RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780803|ref|YP_003065216.1| hypothetical protein CLIBASIA_03470 [Candidatus Liberibacter asiaticus str. psy62] (165 letters) >gnl|CDD|150583 pfam09927, DUF2159, Predicted secreted (periplasmic) protein (DUF2159). This domain, found in various hypothetical prokaryotic proteins, has no known function. Length = 120 Score = 46.1 bits (110), Expect = 4e-06 Identities = 15/89 (16%), Positives = 38/89 (42%), Gaps = 1/89 (1%) Query: 71 LYQLEVNIDSFTDH-AISNAFFKNIGRITLKAKYYFKEISGKNILYENNTDVTSLFDFSD 129 Y+L V +D+ + I +T A Y +++ ++ + +D + Sbjct: 32 RYRLSVRLDTSRESLGIRPDNDTTRYNLTGTATYTLVDLATGKVVASGTVTSFTSYDATG 91 Query: 130 QQFSQLRSHKSSEEKAIQELSENIYIDII 158 ++ L + + +EE+ +EL++ I + Sbjct: 92 STYATLAAERDAEERLARELADQIVTRLA 120 >gnl|CDD|152060 pfam11624, M157, MHC class I-like protein M157. This family of proteins represents M157,a divergent form of MHC class I-like proteins which is the protein product of the mouse cytomegalovirus. This protein is unique in its ability to engage both activating (Ly49H) and inhibitory (Ly49I) natural killer cell receptors. M157 is involved in intra- and intermolecular interacts within and between its domains to form a compact MHC-like molecule. Length = 256 Score = 27.2 bits (60), Expect = 2.1 Identities = 20/72 (27%), Positives = 28/72 (38%), Gaps = 9/72 (12%) Query: 8 RILVVFNFFLLINSCSVYPFYYLKNQDRTEYIHPIKVLVVSKNNKNEIYRSINFLTSTVR 67 RI V + LL S V Y+ ++ R Y + K I + FLT Sbjct: 67 RICVRYTCLLL-KSDVVCDVYHTTDRVRVTYTG--------QTGKINIQGNGTFLTDDAN 117 Query: 68 TKNLYQLEVNID 79 + LY L N+D Sbjct: 118 ERGLYMLLSNVD 129 >gnl|CDD|183156 PRK11478, PRK11478, putative lyase; Provisional. Length = 129 Score = 26.8 bits (59), Expect = 3.1 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Query: 82 TDHAISNAFFKNIGRITLKAKYYFKEI-SGKNILYENNTDVTSLFDF 127 TD+A+S AF+ +I TL+++ Y + S K L N V LF F Sbjct: 15 TDYAVSKAFYCDILGFTLQSEVYREARDSWKGDLALNGQYVIELFSF 61 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.323 0.138 0.381 Gapped Lambda K H 0.267 0.0703 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,561,884 Number of extensions: 148658 Number of successful extensions: 330 Number of sequences better than 10.0: 1 Number of HSP's gapped: 330 Number of HSP's successfully gapped: 32 Length of query: 165 Length of database: 5,994,473 Length adjustment: 86 Effective length of query: 79 Effective length of database: 4,136,185 Effective search space: 326758615 Effective search space used: 326758615 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 53 (24.2 bits)