BLAST/PSIBLAST alignment of GI: 254780802 and GI: 190893972 at iteration 1
>gi|190893972|ref|YP_001980514.1| leucyl-tRNA synthetase [Rhizobium etli CIAT 652] Length = 876
>gi|238692504|sp|B3PS46|SYL_RHIE6 RecName: Full=Leucyl-tRNA synthetase; AltName: Full=Leucine--tRNA ligase; Short=LeuRS Length = 876
>gi|190699251|gb|ACE93336.1| leucyl-tRNA synthetase protein [Rhizobium etli CIAT 652] Length = 876
 Score = 1077 bits (2784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/876 (55%), Positives = 646/876 (73%), Gaps = 7/876 (0%)

Query: 1   METRSYSPQETDSIWQSAWYDSNIFKAENGKNKKKYFVLEMFPYPSGNIHMGHLRNYVIG 60
           M T  Y+P++ +  WQ  W +  +F+ +N   ++KY+VLEMFPYPSG IHMGH+RNY +G
Sbjct: 1   MATERYNPRDAEPRWQQKWNEDKVFETDNADPREKYYVLEMFPYPSGRIHMGHVRNYAMG 60

Query: 61  DVVARFMRASGYSVLHPMGWDAFGMPAENAAREHNVHPKMWTYQNIKVMRKQLQSIGLSI 120
           DVVAR+ RA GY+VLHPMGWDAFGMPAENAA E  VHP  WTYQNI  M+ QL+++GLS+
Sbjct: 61  DVVARYKRARGYNVLHPMGWDAFGMPAENAAMERGVHPASWTYQNIASMKAQLKAMGLSL 120

Query: 121 DWSKDFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVNWDPVEQTVLANEQVINGRGWRS 180
           DWS++FATCDV+YY  QQ LFLDF++  ++ RK ++VNWDPV+ TVLANEQVI+GRGWRS
Sbjct: 121 DWSREFATCDVEYYQHQQHLFLDFLEKGLVYRKQSKVNWDPVDNTVLANEQVIDGRGWRS 180

Query: 181 DAPVEQRSLPQWFFKISDLSQELLDSIETLSEWPEKVKIMQKNWIGRSEGMEIRWEIVSN 240
            A VEQR L QWFFKI+D SQ+LLD+++TL +WPEKV++MQKNWIGRSEG+ +RWEIV  
Sbjct: 181 GALVEQRELTQWFFKITDFSQDLLDALDTLDQWPEKVRLMQKNWIGRSEGLTVRWEIVPE 240

Query: 241 TIDQIE-EILVYTTRPETIFGASFIAIAVDHSISEKLSCDNTDIKEFCDEEKQKGTSLSV 299
           T    E EI VYTTRP+T+FGASF+AIA DH +++  +  N +I+ FC+E ++ GTSL+ 
Sbjct: 241 TAPAGETEITVYTTRPDTLFGASFLAIAADHPLAKDAAAKNVEIEAFCEECRRAGTSLAA 300

Query: 300 LDKTEKKGIYTGIHVKHPLNPNVVIPVYIANFVFMNYGTGAIFGCPFADQRDMDFAKKYG 359
           L+  EKKG+ TGI V+HPL+P   +PVYIANFV M+YGTGAIFGCP  DQRD+DFA+KYG
Sbjct: 301 LETAEKKGLDTGIRVRHPLDPTWELPVYIANFVLMDYGTGAIFGCPSGDQRDLDFARKYG 360

Query: 360 LPIIPIMKRSINHSQDIEEG-KAFSGDGIMINSSFLDGMTNTEALQAVMSHLEKQNIKNS 418
           LP++ ++  S   +     G  A+ GDG+MINS FLDG T  EA   V   L   ++ N+
Sbjct: 361 LPVVAVVMPSDGDAASFAVGDTAYDGDGVMINSRFLDGKTTEEAFNIVADRLSAASLGNT 420

Query: 419 PIGKRKINFRLRDWCISRQRSWGCPIPVIHCQKCGIVELPKEDLPVQLPEDLDFTLPGNP 478
           P+ +RK+NFRLRDW ISRQR WGCPIPVIHC  CG+V +PK DLPV+LPED+ F  PGNP
Sbjct: 421 PVAERKVNFRLRDWGISRQRYWGCPIPVIHCDACGVVPVPKTDLPVKLPEDVTFDQPGNP 480

Query: 479 LENHPTWKKIFCVKCGSEALRETDTMDTFVDSSWYYMRYMTPHAKDPINKELVRQWFPVD 538
           L+ HPTW+ + C  CG +A RETDTMDTFVDSSWY+ R+  P    P + E   +W PVD
Sbjct: 481 LDRHPTWRHVTCPHCGKDARRETDTMDTFVDSSWYFTRFTAPWEAKPTDPEAANRWLPVD 540

Query: 539 QYIGGIEHAVLHLLYARFFAHILKKIGYIEIDEPFKRLFTQGMVVHETYYQLEGIKKKYL 598
           QYIGGIEHA+LHLLY+RFF   +++ G++   EPFK LFTQGMVVHETY +  G  ++++
Sbjct: 541 QYIGGIEHAILHLLYSRFFTRAMRETGHVAASEPFKGLFTQGMVVHETYSRKAGAGREWV 600

Query: 599 KPDEVILRNIEGENCAFRLSDNSKVVIGPLEKMSKSKKNVIDPMKVIKSYGADTARLFVL 658
            P ++ +  I+G+  A  L+   +V IG +EKMSKSKKNV+DP  +I SYGADTAR FVL
Sbjct: 601 APADIRIEEIDGKRRALLLATGEEVAIGSIEKMSKSKKNVVDPDDIIASYGADTARFFVL 660

Query: 659 SDSPPDRDIIWSNKGVDSTYQFIQQIWRLIYNAKDELQT-----SSTKKDISLISKSTKF 713
           SDSPP+RD+IWS  GV+  ++F Q++WRLI  A   L T     +S  + +++   + K 
Sbjct: 661 SDSPPERDVIWSEAGVEGAHRFTQRLWRLISEAAGVLSTVAAAPASEGEALAISQAAHKT 720

Query: 714 LERIEENYQNLSFNKAVANIHELVNVISKPLMEIAKKKSNADRISTIRYILEKLIIMMSP 773
           L+ ++ +Y  L FNKAVA I+ELVN ++ PL ++A  + +    + +R   E LI +++P
Sbjct: 721 LKAVQNDYDKLWFNKAVARIYELVNALAAPLTKVAAGEGDIAYRAAVRDAAEILIQLVAP 780

Query: 774 MIPHLAEECWQLLGNAGLVAQQKWPKLDPILEVNTDIILPIQVNGKKRACITVSMNTDDD 833
           M PHLAEECW  LGN GL+A+  WP+    L V  D++LP+Q+NGKKRA +T+S + D +
Sbjct: 781 MTPHLAEECWATLGNTGLLARTGWPRFVEALVVENDVVLPVQINGKKRAELTISRDADQN 840

Query: 834 FIKKTVLELNVIKNILQGKSPKKIIIISKRIVNIVV 869
            +   VLEL+ +KN+L G++PKKII++ +RIVNIVV
Sbjct: 841 AVTDAVLELDAVKNVLNGQAPKKIIVVPQRIVNIVV 876