGHARTALFNYLFAKN--YNGKFILRFDDTD----------------PEREKPEYEESILEDLKWLGI   65 (314)
T ss_pred             EECCCCCCCCCCHHHHHHHHHHHHHHHH--HCCEEEEEECCCC----------------CCCCCHHHHHHHHHHHHHHCC
T ss_conf             9728898986448999999999999998--0998999968789----------------886876899999999999537


Q ss_pred             EEECCC-CEECCCHHHHHHHHHHHHHHHHCCCEEE
Q ss_conf             766469-8214773599999999999998896341
Q gi|254780802|r  119 SIDWSK-DFATCDVDYYHCQQLLFLDFMKHNVIVR  152 (869)
Q Consensus       119 ~~DW~r-~y~T~d~~y~~~v~w~f~~L~~kGliyr  152 (869)
T Consensus        66 ~--wDe~~~~QS~r--~~~Y~~~~~~L~~~g~aY~   96 (314)
T pfam00749        66 K--WDEKPYYQSDR--FDIYYKYAEELIEKGLAYV   96 (314)
T ss_pred             C--CCCCCEEHHCC--HHHHHHHHHHHHHCCCCCC
T ss_conf             8--99883552020--9999999999997499522