RPSBLAST alignment for GI: 254780802 and conserved domain: PRK00260

>gnl|CDD|178951 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated. Length = 463
 Score = 51.7 bits (125), Expect = 9e-07
 Identities = 36/141 (25%), Positives = 68/141 (48%), Gaps = 15/141 (10%)

Query: 629 EKMSKSKKNVIDPMKVIKSYGADTARLFVLSD---SPPDRDIIWSNKGVDSTYQFIQQIW 685
           EKMSKS  N      ++K Y  +  R F+LS    SP +    +S + ++      ++  
Sbjct: 265 EKMSKSLGNFFTIRDLLKKYDPEVLRFFLLSAHYRSPLN----FSEEALEQA----KKAL 316

Query: 686 RLIYNAKDELQTSSTKKDISLISKSTKFLERIEENYQN-LSFNKAVANIHELVNVISKPL 744
             +YNA  E  T+  + D +L+++  +F ER  E   +  +  +A+A + EL   I++ L
Sbjct: 317 ERLYNALAE--TALGEDDEALLAELEEFKERFIEAMDDDFNTPEALAVLFELAREINRAL 374

Query: 745 MEIAKKKSNADRISTIRYILE 765
               K+ + A   + +R + +
Sbjct: 375 ETKDKEAAAA-LAALLRALAD 394