RPSBLAST alignment for GI: 254780802 and conserved domain: PRK06039

>gnl|CDD|180364 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed. Length = 975
 Score = 64.0 bits (157), Expect = 1e-10
 Identities = 38/129 (29%), Positives = 47/129 (36%), Gaps = 43/129 (33%)

Query: 429 LRDWCISRQRSWGCPIPVIHCQKCG-------IVELPKEDLPVQLPEDL------DFTLP 475
            RDW ISR R WG P+P+  C+ CG       I EL +       P DL      + TLP
Sbjct: 443 ARDWNISRNRYWGTPLPIWRCEDCGRIDVIGSIEELEELFGEDVEPIDLHRPYVDEVTLP 502

Query: 476 GNPLENHPTWKKIFCVKCGSEALRETDTMDTFVDS------SWYYMRYMTPHAKDPINKE 529
             P               G    R  D +D + DS        +Y     P      NKE
Sbjct: 503 -CP--------------DGGTMRRVPDVIDVWFDSGSMPYAQLHY-----PFE----NKE 538

Query: 530 LVRQWFPVD 538
              + FP D
Sbjct: 539 WFEKHFPAD 547