RPSBLAST alignment for GI: 254780802 and conserved domain: COG0143

>gnl|CDD|30492 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 558
 Score =  101 bits (253), Expect = 8e-22
 Identities = 53/227 (23%), Positives = 89/227 (39%), Gaps = 35/227 (15%)

Query: 31  KNKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENA 90
           K  KK  V    PYP+G  H+GHL  Y+  DV AR++R  GY V    G D  G   E  
Sbjct: 2   KMMKKILVTTALPYPNGPPHLGHLYTYLAADVYARYLRLRGYEVFFLTGTDEHGTKIELK 61

Query: 91  AREHNVHPKMWTYQNIKVMRKQLQSIGLSIDWSKDFA-TCDVDYYHCQQLLFLDFMKHNV 149
           A +  + P+    +N +  ++  +++ +S D   +F  T   ++    Q  FL   ++  
Sbjct: 62  AEKEGITPQELVDKNHEEFKELFKALNISFD---NFIRTTSPEHKELVQEFFLKLYENGD 118

Query: 150 IVRKTAQVNWDPVEQTVLANEQV-----------------------------INGRGWRS 180
           I  +  +  +    +  L +  V                             IN     S
Sbjct: 119 IYLREYEGLYCVSCERFLPDRYVEGTCPKCGGEDARGDQCENCGRTLDPTELINPVCVIS 178

Query: 181 DAPVEQRSLPQWFFKISDLSQELLDSIETLSE--WPEKVKIMQKNWI 225
            A  E R    +FF++S    +LL+  E+  +  WP   +    N++
Sbjct: 179 GATPEVREEEHYFFRLSKFQDKLLEWYESNPDFIWPANRRNEVLNFL 225