BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780803|ref|YP_003065216.1| hypothetical protein CLIBASIA_03470 [Candidatus Liberibacter asiaticus str. psy62] (165 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780803|ref|YP_003065216.1| hypothetical protein CLIBASIA_03470 [Candidatus Liberibacter asiaticus str. psy62] Length = 165 Score = 328 bits (842), Expect = 2e-92, Method: Compositional matrix adjust. Identities = 165/165 (100%), Positives = 165/165 (100%) Query: 1 MLYKRILRILVVFNFFLLINSCSVYPFYYLKNQDRTEYIHPIKVLVVSKNNKNEIYRSIN 60 MLYKRILRILVVFNFFLLINSCSVYPFYYLKNQDRTEYIHPIKVLVVSKNNKNEIYRSIN Sbjct: 1 MLYKRILRILVVFNFFLLINSCSVYPFYYLKNQDRTEYIHPIKVLVVSKNNKNEIYRSIN 60 Query: 61 FLTSTVRTKNLYQLEVNIDSFTDHAISNAFFKNIGRITLKAKYYFKEISGKNILYENNTD 120 FLTSTVRTKNLYQLEVNIDSFTDHAISNAFFKNIGRITLKAKYYFKEISGKNILYENNTD Sbjct: 61 FLTSTVRTKNLYQLEVNIDSFTDHAISNAFFKNIGRITLKAKYYFKEISGKNILYENNTD 120 Query: 121 VTSLFDFSDQQFSQLRSHKSSEEKAIQELSENIYIDIISFIRTIE 165 VTSLFDFSDQQFSQLRSHKSSEEKAIQELSENIYIDIISFIRTIE Sbjct: 121 VTSLFDFSDQQFSQLRSHKSSEEKAIQELSENIYIDIISFIRTIE 165 >gi|254780851|ref|YP_003065264.1| hypothetical protein CLIBASIA_03730 [Candidatus Liberibacter asiaticus str. psy62] Length = 64 Score = 26.2 bits (56), Expect = 0.33, Method: Compositional matrix adjust. Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 10/60 (16%) Query: 52 KNEIYRSINFLTSTVRTKNLYQLEVNIDSFTDHAISNAFFKNIGRITLKAKYYFKEISGK 111 + EIYR +N +T + L ++E D F + N +N + +E+ GK Sbjct: 5 RREIYRWVNLVTGKIANLYLQKIETKDDKFEYCDVWNGQTRN----------WLREVVGK 54 >gi|254780933|ref|YP_003065346.1| valyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 947 Score = 23.9 bits (50), Expect = 1.5, Method: Compositional matrix adjust. Identities = 11/35 (31%), Positives = 20/35 (57%), Gaps = 4/35 (11%) Query: 86 ISNAFFKNIGRITLKAKYYFKEISGKNILYENNTD 120 + +AF I I ++ F+ + GKN+L++ TD Sbjct: 54 MGHAFNTTIQDIMIR----FERMRGKNVLWQPGTD 84 >gi|254780767|ref|YP_003065180.1| lipid-A-disaccharide synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 383 Score = 23.9 bits (50), Expect = 1.7, Method: Compositional matrix adjust. Identities = 14/51 (27%), Positives = 25/51 (49%) Query: 18 LINSCSVYPFYYLKNQDRTEYIHPIKVLVVSKNNKNEIYRSINFLTSTVRT 68 L +S S+ Y +N+ R K+L++ + EIY+ + F S V + Sbjct: 169 LSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVAS 219 >gi|254780364|ref|YP_003064777.1| ferredoxin-NADP+ reductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 224 Score = 21.9 bits (45), Expect = 6.7, Method: Compositional matrix adjust. Identities = 11/44 (25%), Positives = 23/44 (52%), Gaps = 5/44 (11%) Query: 52 KNEIYRSINFLTSTVRTKNLYQLEVNIDSFTDHAISNAFFKNIG 95 K+ I + + F + + LY+ + T+H +S F++N+G Sbjct: 175 KDLIGQKLKFYRTVTQEDYLYKGRI-----TNHILSGEFYRNMG 213 >gi|254780229|ref|YP_003064642.1| hypothetical protein CLIBASIA_00570 [Candidatus Liberibacter asiaticus str. psy62] Length = 1775 Score = 21.2 bits (43), Expect = 9.5, Method: Compositional matrix adjust. Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 8/60 (13%) Query: 42 IKVLVVSKNNKNEIYRSINFLTST------VRTKNLY-QLEVNIDSFTDHAISNAFFKNI 94 IK+ V N K E +S+ + ST +R + L+ +L I+ DH I N+F K++ Sbjct: 1087 IKLSVFDSNTK-ESNKSLAVINSTLEFAHSIRERVLFDELIQGINHIDDHTIYNSFIKDL 1145 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.138 0.381 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 110,564 Number of Sequences: 1233 Number of extensions: 4573 Number of successful extensions: 15 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 8 length of query: 165 length of database: 328,796 effective HSP length: 68 effective length of query: 97 effective length of database: 244,952 effective search space: 23760344 effective search space used: 23760344 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 35 (18.1 bits)