RPSBLAST alignment for GI: 254780802 and conserved domain: COG0018

>gnl|CDD|30368 COG0018, ArgS, Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 577
 Score = 49.5 bits (118), Expect = 4e-06
 Identities = 22/46 (47%), Positives = 29/46 (63%), Gaps = 3/46 (6%)

Query: 30  GKNKKKYFVLEMF-PYPSGNIHMGHLRNYVIGDVVARFMRASGYSV 74
           GK KK   V+E     P+G +H+GHLRN +IGD +AR +   GY V
Sbjct: 114 GKGKK--VVIEYSSANPTGPLHIGHLRNAIIGDSLARILEFLGYDV 157