RPSBLAST alignment for GI: 254780802 and conserved domain: COG0060

>gnl|CDD|30409 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 933
 Score =  229 bits (585), Expect = 3e-60
 Identities = 189/916 (20%), Positives = 331/916 (36%), Gaps = 235/916 (25%)

Query: 5   SYSPQETDSIWQSAWYDSNIF---KAENGKNKKKYFVLEMFPYPSGNIHMGHLRNYVIGD 61
             +  + +      W +++I+   + E  K K K+ + +  PY +GNIH+GH  N ++ D
Sbjct: 17  RANLPKKEPKILKFWEENDIYEKIREERNKGKPKFVLHDGPPYANGNIHIGHALNKILKD 76

Query: 62  VVARFMRASGYSVLHPMGWDAFGMPAENAAREHNVHPKM----------------WTYQN 105
           ++ R+    GY V +  GWD  G+P E    +     K                 +  + 
Sbjct: 77  IIVRYKTMQGYDVPYVPGWDCHGLPIELKVEKKLGIGKKDIESFGVEEFREKCREFALEQ 136

Query: 106 IKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVNWDPVEQT 165
           +   ++Q + +G+  DW   + T D  Y       F +  +  ++ R    V W P  +T
Sbjct: 137 VDEQKEQFKRLGVWGDWENPYKTMDPSYEESVWWAFKELYEKGLLYRGYKPVPWSPRCET 196

Query: 166 VLANEQVINGRGWRSDAPVEQRSLPQWFFKISDLSQELLDSIETLSEWPEKVKIMQKNWI 225
            LA  +V                                       E+ +          
Sbjct: 197 ALAEAEV---------------------------------------EYGDVK-------- 209

Query: 226 GRSEGMEIRWEIVSNTIDQIEEILVYTTRPETIFGASFIAIAVDHSISEKLSCDNTDI-- 283
                + +++ +    +D+   ++++TT P T+   + +AIAV   +   L   N +   
Sbjct: 210 --DPSIYVKFPVKDEGLDENAYLVIWTTTPWTL--PANLAIAVHPDLDYVLVEVNGEKLI 265

Query: 284 --KEFCDE--EKQKGTSLSVLDKTEKKGIYTGIHVKHPLN---PNVVIPVYIANFVFMNY 336
             K   +   +K       VL +T K     G+  +HP      +   PV + + V ++ 
Sbjct: 266 LAKALVESVAKKAGVEDYEVL-ETFKGSELEGLRYEHPFYDFVYDRAFPVILGDHVTLDD 324

Query: 337 GTGAIFGCPFADQRDMDFAKKYGL--PIIPIMKRSINHSQDIEEGKAFSGDGIMINSSFL 394
           GTG +   P   + D +  KKYGL   + P+           EE   + G  +       
Sbjct: 325 GTGLVHTAPGHGEEDYEVGKKYGLLEVLNPVDDNGRY----TEEAPKYEGLFVK------ 374

Query: 395 DGMTNTEALQAVMSHLEKQN-------IKNS---------PIGKR--------------- 423
                 +A + ++  L+++        I++S         P+  R               
Sbjct: 375 ------DANKKIIEDLKEKGNLLKSEKIEHSYPHCWRTKTPLIYRATPQWFVSVDKLRDK 428

Query: 424 ------KINF-------RL-------RDWCISRQRSWGCPIPVIHCQKCGIVELPKEDL- 462
                 K+N+       R         DWCISRQR WG PIPV +C++ G + +  E+L 
Sbjct: 429 MLKEINKVNWVPDWGKNRFGNMVENRPDWCISRQRYWGVPIPVWYCKETGEILVITEELE 488

Query: 463 --PVQLPEDLDFTLPGNPLENHPTWKKIFCVKCGSEALRETDTMDTFVDSSWYYMRYMTP 520
               QL E+        P  +        C + G E  R  D +D + DS        TP
Sbjct: 489 ELVGQLVEEKGIDDWHRPDIDELLPP---CPEDGKEYRRVPDVLDVWFDSG------STP 539

Query: 521 HAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKIGYIEIDE-PFKRLFTQ 579
           +A     + L       D Y+ G +         R + +             P+K + T 
Sbjct: 540 YAVLHPRENLKFPALFADFYLEGSDQT-------RGWFYSSLLTSTALFGRAPYKNVLTH 592

Query: 580 GMVVHETYYQLEGIKKKYLKPDEVILRNIEGENCAFRLSDNSKVVIGPLEKMSKSKKNVI 639
           G V+ E                       +G                   KMSKS  NV+
Sbjct: 593 GFVLDE-----------------------KGR------------------KMSKSLGNVV 611

Query: 640 DPMKVIKSYGADTARLFVLSDSPPDRDIIWSNKGVDSTYQFIQQIWR-----LIYNAKDE 694
           DP  VI  YGAD  RL+V S S    D+ +S++ +    +  ++I       L      +
Sbjct: 612 DPQDVIDKYGADILRLWVAS-SDYWEDLRFSDEILKQVREVYRKIRNTYRFLLGNLDDFD 670

Query: 695 LQTSSTKK------DISLISKSTKFLERIEENYQNLSFNKAVANIHELVNV--------I 740
            +  +         D  ++S+    ++ + E Y+N  F+K V  +   V+         I
Sbjct: 671 PKKDAVLPEELRELDRWILSRLNSLVKEVREAYENYDFHKVVRALMNFVSEDLSNWYLDI 730

Query: 741 SKPLMEIAKKKSNADR--ISTIRYILEKLIIMMSPMIPHLAEECWQLLGNAGL---VAQQ 795
            K  +      S   R   +T+ +IL+ L+ +++P++P  AEE WQ L        V  +
Sbjct: 731 IKDRLYTEAADSPDRRAAQTTLYHILKALVRLLAPILPFTAEEIWQNLPGERKEESVHLE 790

Query: 796 KWPKLDPILEVNTDII 811
            WP++D  L      +
Sbjct: 791 DWPEVDEELIDVEAAL 806