RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780803|ref|YP_003065216.1| hypothetical protein CLIBASIA_03470 [Candidatus Liberibacter asiaticus str. psy62] (165 letters) >gnl|CDD|35027 COG5468, COG5468, Predicted secreted (periplasmic) protein [Function unknown]. Length = 172 Score = 62.0 bits (150), Expect = 7e-11 Identities = 33/166 (19%), Positives = 70/166 (42%), Gaps = 11/166 (6%) Query: 2 LYKRILRILVVFNFFLLINSCSVYPFYYLKNQDRTEYIHPIKVLVVSKNNKNEIYRSINF 61 + + + R+ + F+ L +C V P Y + + I++ E+ + F Sbjct: 1 MKRTLARVALAFSLATL-TACQVRPLYSGERAGTESGLASIEISPAGGRGGQEVRNQLIF 59 Query: 62 LTSTVR---TKNLYQLEVNIDSFTDHAIS-------NAFFKNIGRITLKAKYYFKEISGK 111 L S Y L +++ F + + GR+ + A Y + Sbjct: 60 LFSGGAGEPANPQYYLSLSVSRFARGVRLVNVGNDTDRDRPSAGRVVMTADYVLTDAKDG 119 Query: 112 NILYENNTDVTSLFDFSDQQFSQLRSHKSSEEKAIQELSENIYIDI 157 +++ VT+ FD Q+F+++R+ + +E +A +EL+E I +D+ Sbjct: 120 AEVHKGRRSVTASFDRPRQEFAKIRAQRDAENRAARELAEIIQLDL 165 >gnl|CDD|36212 KOG0994, KOG0994, KOG0994, Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]. Length = 1758 Score = 29.7 bits (66), Expect = 0.41 Identities = 9/75 (12%), Positives = 25/75 (33%), Gaps = 1/75 (1%) Query: 79 DSFTDHAISNAFFKNIGRITLKAKYYFKEISGKNILYENN-TDVTSLFDFSDQQFSQLRS 137 + ++S + T + + ++ E +D+T+ + + L+ Sbjct: 1215 AILSAPSVSAEDIAQLASATESLRRQLQALTEDLPQEEETLSDITNSLPLAGKDLESLQR 1274 Query: 138 HKSSEEKAIQELSEN 152 + +EL E Sbjct: 1275 EFNGLLTTYKELREQ 1289 >gnl|CDD|38804 KOG3598, KOG3598, KOG3598, Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription]. Length = 2220 Score = 28.1 bits (62), Expect = 1.2 Identities = 18/66 (27%), Positives = 25/66 (37%), Gaps = 9/66 (13%) Query: 86 ISNAFFKNIGRITLKAKYYFKEISGKNI---LYENNTDVTSLFDFSDQQFSQLRS----- 137 I F IG K NI + E + D+T L DF+ Q ++L Sbjct: 875 IVYNFIDGIGGFLKKNCDDVPAPEVANIICEMMEFSLDITGLIDFAIQLLNELSVVEAEL 934 Query: 138 -HKSSE 142 KSS+ Sbjct: 935 LLKSSD 940 >gnl|CDD|145960 pfam03095, PTPA, Phosphotyrosyl phosphate activator (PTPA) protein. Phosphotyrosyl phosphatase activator (PTPA) proteins stimulate the phosphotyrosyl phosphatase (PTPase) activity of the dimeric form of protein phosphatase 2A (PP2A). PTPase activity in PP2A (in vitro) is relatively low when compared to the better recognized phosphoserine/ threonine protein phosphorylase activity. The specific biological role of PTPA is unknown, Basal expression of PTPA depends on the activity of a ubiquitous transcription factor, Yin Yang 1 (YY1). The tumour suppressor protein p53 can inhibit PTPA expression through an unknown mechanism that negatively controls YY1. Length = 298 Score = 26.7 bits (60), Expect = 3.3 Identities = 10/39 (25%), Positives = 18/39 (46%), Gaps = 7/39 (17%) Query: 133 SQLRSHKSSEEKAI-------QELSENIYIDIISFIRTI 164 +QL H + K+I + E +Y+ I+FI + Sbjct: 201 AQLLGHPYIKPKSIHNEEIVEEYRDEYLYLSCIAFINKV 239 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.138 0.381 Gapped Lambda K H 0.267 0.0713 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,910,340 Number of extensions: 92162 Number of successful extensions: 237 Number of sequences better than 10.0: 1 Number of HSP's gapped: 237 Number of HSP's successfully gapped: 24 Length of query: 165 Length of database: 6,263,737 Length adjustment: 87 Effective length of query: 78 Effective length of database: 4,383,754 Effective search space: 341932812 Effective search space used: 341932812 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 54 (24.6 bits)