RPSBLAST alignment for GI: 254780802 and conserved domain: cd07958

>gnl|CDD|153412 cd07958, Anticodon_Ia_Leu_BEm, Anticodon-binding domain of bacterial and eukaryotic mitochondrial leucyl tRNA synthetases. This domain is found in leucyl tRNA synthetases (LeuRS), which belong to the class Ia aminoacyl tRNA synthetases. It lies C-terminal to the catalytic core domain. In contrast to other class Ia enzymes, the anticodon is not used as an identity element in LeuRS (with exceptions such as Saccharomyces cerevisiae and some other eukaryotes). No anticodon-binding site can be defined for this family, which includes bacterial and eukaryotic mitochondrial members, as well as LeuRS from the archaeal Halobacteria. LeuRS catalyzes the transfer of leucine to the 3'-end of its tRNA. Length = 117
 Score =  105 bits (265), Expect = 5e-23
 Identities = 40/126 (31%), Positives = 67/126 (53%), Gaps = 17/126 (13%)

Query: 669 WSNKGVDSTYQFIQQIWRLIYNAKDELQTSSTKKDISLISKSTKFLER--------IEEN 720
           WS+ GV+  Y+F+ ++WRL+    + L   +   ++S   +  K L R        + E+
Sbjct: 1   WSDSGVEGAYRFLNRVWRLVTELAEALAAPAAAAELS---EEDKELRRKLHKTIKKVTED 57

Query: 721 YQNLSFNKAVANIHELVNVISKPLMEIAKKKSNADRISTIRYILEKLIIMMSPMIPHLAE 780
            + L FN A+A + ELVN + K      KKK      + +R  LE L+++++P  PH+AE
Sbjct: 58  IERLRFNTAIAALMELVNALYK-----YKKKDAQHA-AVLREALETLVLLLAPFAPHIAE 111

Query: 781 ECWQLL 786
           E W+ L
Sbjct: 112 ELWEEL 117