RPSBLAST alignment for GI: 254780802 and conserved domain: pfam09334

>gnl|CDD|117876 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M). This family includes methionyl tRNA synthetases. Length = 388
 Score = 51.5 bits (124), Expect = 9e-07
 Identities = 16/42 (38%), Positives = 27/42 (64%)

Query: 629 EKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPDRDIIWS 670
            KMSKS+ NV+DP +++  YG D  R ++  ++P  +D  +S
Sbjct: 323 GKMSKSRGNVVDPDELLDRYGVDALRYYLAREAPEGKDGDFS 364