HHsearch alignment for GI: 254780802 and conserved domain: pfam00750

>pfam00750 tRNA-synt_1d tRNA synthetases class I (R). Other tRNA synthetase sub-families are too dissimilar to be included. This family includes only arginyl tRNA synthetase.
Probab=97.10  E-value=0.00018  Score=48.67  Aligned_cols=46  Identities=30%  Similarity=0.343  Sum_probs=36.9

Q ss_pred             EECCCCCCHHHCCCCCCCCCCCCC--------------------------CCHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             404742100000012222100123--------------------------46335666553013321111134
Q gi|254780802|r  624 VIGPLEKMSKSKKNVIDPMKVIKS--------------------------YGADTARLFVLSDSPPDRDIIWS  670 (869)
Q Consensus       624 ~~~~g~KMSKSkGNvi~p~~~i~~--------------------------yGaD~lRl~~~~~~~~~~d~~~s  670 (869)
T Consensus       273 ~~~dgkkMStR~G~~v~l~dLl~ea~~~a~~~~~~~~~~~~~~~~~ia~~Vgi~Airy~~L~-~~~~k~i~FD  344 (345)
T pfam00750       273 LGKDGKRMSTRAGNVVTLDDLLDEALERAMDIKEKNRDLTADELEAVATAIGVDAARYADLS-SNRDTDYIFD  344 (345)
T ss_pred             ECCCCCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHH-CCCCCCCCCC
T ss_conf             76899616778877578999999999999999973668987789999987707676599986-5889898358