HHsearch results for GI: 254780805 and protein with PDBid: 3o9x_A

>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B*
Probab=93.58  E-value=0.041  Score=32.18  Aligned_cols=34  Identities=12%  Similarity=0.096  Sum_probs=28.8

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999985210111046799997433787786565
Q gi|254780805|r  141 ALGYEQLISEYGYTQNDIGSIVGKSRSHVANILR  174 (300)
Q Consensus       141 A~~~~~l~~~~~~t~~~lA~~~G~s~s~V~~~Lr  174 (300)
                      +.-++++...+|+||.++|+.+|.|+++|+++-+
T Consensus        73 ~e~ir~~R~~~glsQ~elA~~lg~~~~ti~~~E~  106 (133)
T 3o9x_A           73 PEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEK  106 (133)
T ss_dssp             HHHHHHHHHHTTCCHHHHHHHHCSCTTHHHHHHH
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHC
T ss_conf             9999999998499999999995999999999986