RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780803|ref|YP_003065216.1| hypothetical protein CLIBASIA_03470 [Candidatus Liberibacter asiaticus str. psy62] (165 letters) >1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} (A:61-246) Length = 186 Score = 26.1 bits (56), Expect = 2.9 Identities = 2/18 (11%), Positives = 4/18 (22%) Query: 77 NIDSFTDHAISNAFFKNI 94 + I F + Sbjct: 168 PDPEASAKNIRQTFDRMA 185 >1iq0_A Arginyl-tRNA synthetase; riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; 2.30A {Thermus thermophilus} (A:99-152,A:233-398) Length = 220 Score = 24.5 bits (53), Expect = 7.4 Identities = 13/73 (17%), Positives = 26/73 (35%), Gaps = 13/73 (17%) Query: 84 HAISNAFFKNIGRITLKAKYYFKEISGKNILYENNTDVTSLFDFSDQQFSQLRSHKSSE- 142 H + A I R +G+ +L N D T D + ++ Sbjct: 24 HLRNIALGDAIAR--------ILAYAGREVLVLNYIDDTRY----DLLVWESDIVRAGLL 71 Query: 143 EKAIQELSENIYI 155 +KA+ L ++ ++ Sbjct: 72 QKALALLEQSPHV 84 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.323 0.138 0.381 Gapped Lambda K H 0.267 0.0695 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,175,274 Number of extensions: 46887 Number of successful extensions: 104 Number of sequences better than 10.0: 1 Number of HSP's gapped: 104 Number of HSP's successfully gapped: 9 Length of query: 165 Length of database: 4,956,049 Length adjustment: 82 Effective length of query: 83 Effective length of database: 2,184,039 Effective search space: 181275237 Effective search space used: 181275237 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 51 (23.5 bits)