RPSBLAST alignment for GI: 254780802 and conserved domain: TIGR00395

>gnl|CDD|161856 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal and cytosolic family. The leucyl-tRNA synthetases belong to two families so broadly different that they are represented by separate models. This model includes both archaeal and cytosolic eukaryotic leucyl-tRNA synthetases; the eubacterial and mitochondrial forms differ so substantially that some other tRNA ligases score higher by this model than does any eubacterial LeuS. Length = 938
 Score = 85.3 bits (211), Expect = 7e-17
 Identities = 44/177 (24%), Positives = 81/177 (45%), Gaps = 10/177 (5%)

Query: 630 KMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPDRDIIWSNKGVDSTYQFIQQIWRLIY 689
           KMSKSK NV+   + ++ +GAD ARL++   +   +D  W    V+ T   +++++    
Sbjct: 620 KMSKSKGNVLTLEQAVEKFGADVARLYIADAAETVQDADWKESEVEGTILRLERLYEFAE 679

Query: 690 NAKDELQTSSTKK----DISLISKSTKFLERIEENYQNLSFNKAV-ANIHELVNVISKPL 744
               E    + ++    D  L S+    ++   E  +N    KAV   + +L   +    
Sbjct: 680 EITKESNLETGEETSFIDRWLESRMNAAIKETYEAMENFQTRKAVKYALFDLQADVDWYR 739

Query: 745 MEIAKKKSNADRISTIRYILEKLIIMMSPMIPHLAEECWQLLGNAGLVAQQKWPKLD 801
                ++   +    +   LE  I +++P  PH AEE W+ +GN G V+  K+P+  
Sbjct: 740 -----RRGGVNHKDVLARYLETWIKLLAPFAPHFAEEMWEEVGNEGFVSLAKFPEAS 791