RPSBLAST alignment for GI: 254780802 and conserved domain: PRK12268

>gnl|CDD|183390 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed. Length = 556
 Score = 74.9 bits (185), Expect = 8e-14
 Identities = 50/238 (21%), Positives = 96/238 (40%), Gaps = 42/238 (17%)

Query: 590 LEGIKKKYLKPDEVI----LRNIEGENCAFRLSDNSKVVIGPLEKMSKSKKNVIDPMKVI 645
           L G  +    PDE++    L  +EG                   K SKS+   I     +
Sbjct: 309 LLGSGEPLKLPDEIVSSEYL-TLEGG------------------KFSKSRGWGIWVDDAL 349

Query: 646 KSYGADTARLFVLSDSPPDRDIIWS--------NKGVDSTY-QFIQQIWRLIYNAKDEL- 695
           + Y  D  R ++ +++P + D  ++        N  +   Y   + ++   I      + 
Sbjct: 350 ERYPPDYLRYYLAANAPENSDTDFTWEEFVRRVNSELADKYGNLVNRVLSFIEKYFGGIV 409

Query: 696 -QTSSTKKDISLISKSTKFLERIEENYQNLSFNKAVANIHELVNVISKPLMEIA---KKK 751
                  +D  LI+++    + + E  +   F KA+  I EL    +K L E A     K
Sbjct: 410 PPGELGDEDRELIAEAEALFKEVGELLEAGEFKKALEEIMELAREANKYLDEKAPWKLAK 469

Query: 752 SNADRISTIRYILEKLI----IMMSPMIPHLAEECWQLLGNAGLVAQQKWPKLDPILE 805
           ++ +R +T+ Y    L+    +++ P +P  A++ W++LG   +  +  W  L P+L 
Sbjct: 470 TDRERAATVLYTALNLVRLLAVLLYPFLPFSAQKIWEMLGGENIE-KLTWESLKPLLP 526